SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0015
         (598 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P04350 Cluster: Tubulin beta-4 chain; n=4602; root|Rep:...   179   4e-44
UniRef50_P52275 Cluster: Tubulin beta-2 chain; n=115; Bilateria|...   178   9e-44
UniRef50_Q9VAX7 Cluster: CG4869-PA; n=8; Eukaryota|Rep: CG4869-P...   168   1e-40
UniRef50_UPI0000E4A877 Cluster: PREDICTED: similar to beta-tubul...   167   1e-40
UniRef50_Q8J1D5 Cluster: Beta-tubulin; n=5; Pezizomycotina|Rep: ...   157   1e-37
UniRef50_UPI00005A581E Cluster: PREDICTED: similar to tubulin, b...   134   1e-30
UniRef50_Q26236 Cluster: Beta-tubulin; n=5; Eukaryota|Rep: Beta-...   126   5e-28
UniRef50_A2FXL6 Cluster: Tubulin beta chain, putative; n=1; Tric...   116   3e-25
UniRef50_Q227Z6 Cluster: Tubulin/FtsZ family, GTPase domain cont...   111   9e-24
UniRef50_UPI00005639CD Cluster: UPI00005639CD related cluster; n...   109   6e-23
UniRef50_P68363 Cluster: Tubulin alpha-1B chain; n=970; Eukaryot...   100   3e-20
UniRef50_P09733 Cluster: Tubulin alpha-1 chain; n=493; Eukaryota...    97   2e-19
UniRef50_UPI00005A03AE Cluster: PREDICTED: similar to tubulin, a...    97   4e-19
UniRef50_Q86ZZ0 Cluster: Alpha-tubulin; n=2; Pansporablastina|Re...    97   4e-19
UniRef50_A4HVG1 Cluster: Alpha tubulin; n=2; Leishmania|Rep: Alp...    96   6e-19
UniRef50_Q3HRW7 Cluster: Alpha-tubulin-like protein; n=3; Eukary...    95   1e-18
UniRef50_Q4SEQ2 Cluster: Chromosome 3 SCAF14614, whole genome sh...    95   1e-18
UniRef50_Q8N532 Cluster: TUBA1C protein; n=9; Amniota|Rep: TUBA1...    93   6e-18
UniRef50_A1CPB9 Cluster: Tubulin gamma chain; n=9; Fungi/Metazoa...    85   2e-15
UniRef50_Q2U1M2 Cluster: Beta tubulin; n=649; root|Rep: Beta tub...    84   2e-15
UniRef50_Q3UX10 Cluster: In vitro fertilized eggs cDNA, RIKEN fu...    83   6e-15
UniRef50_Q7Z1L8 Cluster: Alpha-tubulin; n=2; Eukaryota|Rep: Alph...    82   1e-14
UniRef50_Q0D0J3 Cluster: Tubulin gamma chain; n=6; Fungi/Metazoa...    81   1e-14
UniRef50_A6RFR4 Cluster: Tubulin gamma chain; n=1; Ajellomyces c...    81   2e-14
UniRef50_Q9VRX3 Cluster: Probable tubulin beta chain CG32396; n=...    79   6e-14
UniRef50_P23258 Cluster: Tubulin gamma-1 chain; n=213; cellular ...    78   2e-13
UniRef50_UPI0000DB78C0 Cluster: PREDICTED: similar to Tubulin al...    77   2e-13
UniRef50_A6RQ51 Cluster: Putative uncharacterized protein; n=1; ...    77   2e-13
UniRef50_P54401 Cluster: Tubulin gamma chain; n=3; Entamoeba his...    77   2e-13
UniRef50_Q4S6A2 Cluster: Chromosome 9 SCAF14729, whole genome sh...    77   3e-13
UniRef50_A5HWB6 Cluster: Bacterial tubulin B; n=8; Prosthecobact...    75   1e-12
UniRef50_Q3ZJ98 Cluster: Tubulin gamma subunit; n=1; Monocercomo...    74   2e-12
UniRef50_P78672 Cluster: Beta-tubulin; n=3; Hypocreales|Rep: Bet...    72   9e-12
UniRef50_Q9UJT0 Cluster: Tubulin epsilon chain; n=30; Eukaryota|...    71   2e-11
UniRef50_A7M6D9 Cluster: Alpha-tubulin; n=1; Dugesia ryukyuensis...    71   2e-11
UniRef50_Q7R2Q0 Cluster: GLP_546_6876_8351; n=1; Giardia lamblia...    71   3e-11
UniRef50_Q4QC95 Cluster: Epsilon tubulin, putative; n=6; Trypano...    71   3e-11
UniRef50_UPI0000E1F213 Cluster: PREDICTED: hypothetical protein;...    70   5e-11
UniRef50_Q9D6T1 Cluster: Tubulin epsilon chain; n=9; Eukaryota|R...    70   5e-11
UniRef50_P34475 Cluster: Tubulin gamma chain; n=2; Caenorhabditi...    68   1e-10
UniRef50_A7NXT4 Cluster: Chromosome chr5 scaffold_2, whole genom...    68   2e-10
UniRef50_UPI0000F1FF49 Cluster: PREDICTED: hypothetical protein;...    66   4e-10
UniRef50_UPI00006CA67A Cluster: Tubulin/FtsZ family, GTPase doma...    66   8e-10
UniRef50_Q402S5 Cluster: Beta-tubulin; n=6; Trichocomaceae|Rep: ...    65   1e-09
UniRef50_UPI00015B54E0 Cluster: PREDICTED: similar to Tubulin, e...    65   1e-09
UniRef50_A2EAH1 Cluster: Gamma tubulin, putative; n=5; Eukaryota...    64   2e-09
UniRef50_UPI0000660846 Cluster: Homolog of Notothenia coriiceps ...    63   4e-09
UniRef50_Q22YZ9 Cluster: Tubulin/FtsZ family, GTPase domain cont...    63   6e-09
UniRef50_Q8SRD2 Cluster: Tubulin gamma chain; n=1; Encephalitozo...    63   6e-09
UniRef50_Q4UCK3 Cluster: Tubulin gamma-chain (Gamma-tubulin), pu...    62   1e-08
UniRef50_UPI0000DB71EB Cluster: PREDICTED: similar to epsilon-tu...    62   1e-08
UniRef50_Q24D61 Cluster: Tubulin/FtsZ family, GTPase domain cont...    61   2e-08
UniRef50_Q22CD2 Cluster: Tubulin/FtsZ family, GTPase domain cont...    60   3e-08
UniRef50_Q23WP5 Cluster: Tubulin/FtsZ family, GTPase domain cont...    60   4e-08
UniRef50_Q8T887 Cluster: Delta-tubulin; n=1; Ciona intestinalis|...    59   9e-08
UniRef50_Q3SEG3 Cluster: Beta tubulin,putative; n=2; Paramecium ...    59   9e-08
UniRef50_A5HWB9 Cluster: Bacterial tubulin A2; n=7; Prosthecobac...    58   2e-07
UniRef50_Q4P3J3 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q9UJT1 Cluster: Tubulin delta chain; n=35; Euteleostomi...    58   2e-07
UniRef50_UPI0000EB22D9 Cluster: Tubulin delta chain (Delta tubul...    57   3e-07
UniRef50_O22416 Cluster: Tubulin Uni3; n=1; Chlamydomonas reinha...    57   3e-07
UniRef50_Q3SEH6 Cluster: Iota_tubulin,putative; n=2; Paramecium ...    57   4e-07
UniRef50_Q22UN3 Cluster: Tubulin/FtsZ family, GTPase domain cont...    57   4e-07
UniRef50_Q5B300 Cluster: Putative uncharacterized protein; n=1; ...    57   4e-07
UniRef50_A2ELX8 Cluster: Tubulin/FtsZ family, GTPase domain cont...    56   5e-07
UniRef50_UPI00005A4366 Cluster: PREDICTED: similar to tubulin, a...    56   8e-07
UniRef50_Q3SEF7 Cluster: Alpha-tubulin,putative; n=3; Paramecium...    56   8e-07
UniRef50_A2FJ63 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_Q8IK81 Cluster: Tubulin, putative; n=9; Plasmodium|Rep:...    53   4e-06
UniRef50_Q7R6N2 Cluster: GLP_170_87302_88000; n=1; Giardia lambl...    53   4e-06
UniRef50_Q3SEF9 Cluster: Alpha-tubulin,putative; n=1; Paramecium...    52   1e-05
UniRef50_Q24D62 Cluster: Tubulin/FtsZ family, GTPase domain cont...    52   1e-05
UniRef50_UPI0000584751 Cluster: PREDICTED: similar to tubulin, d...    51   2e-05
UniRef50_Q24HJ8 Cluster: Tubulin/FtsZ family, GTPase domain cont...    51   2e-05
UniRef50_Q4CWT7 Cluster: Delta tubulin, putative; n=4; Trypanoso...    51   2e-05
UniRef50_P53378 Cluster: Tubulin gamma chain; n=5; Saccharomycet...    51   2e-05
UniRef50_Q6A208 Cluster: Delta tubulin; n=1; Oikopleura dioica|R...    50   4e-05
UniRef50_UPI00006CCC73 Cluster: Tubulin/FtsZ family, GTPase doma...    49   1e-04
UniRef50_A7SA70 Cluster: Predicted protein; n=1; Nematostella ve...    49   1e-04
UniRef50_O93807 Cluster: Tubulin gamma chain; n=8; Saccharomycet...    49   1e-04
UniRef50_UPI00015B628B Cluster: PREDICTED: hypothetical protein;...    48   1e-04
UniRef50_UPI0000E1EF15 Cluster: PREDICTED: similar to alpha-2-tu...    48   1e-04
UniRef50_Q4S982 Cluster: Chromosome 3 SCAF14700, whole genome sh...    48   2e-04
UniRef50_Q862L2 Cluster: Similar to alpha-tubulin isoform 1; n=1...    48   2e-04
UniRef50_Q7QZN1 Cluster: GLP_680_43068_44504; n=1; Giardia lambl...    48   2e-04
UniRef50_UPI0000D5556D Cluster: PREDICTED: similar to epsilon-tu...    47   3e-04
UniRef50_Q9SEA4 Cluster: Tubulin gamma chain, nucleomorph; n=1; ...    47   4e-04
UniRef50_UPI0000DC0F37 Cluster: UPI0000DC0F37 related cluster; n...    46   5e-04
UniRef50_A0BQ86 Cluster: Chromosome undetermined scaffold_120, w...    46   7e-04
UniRef50_Q8I2I0 Cluster: Delta tubulin, putative; n=1; Plasmodiu...    45   0.001
UniRef50_Q8K5B7 Cluster: Neuron-specific class III beta-tubulin;...    44   0.002
UniRef50_A7RI16 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.003
UniRef50_A4H729 Cluster: Alpha tubulin; n=5; Trypanosomatidae|Re...    44   0.003
UniRef50_UPI0000EB04B1 Cluster: UPI0000EB04B1 related cluster; n...    44   0.004
UniRef50_A2F2M2 Cluster: Tubulin/FtsZ family, GTPase domain cont...    44   0.004
UniRef50_A1BPT4 Cluster: Tubulin-like protein; n=1; Lygus lineol...    44   0.004
UniRef50_Q3SEG5 Cluster: Alpha tubulin,putative; n=1; Paramecium...    43   0.005
UniRef50_Q3SEG4 Cluster: Alpha-tubulin,putative; n=1; Paramecium...    43   0.005
UniRef50_Q9XFV1 Cluster: Putative uncharacterized protein; n=1; ...    42   0.008
UniRef50_A0EC94 Cluster: Chromosome undetermined scaffold_89, wh...    42   0.008
UniRef50_Q4QCZ3 Cluster: Zeta tubulin, putative; n=2; Leishmania...    42   0.011
UniRef50_Q4DS09 Cluster: Zeta tubulin, putative; n=4; Trypanosom...    42   0.015
UniRef50_Q2XVP6 Cluster: Beta 5-tubulin; n=2; Eutheria|Rep: Beta...    41   0.025
UniRef50_Q3SEH2 Cluster: Alpha_tubulin,putative; n=5; Paramecium...    40   0.034
UniRef50_A5KEA7 Cluster: Delta tubulin, putative; n=1; Plasmodiu...    40   0.044
UniRef50_Q8AVA7 Cluster: Cryptic tubulin; n=3; Tetrapoda|Rep: Cr...    40   0.059
UniRef50_Q6AU00 Cluster: Alpha tubulin; n=1; Oryza sativa (japon...    40   0.059
UniRef50_A0JJL8 Cluster: Beta-tubulin; n=13; Sordariomycetes|Rep...    40   0.059
UniRef50_A7ARU2 Cluster: Tubulin, putative; n=1; Babesia bovis|R...    39   0.078
UniRef50_Q3SEG6 Cluster: Beta_tubulin,putative; n=1; Paramecium ...    38   0.18 
UniRef50_A5C6C9 Cluster: Serine/threonine protein phosphatase; n...    38   0.24 
UniRef50_UPI0000DB7B89 Cluster: PREDICTED: similar to delta-tubu...    37   0.41 
UniRef50_Q4XML3 Cluster: Delta tubulin, putative; n=5; Plasmodiu...    36   0.55 
UniRef50_Q8J1W3 Cluster: Beta-tubulin; n=1; Colletotrichum sp.|R...    36   0.96 
UniRef50_Q4S633 Cluster: Chromosome 9 SCAF14729, whole genome sh...    35   1.3  
UniRef50_UPI00005A461E Cluster: PREDICTED: hypothetical protein ...    35   1.7  
UniRef50_Q4Q0R3 Cluster: Delta tubulin, putative; n=3; Leishmani...    35   1.7  
UniRef50_UPI000049A5F8 Cluster: hypothetical protein 149.t00006;...    34   2.9  
UniRef50_Q3SEH3 Cluster: Beta_tubulin,putative; n=4; Paramecium ...    34   2.9  
UniRef50_A0BVH8 Cluster: Chromosome undetermined scaffold_13, wh...    34   2.9  
UniRef50_Q6NN85 Cluster: Protein phosphatase Slingshot; n=5; Sop...    34   2.9  
UniRef50_Q7SB97 Cluster: Sorting nexin mvp-1; n=9; Pezizomycotin...    34   2.9  
UniRef50_UPI0000DC0C7D Cluster: UPI0000DC0C7D related cluster; n...    33   3.9  
UniRef50_Q7XSJ2 Cluster: OSJNBb0085C12.3 protein; n=2; Oryza sat...    33   3.9  
UniRef50_A3AU36 Cluster: Putative uncharacterized protein; n=1; ...    33   3.9  
UniRef50_UPI0000DD8653 Cluster: PREDICTED: hypothetical protein;...    33   5.1  
UniRef50_Q0UET6 Cluster: Putative uncharacterized protein; n=1; ...    33   5.1  
UniRef50_UPI0000DD82B6 Cluster: PREDICTED: hypothetical protein;...    33   6.7  
UniRef50_Q74AC9 Cluster: Putative uncharacterized protein; n=6; ...    33   6.7  
UniRef50_Q1GTZ1 Cluster: Short-chain dehydrogenase/reductase SDR...    33   6.7  
UniRef50_Q75I84 Cluster: Putative uncharacterized protein OSJNBa...    33   6.7  
UniRef50_UPI0000EB078E Cluster: UPI0000EB078E related cluster; n...    32   8.9  
UniRef50_Q0RVI3 Cluster: Aldehyde dehydrogenase; n=1; Rhodococcu...    32   8.9  
UniRef50_A3HX59 Cluster: Putative uncharacterized protein; n=1; ...    32   8.9  
UniRef50_Q01IW3 Cluster: OSIGBa0102I15.7 protein; n=18; Oryza sa...    32   8.9  

