SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0017
         (698 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A7R040 Cluster: Chromosome undetermined scaffold_296, w...    33   8.9  
UniRef50_Q4CTL7 Cluster: Putative uncharacterized protein; n=1; ...    33   8.9  

>UniRef50_A7R040 Cluster: Chromosome undetermined scaffold_296,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_296, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 416

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 18/101 (17%), Positives = 45/101 (44%), Gaps = 2/101 (1%)
 Frame = +1

Query: 313 VQEHDSQPQEKVCSTTKDVFWDRSKIRLLLKL--CLEDRFKNINKQKTLWHDIASHVGTT 486
           +Q  + Q Q  +     +  W +S+++ L+ L   L+ +F+N+  + ++W +I++ + + 
Sbjct: 280 IQNQEIQNQRDLRYDPSNKRWPKSEVQALITLRTTLDHKFRNMGAKGSIWEEISTGMSSM 339

Query: 487 GXXXXXXXXXXXXTYIRLLKKNRLGKEIKWVHYNTCEEVFK 609
           G              I    +   G   K  ++N  + ++K
Sbjct: 340 GYTRTAKKCKEKWENINKYYRRSTGSGKKLPYFNELDVLYK 380


>UniRef50_Q4CTL7 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 2351

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 18/61 (29%), Positives = 29/61 (47%)
 Frame = +1

Query: 307 IIVQEHDSQPQEKVCSTTKDVFWDRSKIRLLLKLCLEDRFKNINKQKTLWHDIASHVGTT 486
           +++Q       E+ CS ++D  W RS I LL K+ L    K I    +L+  +  H+   
Sbjct: 359 LLIQTEKESSSERECSNSQDNLWLRSAISLLFKVVLAS--KKIETLLSLFRWVYRHLKIA 416

Query: 487 G 489
           G
Sbjct: 417 G 417


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 642,849,647
Number of Sequences: 1657284
Number of extensions: 12435827
Number of successful extensions: 29118
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 27992
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29105
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55371905986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).