SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0016
         (598 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A3WN49 Cluster: Putative uncharacterized protein; n=1; ...    35   1.7  
UniRef50_A0D2R8 Cluster: Chromosome undetermined scaffold_35, wh...    33   3.9  

>UniRef50_A3WN49 Cluster: Putative uncharacterized protein; n=1;
           Idiomarina baltica OS145|Rep: Putative uncharacterized
           protein - Idiomarina baltica OS145
          Length = 145

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 24/100 (24%), Positives = 44/100 (44%), Gaps = 2/100 (2%)
 Frame = +1

Query: 244 KKKMSSLLTML*FYGIALPIKQVPTQKTYNYVEKNKYDNIVVLDHSFALGMFKQSIYNQT 423
           K+ M  L   L F G+ LP+  +PT     Y +  ++D I+VL  S    M+     N  
Sbjct: 3   KRIMGMLGAALLFVGMFLPVFSMPTIDDITYFQNGRFDRIIVLSAS-VFAMYFAFARNSK 61

Query: 424 MLLFTKSSD*ITK--MVVMFYYNVKTALTELRSXTINHEW 537
            L+   +   +      +  Y  V+     +R+ ++N+E+
Sbjct: 62  GLVAAGAMSLVFAGYSFIDMYLQVRDMKASIRTESVNYEF 101


>UniRef50_A0D2R8 Cluster: Chromosome undetermined scaffold_35, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_35,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 533

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 3/83 (3%)
 Frame = +1

Query: 262 LLTML*FYGIALPIKQVPTQKTYNYVE--KNKYDNIVVLDHSFALGMFKQSIYNQTMLLF 435
           LLT+L  +G AL IKQ  T +  N +E   N YD   +   +  + +   SI +  +L +
Sbjct: 3   LLTILIGFGSALMIKQTHTTRGINVIEIDLNNYDEFTIGQSTLVISLTYNSIISYPILSY 62

Query: 436 TKSSD-*ITKMVVMFYYNVKTAL 501
              ++  I K ++     VKT +
Sbjct: 63  CSITNLNIIKSIISSISQVKTQI 85


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 436,331,654
Number of Sequences: 1657284
Number of extensions: 6977704
Number of successful extensions: 14415
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 13998
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14411
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41902926763
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).