>UniRef50_P04350 Cluster: Tubulin beta-4 chain; n=4602; root|Rep:
           Tubulin beta-4 chain - Homo sapiens (Human)
          Length = 444

 Score =  179 bits (436), Expect = 4e-44
 Identities = 80/87 (91%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GG YVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDAVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>UniRef50_P52275 Cluster: Tubulin beta-2 chain; n=115;
           Bilateria|Rep: Tubulin beta-2 chain - Caenorhabditis
           elegans
          Length = 450

 Score =  178 bits (433), Expect = 9e-44
 Identities = 78/87 (89%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+ GKYVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  IDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDV+RKEAEGCDCL+ F
Sbjct: 107 TEGAELVDNVLDVIRKEAEGCDCLQGF 133



 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 35/45 (77%), Positives = 40/45 (88%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIG+KFWEVISDEHGI   G + G++DLQLE
Sbjct: 1   MREIVHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGETDLQLE 45


>UniRef50_Q9VAX7 Cluster: CG4869-PA; n=8; Eukaryota|Rep: CG4869-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 522

 Score =  168 bits (408), Expect = 1e-40
 Identities = 72/87 (82%), Positives = 82/87 (94%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEAS GKYVPRAV++DLEPGTMDSVR  P GQ+FRPDNFV+GQSGAGNNWAKGHY
Sbjct: 47  IDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVL+V+RKE+EGCDCL+ F
Sbjct: 107 TEGAELIDSVLEVLRKESEGCDCLQGF 133



 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 35/45 (77%), Positives = 39/45 (86%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIG+KFWE+ISDEHGID  G Y G+S LQ E
Sbjct: 1   MREIVHLQAGQCGNQIGSKFWEIISDEHGIDPNGYYHGESALQHE 45


>UniRef50_UPI0000E4A877 Cluster: PREDICTED: similar to beta-tubulin,
           partial; n=3; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to beta-tubulin, partial -
           Strongylocentrotus purpuratus
          Length = 224

 Score =  167 bits (407), Expect = 1e-40
 Identities = 71/85 (83%), Positives = 82/85 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GG+YVPRAV++DLEPGT+DSV SGPFGQIFRPDNF+FGQSGA NNWAKGH+
Sbjct: 18  INVYYNEAAGGQYVPRAVLLDLEPGTLDSVHSGPFGQIFRPDNFIFGQSGAENNWAKGHF 77

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLR 511
           TEGAEL+ SV+DVVRKEAEGCDC++
Sbjct: 78  TEGAELIHSVMDVVRKEAEGCDCIQ 102



 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 30/40 (75%), Positives = 38/40 (95%)
 Frame = +2

Query: 398 QSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           QSGAGNNWAKGH+TEGA+L+ SV+D+VRKEA+GCDC++ F
Sbjct: 102 QSGAGNNWAKGHFTEGAKLIHSVMDIVRKEAKGCDCIQGF 141


>UniRef50_Q8J1D5 Cluster: Beta-tubulin; n=5; Pezizomycotina|Rep:
           Beta-tubulin - Nephromopsis leucostigma
          Length = 239

 Score =  157 bits (382), Expect = 1e-37
 Identities = 69/81 (85%), Positives = 76/81 (93%)
 Frame = +2

Query: 275 EASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAEL 454
           +AS  KYVPRAV+VDLEPGTMD+VR+GPF Q+FRPDNFVFGQSGAGNNWAKGHYTEGAEL
Sbjct: 4   QASNNKYVPRAVLVDLEPGTMDAVRAGPFXQLFRPDNFVFGQSGAGNNWAKGHYTEGAEL 63

Query: 455 VDSVLDVVRKEAEGCDCLRVF 517
           VD VLDVVR+EAEGCDCL+ F
Sbjct: 64  VDQVLDVVRREAEGCDCLQGF 84


>UniRef50_UPI00005A581E Cluster: PREDICTED: similar to tubulin, beta
           3; n=2; Canis lupus familiaris|Rep: PREDICTED: similar
           to tubulin, beta 3 - Canis familiaris
          Length = 363

 Score =  134 bits (325), Expect = 1e-30
 Identities = 59/80 (73%), Positives = 67/80 (83%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYY EAS  KY+PRA+ VDLEPGT+DSVRSG FG +FRPDNF+FGQSG GNNW KGHY
Sbjct: 47  ISVYYKEASSHKYMPRAIRVDLEPGTLDSVRSGAFGHLFRPDNFIFGQSGDGNNWGKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEG 496
           TEGAELVDSVLD++     G
Sbjct: 107 TEGAELVDSVLDMLTHSLGG 126



 Score = 82.2 bits (194), Expect = 8e-15
 Identities = 37/45 (82%), Positives = 39/45 (86%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQA QCGNQI AKFWEVISD+H ID +G Y GDSDLQLE
Sbjct: 1   MREIVHIQASQCGNQIRAKFWEVISDKHSIDPSGNYVGDSDLQLE 45


>UniRef50_Q26236 Cluster: Beta-tubulin; n=5; Eukaryota|Rep:
           Beta-tubulin - Reticulomyxa filosa
          Length = 473

 Score =  126 bits (303), Expect = 5e-28
 Identities = 50/87 (57%), Positives = 70/87 (80%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I VY+ EA   +YVPRA++VDLEPG ++ +++ P G++F+PDNF+FG SGAGNNW KGHY
Sbjct: 53  IGVYFREAGEKRYVPRAILVDLEPGILEVIKAAPTGKMFKPDNFIFGASGAGNNWGKGHY 112

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGA+L++  ++VVR+EAE CD  + F
Sbjct: 113 TEGAQLIEECVEVVRREAESCDAPQGF 139



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 20/37 (54%), Positives = 26/37 (70%)
 Frame = +3

Query: 117 IMREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAY 227
           ++REIVH+Q GQCGNQIG  FWE +  EH +   G +
Sbjct: 1   MVREIVHVQVGQCGNQIGNVFWETMCKEHHLAEDGKF 37


>UniRef50_A2FXL6 Cluster: Tubulin beta chain, putative; n=1;
           Trichomonas vaginalis G3|Rep: Tubulin beta chain,
           putative - Trichomonas vaginalis G3
          Length = 168

 Score =  116 bits (280), Expect = 3e-25
 Identities = 48/62 (77%), Positives = 58/62 (93%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           +INVY+NEA   +YVPRAV+VD+EPGTMDSVR+G +GQ+FRPDNF+FGQSGAGNNWAKG+
Sbjct: 47  NINVYFNEAINTRYVPRAVLVDMEPGTMDSVRAGQYGQLFRPDNFIFGQSGAGNNWAKGY 106

Query: 434 YT 439
           YT
Sbjct: 107 YT 108



 Score = 90.2 bits (214), Expect = 3e-17
 Identities = 38/46 (82%), Positives = 42/46 (91%)
 Frame = +3

Query: 117 IMREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           ++REIVHIQAGQCGNQIG KFWEV+SDEHG+D TG Y GDSDLQLE
Sbjct: 1   MVREIVHIQAGQCGNQIGTKFWEVVSDEHGVDPTGKYYGDSDLQLE 46


>UniRef50_Q227Z6 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 436

 Score =  111 bits (268), Expect = 9e-24
 Identities = 44/87 (50%), Positives = 63/87 (72%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYN+    KYVPRA+++DL+P  ++S+ +   GQ+F+P+N + GQ  A NNWA GHY
Sbjct: 47  IDVYYNQTKADKYVPRAILIDLDPALLNSINTSQIGQLFKPENLIIGQDPAENNWAIGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
             G + +D V++ VRKEAE CDCL+ F
Sbjct: 107 ILGPQYIDQVMETVRKEAEICDCLQGF 133



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 31/45 (68%), Positives = 35/45 (77%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI++IQ GQ GNQIG  +WE IS EHGI  TG + GDSDLQLE
Sbjct: 1   MREILNIQIGQAGNQIGTAYWEEISKEHGIQPTGVHKGDSDLQLE 45


>UniRef50_UPI00005639CD Cluster: UPI00005639CD related cluster; n=1;
           Mus musculus|Rep: UPI00005639CD UniRef100 entry - Mus
           musculus
          Length = 377

