SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0022
         (598 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A1YRL7 Cluster: Cationic peptide CP8; n=3; Bombyx|Rep: ...    91   2e-17
UniRef50_A4LA63 Cluster: Cationic peptide CP8; n=1; Manduca sext...    76   6e-13

>UniRef50_A1YRL7 Cluster: Cationic peptide CP8; n=3; Bombyx|Rep:
           Cationic peptide CP8 - Bombyx mandarina (Wild silk moth)
           (Wild silkworm)
          Length = 89

 Score = 90.6 bits (215), Expect = 2e-17
 Identities = 50/88 (56%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +2

Query: 74  AYGALVCGTDYCEKNPX-HTAXXXXXXXXXRXRSQTRWKXXPXCPXLGNLXLXEXCHLQD 250
           AYGALVCGTDYCEKNP              R R   +    P C  L    L E    + 
Sbjct: 6   AYGALVCGTDYCEKNPCIQPPLVCPKNTEHRARHAGKCACCPACVTL----LDEGATCKI 61

Query: 251 LSKELGETPSAVCKEPLKCIKRVCTKLV 334
            SKELGETPSAVCKEPLKCIKRVCTKLV
Sbjct: 62  YSKELGETPSAVCKEPLKCIKRVCTKLV 89


>UniRef50_A4LA63 Cluster: Cationic peptide CP8; n=1; Manduca
           sexta|Rep: Cationic peptide CP8 - Manduca sexta (Tobacco
           hawkmoth) (Tobacco hornworm)
          Length = 105

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 35/102 (34%), Positives = 56/102 (54%)
 Frame = +2

Query: 26  MKTLIFIMLVACVASQAYGALVCGTDYCEKNPXHTAXXXXXXXXXRXRSQTRWKXXPXCP 205
           MK ++ ++++AC  +  YG LVCG++YC+++P  +                       CP
Sbjct: 1   MKAVVVLVVLACAMAVVYGDLVCGSNYCKQHPCGSPIAQSSCRSPSVYRAKHAGKCACCP 60

Query: 206 XLGNLXLXEXCHLQDLSKELGETPSAVCKEPLKCIKRVCTKL 331
               + L E    +  SKELGETPSA+C++PLKC+  VCT++
Sbjct: 61  ACVTM-LGENAACKTYSKELGETPSAICRDPLKCLNGVCTRV 101


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 544,658,900
Number of Sequences: 1657284
Number of extensions: 9391288
Number of successful extensions: 18144
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 17658
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18133
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41902926763
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).