 Score =  109 bits (261), Expect = 6e-23
 Identities = 57/87 (65%), Positives = 64/87 (73%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GG YV RA +VDLEP T+DSV SGPFG        VFGQSGAGNN  +   
Sbjct: 47  ISVYYNEATGGNYVSRAALVDLEPSTVDSVCSGPFGS---SQKTVFGQSGAGNN-PRVTN 102

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD  LDVV KEAE  DCL+V+
Sbjct: 103 TEGAELVDVALDVVHKEAESYDCLQVY 129



 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 31/44 (70%), Positives = 36/44 (81%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           +EI+ ++AGQCGNQ+GAKFW VISD H I  TG Y GDSDLQLE
Sbjct: 2   QEIMLLEAGQCGNQMGAKFWIVISDGHSIKPTGTYHGDSDLQLE 45


>UniRef50_P68363 Cluster: Tubulin alpha-1B chain; n=970;
           Eukaryota|Rep: Tubulin alpha-1B chain - Homo sapiens
           (Human)
          Length = 451

 Score =  100 bits (239), Expect = 3e-20
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>UniRef50_P09733 Cluster: Tubulin alpha-1 chain; n=493;
           Eukaryota|Rep: Tubulin alpha-1 chain - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 447

 Score = 97.5 bits (232), Expect = 2e-19
 Identities = 40/86 (46%), Positives = 60/86 (69%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 439
           + +++E   GK+VPRA+ VDLEP  +D VR+GP+  +F P+  + G+  A NN+A+GHYT
Sbjct: 51  STFFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYT 110

Query: 440 EGAELVDSVLDVVRKEAEGCDCLRVF 517
            G E++  VLD +RK A+ CD L+ F
Sbjct: 111 VGREILGDVLDRIRKLADQCDGLQGF 136



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 18/34 (52%), Positives = 21/34 (61%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           MRE++ I  GQ G QIG   WE+ S EHGI   G
Sbjct: 1   MREVISINVGQAGCQIGNACWELYSLEHGIKPDG 34


>UniRef50_UPI00005A03AE Cluster: PREDICTED: similar to tubulin,
           alpha 1; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to tubulin, alpha 1 - Canis familiaris
          Length = 300

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 42/88 (47%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N  ++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 92  SFNTLFSETGAGKHVPRAVFVDLEPTVIDKVRTGTYRQLFHPEQLITGKEDAANNYAQGH 151

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD ++K A+ C  L+ F
Sbjct: 152 YTIGKEIIDLVLDRIQKLADQCTGLQGF 179



 Score = 35.9 bits (79), Expect = 0.72
 Identities = 17/42 (40%), Positives = 20/42 (47%)
 Frame = +3

Query: 111 SAIMREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           +A  RE + I  GQ G QIG   WE+   EHGI        D
Sbjct: 42  AATTRECISIHVGQAGVQIGNACWELYCREHGIQPDAQMPSD 83


>UniRef50_Q86ZZ0 Cluster: Alpha-tubulin; n=2; Pansporablastina|Rep:
           Alpha-tubulin - Trachipleistophora hominis
          Length = 386

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 39/84 (46%), Positives = 59/84 (70%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 445
           +++E+    YVPR VM+DLEPG ++SV+ GPF ++F P+  + G+  A NN+A+GHYT G
Sbjct: 27  FFSESCENTYVPRTVMIDLEPGVIESVQKGPFKKLFHPEQLIHGKEDAANNYARGHYTVG 86

Query: 446 AELVDSVLDVVRKEAEGCDCLRVF 517
            E++D  LD +RK  E C+ L+ F
Sbjct: 87  KEILDESLDRIRKLTENCEGLQGF 110


>UniRef50_A4HVG1 Cluster: Alpha tubulin; n=2; Leishmania|Rep: Alpha
           tubulin - Leishmania infantum
          Length = 327

 Score = 95.9 bits (228), Expect = 6e-19
 Identities = 40/88 (45%), Positives = 59/88 (67%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E   GK+VPR + +DLEP  +D VR+G + Q+F P+  V G+  A NN+A+GH
Sbjct: 140 AFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANNYARGH 199

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD  LD +RK A+ C  L+ F
Sbjct: 200 YTIGKEIVDLALDRIRKLADNCTGLQGF 227



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 21/49 (42%), Positives = 27/49 (55%)
 Frame = +3

Query: 108 FSAIMREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           FSA MRE + I  GQ G Q+G   WE+   EHGI   G+   D  + +E
Sbjct: 90  FSA-MREAICIHIGQAGCQVGNTCWELFCLEHGIQPDGSMPSDKCIGVE 137


>UniRef50_Q3HRW7 Cluster: Alpha-tubulin-like protein; n=3;
           Eukaryota|Rep: Alpha-tubulin-like protein - Solanum
           tuberosum (Potato)
          Length = 237

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 46/105 (43%), Positives = 66/105 (62%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  AFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVFS*LILWEEVLDLVWGLF 568
           YT G E+VD  LD +RK ++     +V   L+L    L LV G F
Sbjct: 108 YTIGKEIVDLCLDRIRKLSDTVLAFKVSWFLMLLVVALVLVLGHF 152



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G Q+G   WE+   EHGI   G    D
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD 39


>UniRef50_Q4SEQ2 Cluster: Chromosome 3 SCAF14614, whole genome
           shotgun sequence; n=2; Euteleostomi|Rep: Chromosome 3
           SCAF14614, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 407

 Score = 94.7 bits (225), Expect = 1e-18
 Identities = 39/77 (50%), Positives = 55/77 (71%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 53  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 112

Query: 434 YTEGAELVDSVLDVVRK 484
           YT G E++D VLD +RK
Sbjct: 113 YTIGKEIIDLVLDRIRK 129



 Score = 37.1 bits (82), Expect = 0.31
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 7   RECISIHVGQAGAQIGNACWELYCLEHGIQPDGQMPSDKTI 47


>UniRef50_Q8N532 Cluster: TUBA1C protein; n=9; Amniota|Rep: TUBA1C
           protein - Homo sapiens (Human)
          Length = 325

 Score = 92.7 bits (220), Expect = 6e-18
 Identities = 38/77 (49%), Positives = 54/77 (70%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRK 484
           YT G E++D VLD + K
Sbjct: 108 YTIGKEIIDLVLDRIHK 124



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>UniRef50_A1CPB9 Cluster: Tubulin gamma chain; n=9; Fungi/Metazoa
           group|Rep: Tubulin gamma chain - Aspergillus clavatus
          Length = 488

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 36/88 (40%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQS--GAGNNWAKGH 433
           +V++ ++   +Y+PRA+++DLEP  + S++SGP+  I+ P+NF  GQ   GAGNNW  G 
Sbjct: 63  DVFFYQSDDTRYIPRAILLDLEPRVLHSIQSGPYKNIYNPENFFIGQQGIGAGNNWGAG- 121

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y  G  + + V D++ +EA+G D L  F
Sbjct: 122 YAAGEVVQEEVFDMIDREADGSDSLEGF 149


>UniRef50_Q2U1M2 Cluster: Beta tubulin; n=649; root|Rep: Beta
           tubulin - Aspergillus oryzae
          Length = 817

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 38/89 (42%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query: 257 INVYYNEA--SGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKG 430
           ++VY++E       YVPRA+++D +  T D + +GP    F   N +F   GAG  WA G
Sbjct: 438 LDVYFSEVITEPQNYVPRAILLDSKSDTRDRICTGPLRTFFHRRNLLFKGYGAGQCWAVG 497

Query: 431 HYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           ++T GAEL+D  +D+VR+EAE C+CL+ F
Sbjct: 498 YHTAGAELIDEAMDMVRREAEECECLQGF 526



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 22/44 (50%), Positives = 31/44 (70%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           +E V++   Q GN IG+ FWE I+DEHG+D +G ++G SD Q E
Sbjct: 395 KENVYVTTFQ-GNNIGSAFWEAITDEHGLDTSGKFTG-SDYQRE 436


>UniRef50_Q3UX10 Cluster: In vitro fertilized eggs cDNA, RIKEN
           full-length enriched library, clone:7420443F16
           product:similar to Alpha tubulin; n=4; Murinae|Rep: In
           vitro fertilized eggs cDNA, RIKEN full-length enriched
           library, clone:7420443F16 product:similar to Alpha
           tubulin - Mus musculus (Mouse)
          Length = 446

 Score = 82.6 bits (195), Expect = 6e-15
 Identities = 34/88 (38%), Positives = 58/88 (65%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S++ +++E   GK+VPR + +DLEP  +D +R G +  +F P+  V G+  A N +A+G 
Sbjct: 55  SLDTFFHETRAGKHVPRTLFMDLEPTVIDGIRVGRYHSLFHPEQLVNGKEDAANTYARGR 114

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y+ G+E+++ VL+ +RK AE C  L+ F
Sbjct: 115 YSVGSEVIELVLERIRKLAEQCSGLQGF 142



 Score = 35.9 bits (79), Expect = 0.72
 Identities = 17/34 (50%), Positives = 19/34 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           MRE + I  GQ G QIG   WE+   EHGI   G
Sbjct: 1   MRECLSIHIGQAGVQIGDACWELYCLEHGIQPDG 34


>UniRef50_Q7Z1L8 Cluster: Alpha-tubulin; n=2; Eukaryota|Rep:
           Alpha-tubulin - Schmidtea polychroa (Freshwater
           planarian flatworm) (Dugesiapolychroa)
          Length = 489

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 31/88 (35%), Positives = 56/88 (63%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N ++ ++   +YVPR + +DLEP  +D +R+G + Q+F PD+ + G+  A +N+A+GH
Sbjct: 47  AFNTFFFQSPSDQYVPRVLSIDLEPTVVDEIRTGTYRQLFHPDSLINGEEDAASNFARGH 106

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +T G  ++D  +  +RK  + CD L  F
Sbjct: 107 FTIGKSIIDVAMAQLRKVVDNCDGLEGF 134



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           M+EI+ I  GQ G Q+    WE+   EHGI A G
Sbjct: 1   MKEIICINIGQAGIQMANAIWELFCQEHGITADG 34


>UniRef50_Q0D0J3 Cluster: Tubulin gamma chain; n=6; Fungi/Metazoa
           group|Rep: Tubulin gamma chain - Aspergillus terreus
           (strain NIH 2624)
          Length = 450

 Score = 81.4 bits (192), Expect = 1e-14
 Identities = 34/78 (43%), Positives = 53/78 (67%), Gaps = 2/78 (2%)
 Frame = +2

Query: 290 KYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQS--GAGNNWAKGHYTEGAELVDS 463
           +Y+PRA+++DLEP  ++S++SGP+  I+ P+NF  GQ   GAGNNW  G Y  G  + + 
Sbjct: 54  RYIPRAILLDLEPRVLNSIQSGPYRNIYNPENFFIGQQGIGAGNNWGAG-YAAGEVVQEE 112

Query: 464 VLDVVRKEAEGCDCLRVF 517
           + D++ +EA+G D L  F
Sbjct: 113 IFDMIDREADGSDSLEGF 130


>UniRef50_A6RFR4 Cluster: Tubulin gamma chain; n=1; Ajellomyces
           capsulatus NAm1|Rep: Tubulin gamma chain - Ajellomyces
           capsulatus NAm1
          Length = 655

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 33/89 (37%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQS--GAGNNWAKGH 433
           +V++ ++   +Y+PRA+++DLEP  ++++++G +  I+ P+NF  G+   GAGNNWA G 
Sbjct: 286 DVFFYQSDDTRYIPRAILLDLEPRVLNTIQTGAYRNIYNPENFFIGRQGIGAGNNWAAG- 344

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVFS 520
           Y  G  + + V D++ +EA+G D L  +S
Sbjct: 345 YAAGEIVQEEVFDMIDREADGSDSLETYS 373



 Score = 49.6 bits (113), Expect = 5e-05
 Identities = 19/33 (57%), Positives = 26/33 (78%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ IQAGQCGN +G++FW+ +  EHGI+  G
Sbjct: 240 REIITIQAGQCGNNVGSQFWQQLCLEHGINKDG 272


>UniRef50_Q9VRX3 Cluster: Probable tubulin beta chain CG32396; n=1;
           Drosophila melanogaster|Rep: Probable tubulin beta chain
           CG32396 - Drosophila melanogaster (Fruit fly)
          Length = 462

 Score = 79.4 bits (187), Expect = 6e-14
 Identities = 33/87 (37%), Positives = 57/87 (65%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INV++N  +  ++  R +++D E  T+  + +    Q++RP+NFV G   AGNN+A+G++
Sbjct: 48  INVFFNATASKRFYARTILIDTEASTIQRLNAS--SQLYRPENFVAGSESAGNNFARGYH 105

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           T+GA ++D VL+  R+E E  D L+ F
Sbjct: 106 TDGAAILDQVLENTRREVESVDSLQGF 132



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 1/46 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGID-ATGAYSGDSDLQLE 254
           MREIV +Q G  GN IG  FW VIS EHG+D A+G + G S LQLE
Sbjct: 1   MREIVTLQIGGAGNAIGDSFWHVISHEHGVDYASGRFGGTSPLQLE 46


>UniRef50_P23258 Cluster: Tubulin gamma-1 chain; n=213; cellular
           organisms|Rep: Tubulin gamma-1 chain - Homo sapiens
           (Human)
          Length = 451

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 31/88 (35%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + + D++ +EA+G D L  F
Sbjct: 108 FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>UniRef50_UPI0000DB78C0 Cluster: PREDICTED: similar to Tubulin
           alpha-6 chain (Alpha-tubulin 6) (Alpha-tubulin isotype
           M-alpha-6); n=1; Apis mellifera|Rep: PREDICTED: similar
           to Tubulin alpha-6 chain (Alpha-tubulin 6)
           (Alpha-tubulin isotype M-alpha-6) - Apis mellifera
          Length = 542

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 32/95 (33%), Positives = 59/95 (62%)
 Frame = +2

Query: 215 HGCLQRRLRPAA*SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 394
           +GCL++   P   ++  +++E+   K  PR +++DLEP  +D +++G + Q+F PD+ V 
Sbjct: 36  NGCLRQGYYPTDPTMCAFFSESQVRKLTPRTMIIDLEPSVIDEIKTGDYKQLFSPDSLVT 95

Query: 395 GQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGC 499
           G+  A NN+A+G+++ G E +  VL  + K  E C
Sbjct: 96  GKQDASNNYARGYHSIGREAIPLVLSRISKIWEAC 130


>UniRef50_A6RQ51 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 573

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 29/71 (40%), Positives = 47/71 (66%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           ++  + E   GKYVPR++ VDL+P  +D +R+G +  +F P+  + G+  A NN+A+GHY
Sbjct: 55  LDTVFTETGNGKYVPRSIFVDLDPSPIDEIRTGDYRSLFHPELLISGKEDAANNYARGHY 114

Query: 437 TEGAELVDSVL 469
           T G E++D  L
Sbjct: 115 TIGKEILDGFL 125


>UniRef50_P54401 Cluster: Tubulin gamma chain; n=3; Entamoeba
           histolytica|Rep: Tubulin gamma chain - Entamoeba
           histolytica
          Length = 451

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 32/87 (36%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF-GQSGAGNNWAKGHY 436
           +V++ +A   +YVPR++ +DLEP  +DS+R+  +   + P+NF+    +GAGN+WA G+Y
Sbjct: 48  DVFFYQADDQRYVPRSINIDLEPRVLDSIRTSEWRNFYNPENFIIPTNNGAGNSWANGYY 107

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           T   E +  + +++ +E E CD L  F
Sbjct: 108 T--TEKMSEIEEIIDREVEHCDSLEGF 132



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 18/36 (50%), Positives = 26/36 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYS 230
           REI+ +  GQCGNQ+G++F++ I  EHGI   G+ S
Sbjct: 3   REIITLNVGQCGNQLGSEFFKKICSEHGILPDGSLS 38


>UniRef50_Q4S6A2 Cluster: Chromosome 9 SCAF14729, whole genome
           shotgun sequence; n=6; Euteleostomi|Rep: Chromosome 9
           SCAF14729, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 416

 Score = 77.0 bits (181), Expect = 3e-13
 Identities = 37/88 (42%), Positives = 55/88 (62%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  + +++      +   D  + G+  A NN+A+GH
Sbjct: 49  SFNTFFSETGAGKHVPRAVFVDLEPTVIANLKIKNVYVVL--DELITGKEDAANNYARGH 106

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 107 YTIGKEIIDLVLDRIRKLADQCTGLQGF 134



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 18/43 (41%), Positives = 22/43 (51%)
 Frame = +3

Query: 117 IMREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           ++RE + I  GQ G QIG   WE+   EHGI   G    D  L
Sbjct: 1   MLRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTL 43


>UniRef50_A5HWB6 Cluster: Bacterial tubulin B; n=8;
           Prosthecobacter|Rep: Bacterial tubulin B -
           Prosthecobacter vanneervenii
          Length = 442

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 30/88 (34%), Positives = 52/88 (59%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           ++ V++++   GKY+PRA++VDLEPG +  +  G   Q+F     +    GA NNWA+G+
Sbjct: 65  NMEVFFHKVRDGKYIPRAILVDLEPGVIARIEGGDMAQLFDESCIIRKIPGAANNWARGY 124

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
             EG  ++D +++V+    E    L+ F
Sbjct: 125 NVEGERIIDQIMNVIDAAVEKTKSLQGF 152



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASM 263
           +REI+ I  GQCGNQI  +FW ++  EHG+   G     +++   A+M
Sbjct: 19  VREILSIHVGQCGNQIADRFWRLVLREHGLTEAGTPKEGTNVAANANM 66


>UniRef50_Q3ZJ98 Cluster: Tubulin gamma subunit; n=1;
           Monocercomonoides sp. PA203|Rep: Tubulin gamma subunit -
           Monocercomonoides sp. PA203
          Length = 479

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 32/91 (35%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ----SGAGNNWAK 427
           +V++ +A   ++VPRAV++DLEP  +  +++GP    F P+NF   +     GAGNNW  
Sbjct: 48  DVFFYQADDDRFVPRAVLIDLEPKVIGGIKNGPMKHFFNPENFFMPKISEGRGAGNNWGA 107

Query: 428 GHYTEGAELVDSVLDVVRKEAEGCDCLRVFS 520
           G Y   ++  + + D++ +E +GCD L  F+
Sbjct: 108 G-YEMASKTHEELFDLIDREVDGCDSLEGFT 137



 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 21/40 (52%), Positives = 28/40 (70%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 239
           M EI+ IQ GQCGNQIG +FW+ I+ EHGI+  G    ++
Sbjct: 1   MFEILTIQCGQCGNQIGNEFWKNITTEHGIELDGVLKDEA 40


>UniRef50_P78672 Cluster: Beta-tubulin; n=3; Hypocreales|Rep:
           Beta-tubulin - Gibberella pulicaris
          Length = 93

 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 29/41 (70%), Positives = 34/41 (82%)
 Frame = +3

Query: 132 VHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           VH+Q GQCGNQIGA FW+ IS EHG+D+ G YSG S+LQLE
Sbjct: 1   VHLQTGQCGNQIGAAFWQTISGEHGLDSNGVYSGTSELQLE 41


>UniRef50_Q9UJT0 Cluster: Tubulin epsilon chain; n=30;
           Eukaryota|Rep: Tubulin epsilon chain - Homo sapiens
           (Human)
          Length = 475

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 482 KEAEGCDCLRVF 517
           K AE CDCL+ F
Sbjct: 130 KSAEHCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.059
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 227
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>UniRef50_A7M6D9 Cluster: Alpha-tubulin; n=1; Dugesia
           ryukyuensis|Rep: Alpha-tubulin - Dugesia ryukyuensis
          Length = 534

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 28/86 (32%), Positives = 50/86 (58%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 439
           + ++ E   G +VPRA+ +DLEP  +D +R+  +  ++ PD  +     A NN+A+GH+T
Sbjct: 49  HTFFQEVPSGNFVPRAINIDLEPTVIDEIRTANYRHLWHPDYLINCCEDAANNFARGHFT 108

Query: 440 EGAELVDSVLDVVRKEAEGCDCLRVF 517
            G  +++  LD +RK    C  ++ F
Sbjct: 109 VGKNVIERFLDQLRKCVHACQSVQGF 134



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           MRE++ I  GQ G Q+    WE+   EHGI+A G
Sbjct: 1   MREVISINVGQAGIQMANAAWELFCIEHGIEADG 34


>UniRef50_Q7R2Q0 Cluster: GLP_546_6876_8351; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_546_6876_8351 - Giardia lamblia ATCC
           50803
          Length = 491

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 35/101 (34%), Positives = 59/101 (58%), Gaps = 6/101 (5%)
 Frame = +2

Query: 236 LRPAA*SIN----VYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQS 403
           LRP A + N    V++ ++    YVPRA+++D EPG +  +R+GP  ++  P+N     +
Sbjct: 56  LRPEAYTFNDRKDVFFYQSDDEHYVPRAILLDTEPGVISHIRNGPIKELINPENVYIDST 115

Query: 404 --GAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVFS 520
             GAGN W KG +  G    + +++++ +EA+G D L  FS
Sbjct: 116 GGGAGNIWTKG-FQCGEAGFEKIVEIIDREADGADSLAGFS 155



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 19/33 (57%), Positives = 23/33 (69%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           RE++ IQ GQCGNQIG  FW  +  EHGI+  G
Sbjct: 22  REVITIQCGQCGNQIGEVFWNRLCTEHGINPDG 54


>UniRef50_Q4QC95 Cluster: Epsilon tubulin, putative; n=6;
           Trypanosomatidae|Rep: Epsilon tubulin, putative -
           Leishmania major
          Length = 470

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 31/77 (40%), Positives = 45/77 (58%)
 Frame = +2

Query: 287 GKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSV 466
           G+   R V VD+E G + ++  GP   IF  + FV   SGAGNNWA GH   G   +D++
Sbjct: 51  GRLKARCVAVDMEQGVLHAMLRGPLKDIFDANFFVSDVSGAGNNWAVGHMEYGDRYIDAI 110

Query: 467 LDVVRKEAEGCDCLRVF 517
            + VR + E C+C++ F
Sbjct: 111 AESVRNQVEQCNCIQSF 127



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 15/27 (55%), Positives = 22/27 (81%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEH 203
           REIV +Q GQCGNQ+G ++++V+  EH
Sbjct: 3   REIVTVQVGQCGNQLGQRWFDVMLQEH 29


>UniRef50_UPI0000E1F213 Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 580

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 30/41 (73%), Positives = 35/41 (85%)
 Frame = +2

Query: 395 GQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           GQ GA  NWAKGHYTEGAEL++SV+ VVRKEAE C+CL+ F
Sbjct: 312 GQCGARKNWAKGHYTEGAELMESVMVVVRKEAESCNCLQGF 352


>UniRef50_Q9D6T1 Cluster: Tubulin epsilon chain; n=9; Eukaryota|Rep:
           Tubulin epsilon chain - Mus musculus (Mouse)
          Length = 475

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 29/72 (40%), Positives = 43/72 (59%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G    + +L+ +R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDSKQLITDISGSGNNWAVGHKVFGCLYREQILEKLR 129

Query: 482 KEAEGCDCLRVF 517
           K AE CDCL+ F
Sbjct: 130 KSAEQCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.059
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 227
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>UniRef50_P34475 Cluster: Tubulin gamma chain; n=2;
           Caenorhabditis|Rep: Tubulin gamma chain - Caenorhabditis
           elegans
          Length = 444

 Score = 68.1 bits (159), Expect = 1e-10
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGP-FGQIFRPDNFVFGQ--SGAGNNWAKG 430
           ++ + +A    YVPRAV+VDLEP  ++ +   P F  +F  DN        GAGNNWA G
Sbjct: 50  DLLFYQADDDHYVPRAVLVDLEPRVINGMMQSPNFSNLFNTDNIFMSDHGGGAGNNWASG 109

Query: 431 HYTEGAELVDSVLDVVRKEAEGCDCL 508
            Y +G E+ + ++D++ +EAE  + L
Sbjct: 110 -YCQGQEVQEKIMDIIIREAENTNNL 134



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           ++ +  GQCGNQ+   FW+ + DEHGI+  G  + + D+
Sbjct: 7   LMTVHVGQCGNQLAQAFWKSMVDEHGINERGQTTHEDDM 45


>UniRef50_A7NXT4 Cluster: Chromosome chr5 scaffold_2, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_2, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 100

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 29/45 (64%), Positives = 33/45 (73%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI H+Q GQC NQI AK WEV+  EH ID+ G Y GD +LQLE
Sbjct: 1   MREIFHVQGGQCRNQIEAKLWEVVCIEHDIDSIGRYQGDMELQLE 45



 Score = 32.7 bits (71), Expect = 6.7
 Identities = 12/17 (70%), Positives = 16/17 (94%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRA 307
           +NVYYNEA+ G++VPRA
Sbjct: 47  VNVYYNEANCGRFVPRA 63


>UniRef50_UPI0000F1FF49 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 168

 Score = 66.5 bits (155), Expect = 4e-10
 Identities = 31/42 (73%), Positives = 35/42 (83%)
 Frame = +2

Query: 368 IFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE 493
           I R + F   QSGAGNNWAK HYTEGA++VDSVLDVVRKE+E
Sbjct: 126 IIRMEVFEKRQSGAGNNWAKKHYTEGAKIVDSVLDVVRKESE 167


>UniRef50_UPI00006CA67A Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 452

 Score = 65.7 bits (153), Expect = 8e-10
 Identities = 31/88 (35%), Positives = 49/88 (55%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           ++  +++E+   KYVPR V +DL+   +D +R       FR D  + G+   G+N  +G 
Sbjct: 46  NVTCFFSESEKQKYVPRCVFLDLDATPIDEIRKKS-SSFFRKDCLISGKEDCGSNCVRGK 104

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+ D  LD +R EA  C+ L+ F
Sbjct: 105 YTLGKEICDIALDQIRLEANKCENLQGF 132



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           M EI+++  GQ G Q G ++W+ I  EH I++ G
Sbjct: 1   MGEIINVFVGQYGVQSGQEYWKQICLEHNINSYG 34


>UniRef50_Q402S5 Cluster: Beta-tubulin; n=6; Trichocomaceae|Rep:
           Beta-tubulin - Thysanophora penicillioides
          Length = 62

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 26/37 (70%), Positives = 34/37 (91%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQ 367
           +NVY+  ASG +YVPRAV+VDLEPGTMD++R+GPFG+
Sbjct: 26  MNVYFTAASGDRYVPRAVLVDLEPGTMDAIRAGPFGK 62



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = +3

Query: 189 ISDEHGIDATGAYSGDSDLQLEASMSTITKLQG 287
           I+ EHG+D  G Y+G SDLQLE      T   G
Sbjct: 3   IAAEHGLDGDGHYNGTSDLQLERMNVYFTAASG 35


>UniRef50_UPI00015B54E0 Cluster: PREDICTED: similar to Tubulin,
           epsilon 1; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to Tubulin, epsilon 1 - Nasonia vitripennis
          Length = 478

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 28/72 (38%), Positives = 40/72 (55%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           RAV++D+E   +   R GP   +F     V    G+GNNWA G+YT G E  + + + +R
Sbjct: 86  RAVLIDMEDSVVGRFRQGPLRNLFDQTCTVTNYPGSGNNWAVGYYTHGIEYHNKLEETIR 145

Query: 482 KEAEGCDCLRVF 517
           +  E CDCL  F
Sbjct: 146 RTVEKCDCLHGF 157



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 16/33 (48%), Positives = 23/33 (69%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDAT 218
           M + V +Q GQCGNQIG+ FW ++  E+G+  T
Sbjct: 1   MSQFVTVQVGQCGNQIGSAFWPLVLHEYGVQTT 33


>UniRef50_A2EAH1 Cluster: Gamma tubulin, putative; n=5;
           Eukaryota|Rep: Gamma tubulin, putative - Trichomonas
           vaginalis G3
          Length = 457

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGH 433
           ++++  +  G+Y+PRA+++DLEP  +  +++      F  +N   G   SGAGN W  G 
Sbjct: 49  DIFFYSSDDGRYIPRAILIDLEPRVIMGIKNSELKDFFNAENMYIGVEGSGAGNVWGTG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y EG    ++  ++VR+E E  D L  F
Sbjct: 108 YAEGEAHYEAFSEIVRREVEVADALEGF 135



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 18/33 (54%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           ++I+ IQ GQCGN IG +FW+ +S EHGI   G
Sbjct: 3   KKIITIQVGQCGNSIGLEFWKTLSTEHGIGPDG 35


>UniRef50_UPI0000660846 Cluster: Homolog of Notothenia coriiceps
           "Alpha tubulin.; n=1; Takifugu rubripes|Rep: Homolog of
           Notothenia coriiceps "Alpha tubulin. - Takifugu rubripes
          Length = 306

 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 32/80 (40%), Positives = 46/80 (57%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N ++ E+  GK     V VD EP  +D VRSG + Q+  P+  + G+  A NN+A+GH
Sbjct: 21  SFNTFFGESGAGK-----VFVDQEPTVIDEVRSGSYRQLLHPEQLISGKEDAANNYARGH 75

Query: 434 YTEGAELVDSVLDVVRKEAE 493
           YT   +++D VLD   K  E
Sbjct: 76  YTLWKKIID-VLDRNHKTGE 94


>UniRef50_Q22YZ9 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 498

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 27/72 (37%), Positives = 42/72 (58%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           R+++VD+E G  + +     G +F    F+   SGAGNNWA GH+  G +  D++ + +R
Sbjct: 69  RSIIVDMEEGVTNQLLKSDIGDLFDQRQFINDVSGAGNNWAHGHFFYGNKYRDNMSERIR 128

Query: 482 KEAEGCDCLRVF 517
           K  E CD L+ F
Sbjct: 129 KAVEQCDSLQCF 140



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 20/28 (71%), Positives = 23/28 (82%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEH 203
           MRE++ IQ GQCGNQIGAKFWE+   EH
Sbjct: 1   MRELITIQVGQCGNQIGAKFWELAIKEH 28


>UniRef50_Q8SRD2 Cluster: Tubulin gamma chain; n=1; Encephalitozoon
           cuniculi|Rep: Tubulin gamma chain - Encephalitozoon
           cuniculi
          Length = 434

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 34/87 (39%), Positives = 51/87 (58%), Gaps = 1/87 (1%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSG-AGNNWAKGHY 436
           +V++ +A    +VPRA++VDLEP  +    S  F Q      F+  + G AGNNW  G Y
Sbjct: 47  DVFFYQADDNVFVPRAILVDLEPRVISQAPSF-FSQ---ESIFLSNEGGGAGNNWGHG-Y 101

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
             G  + + V+D++++EAEGCD L  F
Sbjct: 102 CVGKAMGNDVIDMIQREAEGCDALETF 128



 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 22/42 (52%), Positives = 28/42 (66%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE+V +Q GQCGNQ+GA+FW+ +  EHGI   G      DL
Sbjct: 1   MREVVTLQVGQCGNQMGAEFWKTLCKEHGISMCGVLQDSRDL 42


>UniRef50_Q4UCK3 Cluster: Tubulin gamma-chain (Gamma-tubulin),
           putative; n=2; Theileria|Rep: Tubulin gamma-chain
           (Gamma-tubulin), putative - Theileria annulata
          Length = 490

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQS--GAGNNWAKGH 433
           +V++ +    +Y PRA+++DLEP  + S+ +     +F P+N    +   GAGNNW  G 
Sbjct: 48  DVFFFQTGTNRYYPRALLIDLEPRVISSILNSENKNLFNPENVFLSKDSMGAGNNWGVG- 106

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G +  D + ++V +E +  D L  F
Sbjct: 107 YTYGNQFNDELSEIVDREVDNADNLEGF 134



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 18/33 (54%), Positives = 22/33 (66%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           +EIV +  GQCGN IG +FW  I  EHGI+  G
Sbjct: 3   KEIVTLHVGQCGNNIGNEFWNQICLEHGINKDG 35


>UniRef50_UPI0000DB71EB Cluster: PREDICTED: similar to
           epsilon-tubulin 1; n=1; Apis mellifera|Rep: PREDICTED:
           similar to epsilon-tubulin 1 - Apis mellifera
          Length = 420

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 28/76 (36%), Positives = 40/76 (52%)
 Frame = +2

Query: 290 KYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVL 469
           K   RA+++D+E   +  +R GP   +F     V    G+ NNWA G+YT G E  D + 
Sbjct: 42  KVKARAILIDMEDSVIGEIRRGPVRDLFDQTCVVTNYPGSANNWAVGYYTHGTEYYDKLE 101

Query: 470 DVVRKEAEGCDCLRVF 517
           D +R+ AE C  L  F
Sbjct: 102 DNIRRMAEKCSRLHGF 117



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGI 209
           M + + +Q GQCGNQIG+ FW +   E+ +
Sbjct: 1   MSQFISVQVGQCGNQIGSVFWPLALHEYDL 30


>UniRef50_Q24D61 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 441

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/86 (32%), Positives = 52/86 (60%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 439
           NVY+ E   G Y  R++ VD +P  ++ ++      +F   +F++G S + NN+++G Y+
Sbjct: 48  NVYFLETIKGSYCARSIQVDSDPDFINEIQQSYIQNLFSQSSFIYGNSSSNNNFSQG-YS 106

Query: 440 EGAELVDSVLDVVRKEAEGCDCLRVF 517
           +  EL+D V + +R +AE  +CL+ F
Sbjct: 107 Q-LELLDQVQEEIRLQAEQSECLQGF 131



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEA-SMSTITKLQGAST 296
           MREI++IQ G+ GNQIG  FWE +  EH +D  G  +  SD Q E  ++  +  ++G+  
Sbjct: 1   MREIINIQIGKGGNQIGLDFWEALHIEHSLDPYGDLNHSSDYQKEKFNVYFLETIKGSYC 60

Query: 297 SREL 308
           +R +
Sbjct: 61  ARSI 64


>UniRef50_Q22CD2 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 443

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 27/84 (32%), Positives = 48/84 (57%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 445
           +++E   G++VPR+V +DL+  ++D V+ G   Q+F  +  V       N +A+G+Y   
Sbjct: 49  FFSETQSGQFVPRSVYLDLDSNSIDEVKVGSQKQLFNHEFLVSKNDEKANTFARGNYQVS 108

Query: 446 AELVDSVLDVVRKEAEGCDCLRVF 517
           +E ++  LD VR+  E C  L+ F
Sbjct: 109 SEFIEFCLDKVRRLTESCQNLQGF 132


>UniRef50_Q23WP5 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 450

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 24/84 (28%), Positives = 47/84 (55%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 445
           ++ E+   K  P +V +DL+   +D +++G    +++PD  +  +   G  +++G+YT G
Sbjct: 51  FFQESVSEKITPISVFIDLDTEQIDEIKNGQCRTLYKPDCLISSKEDTGGLFSRGYYTAG 110

Query: 446 AELVDSVLDVVRKEAEGCDCLRVF 517
             ++D  +D +RK AE C  L  F
Sbjct: 111 RSILDHSIDQIRKIAESCSYLHGF 134



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 14/34 (41%), Positives = 24/34 (70%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           M++I+ I  GQCG +IG + W++  +EH I+ +G
Sbjct: 1   MKQIITICLGQCGIRIGNQVWKLFCEEHKIELSG 34


>UniRef50_Q8T887 Cluster: Delta-tubulin; n=1; Ciona
           intestinalis|Rep: Delta-tubulin - Ciona intestinalis
           (Transparent sea squirt)
          Length = 453

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 2/85 (2%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQ--IFRPDNFVFGQSGAGNNWAK 427
           S+  +++E   G Y  R+VMVD+EP  ++   SG  G+   +        +SG+GNNWA 
Sbjct: 47  SLKTFFHETGSG-YEARSVMVDMEPKAVNCALSGTSGKGWSYAKRQQFCQKSGSGNNWAY 105

Query: 428 GHYTEGAELVDSVLDVVRKEAEGCD 502
           G         D +LD +R+E E CD
Sbjct: 106 GFKVHAPRCKDGILDCIRREVEKCD 130


>UniRef50_Q3SEG3 Cluster: Beta tubulin,putative; n=2; Paramecium
           tetraurelia|Rep: Beta tubulin,putative - Paramecium
           tetraurelia
          Length = 426

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 31/80 (38%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQS-GAGNNWAKGH 433
           INV++NE S  +++PR + +DLEP ++D +       +    N  F ++ G+GNN+A G 
Sbjct: 46  INVFFNENSRQQFLPRCLFLDLEPKSIDKLFIQK--DVIIDPNCCFSRNCGSGNNYAVGR 103

Query: 434 YTEGAELVDSVLDVVRKEAE 493
           YTEGAEL+D    ++ K  E
Sbjct: 104 YTEGAELMDKCKHILDKYFE 123


>UniRef50_A5HWB9 Cluster: Bacterial tubulin A2; n=7;
           Prosthecobacter|Rep: Bacterial tubulin A2 -
           Prosthecobacter debontii
          Length = 497

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 27/76 (35%), Positives = 42/76 (55%)
 Frame = +2

Query: 275 EASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAEL 454
           + S   YVPR+VMVDLEP  ++ +++   G +F P N +    GAG N+A G+   G E+
Sbjct: 58  DGSSASYVPRSVMVDLEPSVINQIKATT-GSLFNPANLITRMEGAGGNFAVGYMGAGREV 116

Query: 455 VDSVLDVVRKEAEGCD 502
           +   +  +  E   CD
Sbjct: 117 LPEAMARLDYEISKCD 132



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 15/29 (51%), Positives = 18/29 (62%)
 Frame = +3

Query: 138 IQAGQCGNQIGAKFWEVISDEHGIDATGA 224
           +  GQ GNQI + FW  +  EHGID T A
Sbjct: 9   VSVGQAGNQIASSFWRTLCLEHGIDPTTA 37


>UniRef50_Q4P3J3 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 291

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 26/40 (65%), Positives = 31/40 (77%)
 Frame = +2

Query: 398 QSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +   GNN+AKG+YTEGAEL+D VLDV RKEAE  D L+ F
Sbjct: 27  RKATGNNFAKGYYTEGAELLDQVLDVARKEAEKADMLQGF 66


>UniRef50_Q9UJT1 Cluster: Tubulin delta chain; n=35;
           Euteleostomi|Rep: Tubulin delta chain - Homo sapiens
           (Human)
          Length = 453

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 436
           +++E   G  + RAV+VD+EP  ++ +  ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYS 109

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
             G    +S+++++RKE E CD    F
Sbjct: 110 VHGPRHEESIMNIIRKEVEKCDSFSGF 136



 Score = 32.7 bits (71), Expect = 6.7
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWE-VISDEH 203
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>UniRef50_UPI0000EB22D9 Cluster: Tubulin delta chain (Delta
           tubulin).; n=1; Canis lupus familiaris|Rep: Tubulin
           delta chain (Delta tubulin). - Canis familiaris
          Length = 484

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 436
           +++E   G  + RAV+VD+EP  ++    ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVSIARAVLVDMEPKVINQTLSKAAQSGQWKYAQHSCFCQKEGSGNNWAYGYS 109

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
             G    +S++++++KE E CD L  F
Sbjct: 110 VHGPRHEESIMNLIQKEVEKCDSLSGF 136


>UniRef50_O22416 Cluster: Tubulin Uni3; n=1; Chlamydomonas
           reinhardtii|Rep: Tubulin Uni3 - Chlamydomonas
           reinhardtii
          Length = 532

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 32/93 (34%), Positives = 51/93 (54%), Gaps = 5/93 (5%)
 Frame = +2

Query: 254 SINVYYN-EASGGKYVPRAVMVDLEPGTMDSVRSGPF--GQIFR--PDNFVFGQSGAGNN 418
           +++ Y+   A    Y  R+V++D+EP  +   RS     G  +R     ++  QSG+GNN
Sbjct: 36  AVHEYFRPSADPNLYTARSVLIDMEPKVVAGARSAAAASGSWWRYPSSGYLVMQSGSGNN 95

Query: 419 WAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           WA+G +  G ++ +  LD+VRKE E  D L  F
Sbjct: 96  WAQGFHGYGPQVHEDALDLVRKEVEHADSLTGF 128


>UniRef50_Q3SEH6 Cluster: Iota_tubulin,putative; n=2; Paramecium
           tetraurelia|Rep: Iota_tubulin,putative - Paramecium
           tetraurelia
          Length = 408

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 27/71 (38%), Positives = 42/71 (59%)
 Frame = +2

Query: 290 KYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVL 469
           K +PR ++VD E  T+D +R       + P+NFV G+S     +A G+Y +  +L D ++
Sbjct: 39  KGIPRTILVDNEENTLDKIRGNKNLSYYDPNNFVCGKSAKCLTFASGYYGQN-DLFDEIV 97

Query: 470 DVVRKEAEGCD 502
           + VRKE E CD
Sbjct: 98  ERVRKEQEQCD 108


>UniRef50_Q22UN3 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 431

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 25/82 (30%), Positives = 48/82 (58%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVY+ E     Y PR+++ DL+   ++ V++G   ++F+ +     Q  + N + +G+Y
Sbjct: 44  INVYFEEVKQDVYKPRSIIADLDDQEINRVQNGFLKRLFQSNTSFSKQESSQNIFPRGYY 103

Query: 437 TEGAELVDSVLDVVRKEAEGCD 502
           + GAEL + +   ++K+ E CD
Sbjct: 104 SHGAELKEEIEYEIQKQVEVCD 125


>UniRef50_Q5B300 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 804

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 21/60 (35%), Positives = 34/60 (56%)
 Frame = +2

Query: 269 YNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGA 448
           + E   GK+VPR++ VDL+P  +D +R+G +  +F P+  + G+  A NN     Y   A
Sbjct: 526 FTELGNGKFVPRSIFVDLDPSPIDEIRTGTYRHLFHPEQLISGKEDAANNCLTSEYLRAA 585



 Score = 37.1 bits (82), Expect = 0.31
 Identities = 17/49 (34%), Positives = 25/49 (51%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASMSTIT 275
           I H+  GQ G Q+G   WE+   EHG+ A G  + D    +  + S +T
Sbjct: 476 ICHLHIGQAGTQMGNAAWELYLLEHGLTADGHVNPDITTDIHRNDSYVT 524


>UniRef50_A2ELX8 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Tubulin/FtsZ family, GTPase domain containing protein -
           Trichomonas vaginalis G3
          Length = 434

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 28/72 (38%), Positives = 39/72 (54%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           RAV++D E      + +     IFR  +      GAGNNWA G++  G   +DSVL+ +R
Sbjct: 62  RAVLIDSETNVTKQLETSAIRDIFRGCSISVDVGGAGNNWAVGYHQNGHLQIDSVLEKIR 121

Query: 482 KEAEGCDCLRVF 517
           K AE C+ L  F
Sbjct: 122 KLAEPCNHLESF 133



 Score = 42.3 bits (95), Expect = 0.008
 Identities = 17/28 (60%), Positives = 20/28 (71%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEH 203
           M EI+ +Q GQCGNQIG +FWE    EH
Sbjct: 1   MSEIIFLQIGQCGNQIGWEFWEKALKEH 28


>UniRef50_UPI00005A4366 Cluster: PREDICTED: similar to tubulin,
           alpha 1; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to tubulin, alpha 1 - Canis familiaris
          Length = 128

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 24/57 (42%), Positives = 36/57 (63%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 424
           S N++ +E   GK+VPRAV VDL+P  +D V +G + Q+F P   + G+  A  N+A
Sbjct: 73  SFNIF-SETDAGKHVPRAVSVDLKPRVIDEVHNGTYHQLFHPQQLIAGKKDAAKNYA 128


>UniRef50_Q3SEF7 Cluster: Alpha-tubulin,putative; n=3; Paramecium
           tetraurelia|Rep: Alpha-tubulin,putative - Paramecium
           tetraurelia
          Length = 426

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 28/83 (33%), Positives = 46/83 (55%)
 Frame = +2

Query: 269 YNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGA 448
           YNE +   Y P  + +DL+   ++ V+       ++ ++FV G+  A NN+ + HYT G 
Sbjct: 38  YNE-NETNYFPLTLFMDLDDRMVNEVKKNKLIN-YKTNSFVTGKEDAANNYCRAHYTIGK 95

Query: 449 ELVDSVLDVVRKEAEGCDCLRVF 517
           E+VD  LD +RK+ E  D +  F
Sbjct: 96  EIVDKCLDNIRKQVESVDRIDQF 118


>UniRef50_A2FJ63 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 119

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = +2

Query: 335 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEA 490
           +D V +G + Q+F P+  + G+  A N++A+GHYT   E++D  LD +RK A
Sbjct: 14  IDEVHTGKYRQLFHPEQLISGKEDAANDYARGHYTVSKEIIDFTLDRIRKLA 65


>UniRef50_Q8IK81 Cluster: Tubulin, putative; n=9; Plasmodium|Rep:
           Tubulin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 519

 Score = 53.2 bits (122), Expect = 4e-06
 Identities = 23/73 (31%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLD-VV 478
           RA+++D E G  + +           +N    QSGAGNNW++G+   G ++ ++++D ++
Sbjct: 74  RAILIDTETGVANEIMKSTISPYIDENNIFTQQSGAGNNWSQGYMYYG-KMYENIIDNII 132

Query: 479 RKEAEGCDCLRVF 517
           R+  E CD L+ F
Sbjct: 133 RRNVEKCDSLQSF 145



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 14/28 (50%), Positives = 20/28 (71%)
 Frame = +3

Query: 117 IMREIVHIQAGQCGNQIGAKFWEVISDE 200
           ++REI+ +  GQCGNQ+G +FW V   E
Sbjct: 1   MVREIIFLHVGQCGNQLGHEFWSVAIKE 28


>UniRef50_Q7R6N2 Cluster: GLP_170_87302_88000; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_170_87302_88000 - Giardia lamblia
           ATCC 50803
          Length = 232

 Score = 53.2 bits (122), Expect = 4e-06
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 7/83 (8%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTM-------DSVRSGPFGQIFRPDNFVFGQSGAGNNWA 424
           ++ +AS G    +A+M+D+EP  +       + V  G F   +   + +FGQSG+GNNWA
Sbjct: 39  WFGQASDGSIYAKALMIDMEPKAILKSCLGKNDVIDGRFH--YNARSAIFGQSGSGNNWA 96

Query: 425 KGHYTEGAELVDSVLDVVRKEAE 493
            G+   G   +  +L+ VRK AE
Sbjct: 97  HGYMEHGPRELPKILEGVRKYAE 119


>UniRef50_Q3SEF9 Cluster: Alpha-tubulin,putative; n=1; Paramecium
           tetraurelia|Rep: Alpha-tubulin,putative - Paramecium
           tetraurelia
          Length = 551

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 25/87 (28%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           +++  ++ +  G+YVPRA+  D +P T++++++GP   +F        Q  +G  WA+  
Sbjct: 48  NVDSLFSLSQYGRYVPRAIFFDEDPTTINAIKNGPSRGLFNRSYIHQCQKESGGCWARSF 107

Query: 434 YT-EGAELVDSVLDVVRKEAEGCDCLR 511
            T    E  + + D +RK+ E CD L+
Sbjct: 108 GTIMNQEGEEKIADKIRKQVESCDGLQ 134



 Score = 39.1 bits (87), Expect = 0.078
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQ-LEASMSTITKL 281
           MREI+ +  GQ G QIG   WE+   EH I   G    D  L+ L +++ ++  L
Sbjct: 1   MREIISLHIGQAGLQIGNSLWELFCLEHSIQPDGTVPTDRILEGLNSNVDSLFSL 55


>UniRef50_Q24D62 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 459

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 26/87 (29%), Positives = 49/87 (56%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I VY++E +  +Y  R++++D +P ++  ++   FG +F  + F+  Q  A N + KG  
Sbjct: 47  IGVYFDEQNDKRYKARSLLIDGDPNSIFQIQQSSFGNLFNSNCFIQDQWSAANCFGKGR- 105

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
            +  EL+D V+D +R   E  D ++ F
Sbjct: 106 -QFYELIDLVMDQIRILVEKSDQMQGF 131



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 22/45 (48%), Positives = 28/45 (62%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+++Q GQ GN+IG  FWE +  EH +D  G     SD Q E
Sbjct: 1   MREIINLQIGQGGNKIGQCFWESLCTEHQLDQDGYSDKMSDFQRE 45


>UniRef50_UPI0000584751 Cluster: PREDICTED: similar to tubulin,
           delta 1; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to tubulin, delta 1 -
           Strongylocentrotus purpuratus
          Length = 439

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 5/81 (6%)
 Frame = +2

Query: 275 EASGGKYVP--RAVMVDLEPGTM-DSVRSGPFGQIFR-PDNFVFGQS-GAGNNWAKGHYT 439
           E    K  P  RAVMVD+E   + ++V +      +R PD   F +  GAGNNWA G Y 
Sbjct: 52  EEGSSKTTPSARAVMVDMESKVIQNTVATAKKSGTWRYPDKQQFCRKRGAGNNWADGFYG 111

Query: 440 EGAELVDSVLDVVRKEAEGCD 502
            G+ + + VL++V++E E CD
Sbjct: 112 HGSVVEEQVLEMVQREVEKCD 132



 Score = 32.7 bits (71), Expect = 6.7
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWEVISDE 200
           IV +Q GQCGNQIG  F++ +  +
Sbjct: 3   IVTVQLGQCGNQIGLSFFQTLMSD 26


>UniRef50_Q24HJ8 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=2; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 447

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/82 (30%), Positives = 45/82 (54%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           ++ Y+ E     Y PRA+  DL+   ++S++S    Q+F+    V+   G+ N +A+G Y
Sbjct: 45  LDSYFYEVKENVYKPRALFTDLDDHRINSLQSASLKQLFQGVPTVYSIDGSHNLFARGMY 104

Query: 437 TEGAELVDSVLDVVRKEAEGCD 502
           + G+EL D + + +    E CD
Sbjct: 105 SVGSELKDEIQNQITYLLEQCD 126



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSG-DSDLQLEA 257
           M  IV I  GQCG  I  K W  +  E+GID  G  +  ++D +L++
Sbjct: 1   MSSIVSIAIGQCGISIQEKQWITLLQEYGIDECGIINKLENDKKLDS 47


>UniRef50_Q4CWT7 Cluster: Delta tubulin, putative; n=4;
           Trypanosoma|Rep: Delta tubulin, putative - Trypanosoma
           cruzi
          Length = 571

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 23/77 (29%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +2

Query: 296 VPRAVMVDLEPGTMDSV-RSGPFGQIFRPD--NFVFGQSGAGNNWAKGHYTEGAELVDSV 466
           +PR VM+D+EP  ++ + ++   G  +RP     +    G+ NNWA G++ +G+   + +
Sbjct: 146 LPRCVMIDMEPKVIEGILKNTKNGGAYRPHVRQCITRDEGSANNWACGYFQQGSSRKEEI 205

Query: 467 LDVVRKEAEGCDCLRVF 517
           LD +R+E+E    +  F
Sbjct: 206 LDSLRRESESSGTVGTF 222



 Score = 32.7 bits (71), Expect = 6.7
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +3

Query: 132 VHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASMSTI 272
           VH+  GQCGNQ+G +F + +  E       AY+ D D    A +S++
Sbjct: 85  VHVLVGQCGNQLGTQFLDNLVAE-------AYTSDEDDGFAAQVSSL 124


>UniRef50_P53378 Cluster: Tubulin gamma chain; n=5;
           Saccharomycetales|Rep: Tubulin gamma chain -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 473

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 2/81 (2%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSG--AGNNWAKGHYT 439
           ++ E S  K+ PRA+M+D EP  +  V +  F   F P N      G  AGN+WA G Y 
Sbjct: 53  FFRENSRNKFTPRAIMMDSEPSVIADVEN-TFRGFFDPRNTWVASDGASAGNSWANG-YD 110

Query: 440 EGAELVDSVLDVVRKEAEGCD 502
            G    D +L+ + KE +  D
Sbjct: 111 IGTRNQDDILNKIDKEIDSTD 131



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +QAGQCGN +G   W  ++ EH I   G
Sbjct: 4   EIITLQAGQCGNHVGKFLWSQLAKEHAIGTDG 35


>UniRef50_Q6A208 Cluster: Delta tubulin; n=1; Oikopleura dioica|Rep:
           Delta tubulin - Oikopleura dioica (Tunicate)
          Length = 417

 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNF--VFGQSGAGNNWAKGHYT 439
           ++ E   GKY  R V++D+EP  +++V     G+ +       +  +SG+GNNWA G+  
Sbjct: 31  FFVEKQNGKYYARNVLIDMEPKVIENVLKKSEGKTWNYSKTAAITAKSGSGNNWAFGYSV 90

Query: 440 EGAELVDSVLDVVRKEAEGCD 502
            G    +S+   +RK AE  D
Sbjct: 91  LGDRNQESIQRQIRKLAEDAD 111


>UniRef50_UPI00006CCC73 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 441

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 3/84 (3%)
 Frame = +2

Query: 275 EASGGKYVPRAVMVDLEPGTMDSVRSGPFGQI--FRPDNFVFGQSGAGNNWAKGHYTEGA 448
           E SG K   +++++D+EP  + S  +     +  F P N    Q G+GNNWA G+   G 
Sbjct: 48  EKSGVKNYAKSLLIDMEPKVVQSCLNSHQNDVWEFDPTNCFTQQEGSGNNWAYGYNVHGL 107

Query: 449 ELVDSVLDVVRKEAEGCD-CLRVF 517
           +  D +L   +K  E  D C  +F
Sbjct: 108 KCRDKILQTFQKLLEQIDFCEGIF 131



 Score = 32.3 bits (70), Expect = 8.9
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWEVISDE 200
           IV +Q GQCGNQ+G  F++ + +E
Sbjct: 3   IVCVQLGQCGNQLGNSFYDFLINE 26


>UniRef50_A7SA70 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 474

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 29/75 (38%), Positives = 38/75 (50%), Gaps = 3/75 (4%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRS--GPFGQIFRPDNFVFGQS-GAGNNWAKGHYTEGAELVDSVLD 472
           RAV +D+E   +    S     G    P    F Q  G+GNNWA G    G + +D VLD
Sbjct: 67  RAVSIDMESKVISQTLSEASKSGTWRYPKGQQFSQKRGSGNNWAHGFSEHGPKSIDKVLD 126

Query: 473 VVRKEAEGCDCLRVF 517
           +V++E E CD L  F
Sbjct: 127 LVQREVEKCDRLDGF 141


>UniRef50_O93807 Cluster: Tubulin gamma chain; n=8;
           Saccharomycetales|Rep: Tubulin gamma chain - Candida
           albicans (Yeast)
          Length = 502

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 2/87 (2%)
 Frame = +2

Query: 263 VYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGHY 436
           +++  +    Y PR++++D+EP  +   +S     +F P N       +GA NNW  G Y
Sbjct: 79  LFFTLSDSNTYTPRSILIDMEPSVI--AKSTSALPMFNPRNVHLSNQGNGAANNWING-Y 135

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
             G E  +++L+++ +E + CD L  F
Sbjct: 136 KYGTEEEETLLNLIDREVDKCDNLSNF 162



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 21/47 (44%), Positives = 33/47 (70%), Gaps = 4/47 (8%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATGA---YSGD-SDLQLE 254
           E + +Q GQCGNQ+G ++W+ ++ EHGI + G+   Y  D +DLQL+
Sbjct: 4   ETITLQVGQCGNQVGLQYWQQLATEHGIQSDGSSTPYPKDINDLQLQ 50


>UniRef50_UPI00015B628B Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 456

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 2/74 (2%)
 Frame = +2

Query: 287 GKYVPRAVMVDLEPGTMDSVRSGPFGQ-IFRPDNFVFGQSG-AGNNWAKGHYTEGAELVD 460
           GK + RAV+VD E   ++ + S    +  +R  N +   SG + NNWA G   +G +L +
Sbjct: 75  GKRLARAVLVDTEHKVVNKICSNSSDRWTYRSQNLICQSSGGSANNWAYGSLVKGPQLKN 134

Query: 461 SVLDVVRKEAEGCD 502
            VL++ RKE E  D
Sbjct: 135 DVLEISRKEIEKTD 148


>UniRef50_UPI0000E1EF15 Cluster: PREDICTED: similar to
           alpha-2-tubulin; n=1; Pan troglodytes|Rep: PREDICTED:
           similar to alpha-2-tubulin - Pan troglodytes
          Length = 137

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 20/45 (44%), Positives = 28/45 (62%)
 Frame = +2

Query: 338 DSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLD 472
           D VR+  + Q+F P+  + G   A NN A GHYT G E++D VL+
Sbjct: 93  DGVRTDIYRQLFHPEQLMSGMEDAANNCAHGHYTAGKEIIDLVLE 137


>UniRef50_Q4S982 Cluster: Chromosome 3 SCAF14700, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 3 SCAF14700, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 97

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>UniRef50_Q862L2 Cluster: Similar to alpha-tubulin isoform 1; n=1;
           Bos taurus|Rep: Similar to alpha-tubulin isoform 1 - Bos
           taurus (Bovine)
          Length = 99

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 19/36 (52%), Positives = 26/36 (72%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPF 361
           S N +++E   GK+VPRAV VDLEP  +D VR+G +
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTY 83


>UniRef50_Q7QZN1 Cluster: GLP_680_43068_44504; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_680_43068_44504 - Giardia lamblia
           ATCC 50803
          Length = 478

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 19/28 (67%), Positives = 22/28 (78%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEH 203
           MREI+ +Q GQCGNQIGA+FW  I  EH
Sbjct: 1   MREILVVQTGQCGNQIGAEFWRTILGEH 28



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 2/73 (2%)
 Frame = +2

Query: 290 KYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGHYTEGAELVDS 463
           K   RAV++D+E G ++S+ +     IF     V  +  +GAGNN+  G+   G E    
Sbjct: 61  KLKARAVLIDMEEGVLNSLLTSDINSIFDETLLVKDRVGTGAGNNFGAGYAGYGEEHGQR 120

Query: 464 VLDVVRKEAEGCD 502
            L++++   E CD
Sbjct: 121 ALNIIQHALESCD 133


>UniRef50_UPI0000D5556D Cluster: PREDICTED: similar to
           epsilon-tubulin 1; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to epsilon-tubulin 1 - Tribolium
           castaneum
          Length = 432

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 20/72 (27%), Positives = 36/72 (50%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           R + +D+E   +   +SG    +F   + +    G+GNNWA+G+ + G +    +L  ++
Sbjct: 78  RFLCIDMEDSVVARFKSGRLRDLFDSKSLITHYPGSGNNWAEGYCSHGPKFKQKILKAIQ 137

Query: 482 KEAEGCDCLRVF 517
              E CD L  F
Sbjct: 138 YNVEKCDHLHGF 149



 Score = 36.7 bits (81), Expect = 0.41
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDAT---GAYSGDSDLQLEASMSTITKLQGA 290
           M E + IQ GQCGNQIG+     I  E+G+  T    A    +  +L+  MS+   +   
Sbjct: 1   MSEFIVIQVGQCGNQIGSFLLPEILQEYGVKTTTDSPAKPKRNKAELQQFMSSFFNMDPT 60

Query: 291 STSRE 305
           +T+ E
Sbjct: 61  NTTIE 65


>UniRef50_Q9SEA4 Cluster: Tubulin gamma chain, nucleomorph; n=1;
           Guillardia theta|Rep: Tubulin gamma chain, nucleomorph -
           Guillardia theta (Cryptomonas phi)
          Length = 424

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 20/87 (22%), Positives = 45/87 (51%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 439
           NV++ E++   ++PR ++ DL     + +    + +++  +         GN+W KG+Y 
Sbjct: 46  NVFFEESNESFFIPRTIIFDLSERDFNYIMKSNYSKMYDKNRHFILNKNTGNSWLKGYY- 104

Query: 440 EGAELVDSVLDVVRKEAEGCDCLRVFS 520
           EG    + V +++RK  E  + ++ F+
Sbjct: 105 EGISNCNLVDNILRKRIEKMNSVKYFN 131


>UniRef50_UPI0000DC0F37 Cluster: UPI0000DC0F37 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0F37 UniRef100 entry -
           Rattus norvegicus
          Length = 410

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 22/62 (35%), Positives = 36/62 (58%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E    K++P+A+ + LEP  +D V +G   Q+F P+     Q  A NN A G+
Sbjct: 53  SFNTFFSETGASKHLPQAMFIGLEPTVIDEVCTGICCQLFHPE-LEGRQEDAANNCAYGN 111

Query: 434 YT 439
           Y+
Sbjct: 112 YS 113


>UniRef50_A0BQ86 Cluster: Chromosome undetermined scaffold_120,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_120,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 289

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 17/60 (28%), Positives = 35/60 (58%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 445
           +++E    K+  R++ +DL+  T+D ++   F ++FRP   + G+  A + +A G+Y  G
Sbjct: 100 FFSETGNNKHSQRSLFIDLDRNTIDELKRSQFRELFRPQQMILGKDSAIDIYAGGYYGVG 159


>UniRef50_Q8I2I0 Cluster: Delta tubulin, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Delta tubulin, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 735

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = +2

Query: 371 FRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE 493
           F   NF+ G +G+GNNWA G Y  G  + +  ++++ KE E
Sbjct: 274 FNKSNFICGLNGSGNNWAYGFYVHGKNICEDFINIINKEFE 314



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 11/24 (45%), Positives = 19/24 (79%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVI 191
           M  ++ IQ GQCGNQ+G +F++++
Sbjct: 1   MMGVLSIQIGQCGNQVGYEFFDIL 24


>UniRef50_Q8K5B7 Cluster: Neuron-specific class III beta-tubulin;
           n=6; Fungi/Metazoa group|Rep: Neuron-specific class III
           beta-tubulin - Rattus norvegicus (Rat)
          Length = 19

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAK 176
           MREIVHIQAGQCGNQIGAK
Sbjct: 1   MREIVHIQAGQCGNQIGAK 19


>UniRef50_A7RI16 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 420

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 28/74 (37%), Positives = 38/74 (51%), Gaps = 7/74 (9%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVR--SGPFGQIFRPDNFVFGQSGAGNNWAKGHYTE-----GAELVD 460
           R V VD E   + S R   G  GQ +R  N + G+ G GNN+A G++       G  L+ 
Sbjct: 40  RCVCVDSESKVIASNRRSDGVHGQ-YRDSNIIAGRRGRGNNFALGYHGNSIDEGGTSLLH 98

Query: 461 SVLDVVRKEAEGCD 502
             +D +RKE E CD
Sbjct: 99  MTMDAMRKEVERCD 112


>UniRef50_A4H729 Cluster: Alpha tubulin; n=5; Trypanosomatidae|Rep:
           Alpha tubulin - Leishmania braziliensis
          Length = 267

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAG 412
           + N +++E   GK+VPR++ +DLEP  +D VR+G      +P      Q G G
Sbjct: 82  AFNTFFSETGAGKHVPRSLFLDLEPTVVDEVRTGNVPPAVQPRAAGVWQGGCG 134



 Score = 42.3 bits (95), Expect = 0.008
 Identities = 20/49 (40%), Positives = 26/49 (53%)
 Frame = +3

Query: 108 FSAIMREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           FS  MRE + I  GQ G Q+G   WE+   EHGI   G+   D  + +E
Sbjct: 31  FSPTMREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGVE 79


>UniRef50_UPI0000EB04B1 Cluster: UPI0000EB04B1 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB04B1 UniRef100
           entry - Canis familiaris
          Length = 387

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 22/57 (38%), Positives = 32/57 (56%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 424
           S N  ++E   GK+VPRA+ V   P  +D V +G   Q+F P+    G+  A NN+A
Sbjct: 49  SFNASFSEMGAGKHVPRAMFV---PTVIDEVHTGTDCQLFHPEQLNTGKEDATNNYA 102


>UniRef50_A2F2M2 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Tubulin/FtsZ family, GTPase domain containing protein -
           Trichomonas vaginalis G3
          Length = 432

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 3/81 (3%)
 Frame = +2

Query: 269 YNEASGGKYVPRAVMVDLEPGTMDSVRSGPFG-QIFRPDNF-VFGQS-GAGNNWAKGHYT 439
           + E S  +Y+ R V++D E   +  + S  F  + ++ D   ++ +  G+GNNWA G+  
Sbjct: 41  FYETSDHQYIARTVLIDTERKAITDILSDKFATRNWKYDKCSIWAEGCGSGNNWAYGYDK 100

Query: 440 EGAELVDSVLDVVRKEAEGCD 502
            G    + V+D ++ +AE CD
Sbjct: 101 NGFAAKNEVMDRLQHQAEKCD 121


>UniRef50_A1BPT4 Cluster: Tubulin-like protein; n=1; Lygus
           lineolaris|Rep: Tubulin-like protein - Lygus lineolaris
           (Tarnished plant bug)
          Length = 242

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 19/61 (31%), Positives = 39/61 (63%)
 Frame = +2

Query: 335 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRV 514
           M+S+ +  + ++F+ D  + G   A NN+A+G +T G +++  + D+VR++AE  D ++ 
Sbjct: 1   MESISTTKYCKLFQSDFILKGTEDAANNFARGFHTLGKQMMIPLSDMVRRQAESSDRVQG 60

Query: 515 F 517
           F
Sbjct: 61  F 61


>UniRef50_Q3SEG5 Cluster: Alpha tubulin,putative; n=1; Paramecium
           tetraurelia|Rep: Alpha tubulin,putative - Paramecium
           tetraurelia
          Length = 405

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 22/78 (28%), Positives = 37/78 (47%)
 Frame = +2

Query: 269 YNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGA 448
           + E S   Y PR++ V+    T+D          F P+ F + +   GN +  GHY    
Sbjct: 36  FQENSHQSYKPRSIFVN----TIDDQVPKYDEPQFSPNQFFYTKEDTGNIYTVGHYCVAK 91

Query: 449 ELVDSVLDVVRKEAEGCD 502
           +L+  + D +R++ E CD
Sbjct: 92  DLIPKIQDEIRRQVENCD 109


>UniRef50_Q3SEG4 Cluster: Alpha-tubulin,putative; n=1; Paramecium
           tetraurelia|Rep: Alpha-tubulin,putative - Paramecium
           tetraurelia
          Length = 461

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 18/43 (41%), Positives = 27/43 (62%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQ 248
           MREI+    GQ G Q+ +  WE+   EHGI+  G+ S +S++Q
Sbjct: 1   MREIISFHFGQSGAQLASPLWELYCLEHGINLDGSVSNNSEIQ 43


>UniRef50_Q9XFV1 Cluster: Putative uncharacterized protein; n=1;
           Chlamydomonas sp. HS-5|Rep: Putative uncharacterized
           protein - Chlamydomonas sp. HS-5
          Length = 91

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 23/63 (36%), Positives = 30/63 (47%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASMSTITKLQGASTS 299
           MRE + I  GQ G Q+G   WE+   EHGI   G    D  +     +ST + L+ A  S
Sbjct: 1   MREAISIHIGQAGCQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDVSTRSSLRRAPAS 60

Query: 300 REL 308
             L
Sbjct: 61  TSL 63


>UniRef50_A0EC94 Cluster: Chromosome undetermined scaffold_89, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_89,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 624

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 21/49 (42%), Positives = 27/49 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASMS 266
           MREI+    GQ G QIG   WE++  EHGI   G+     +LQ+  S S
Sbjct: 1   MREILQFHVGQAGIQIGNTAWELLCLEHGIQPDGSAPSSQNLQVLFSES 49



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 3/99 (3%)
 Frame = +2

Query: 215 HGCLQRRLRPAA*SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 394
           HG       P++ ++ V ++E+     VPRA   D +P T++S+  GP  ++   +    
Sbjct: 28  HGIQPDGSAPSSQNLQVLFSESQTKANVPRAAFFDDDPLTINSLNRGPLKKVLNQNLIKL 87

Query: 395 GQSGAGNNWAK---GHYTEGAELVDSVLDVVRKEAEGCD 502
            +  A + WA      Y E      +  ++VRK  E  D
Sbjct: 88  FKDDASSIWASKKITQYDEKDRSSRAADEIVRKMLEAAD 126


>UniRef50_Q4QCZ3 Cluster: Zeta tubulin, putative; n=2;
           Leishmania|Rep: Zeta tubulin, putative - Leishmania
           major
          Length = 605

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 18/45 (40%), Positives = 26/45 (57%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           R ++VD EP  +  V+        R +N ++GQSG GNNW  G+Y
Sbjct: 56  RCILVDTEPKVVLGVQQR-HPDFIRAENVIYGQSGRGNNWGLGYY 99


>UniRef50_Q4DS09 Cluster: Zeta tubulin, putative; n=4;
           Trypanosoma|Rep: Zeta tubulin, putative - Trypanosoma
           cruzi
          Length = 480

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 19/45 (42%), Positives = 27/45 (60%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           R V+VD EP  + +V       + R +N + GQSG GN+WA G+Y
Sbjct: 44  RCVLVDSEPKVVTAVYERQ-KDVLRAENVIHGQSGRGNHWALGYY 87


>UniRef50_Q2XVP6 Cluster: Beta 5-tubulin; n=2; Eutheria|Rep: Beta
           5-tubulin - Sus scrofa (Pig)
          Length = 17

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIG 170
           MREIVHIQAGQCGNQIG
Sbjct: 1   MREIVHIQAGQCGNQIG 17


>UniRef50_Q3SEH2 Cluster: Alpha_tubulin,putative; n=5; Paramecium
           tetraurelia|Rep: Alpha_tubulin,putative - Paramecium
           tetraurelia
          Length = 425

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 27/86 (31%), Positives = 42/86 (48%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 439
           N  YNE  G  Y P A+ VD +   +  V+     + F+  +F+ G+  A   +A+G Y 
Sbjct: 35  NYIYNEVDGNHY-PLALFVDTDDRMIHEVQRNKSVK-FKKHSFLHGKEDA-LTYARGCYD 91

Query: 440 EGAELVDSVLDVVRKEAEGCDCLRVF 517
            G  + D  L+ +RK+ E  D L  F
Sbjct: 92  GGRLIQDEALECIRKQIETMDRLDEF 117


>UniRef50_A5KEA7 Cluster: Delta tubulin, putative; n=1; Plasmodium
           vivax|Rep: Delta tubulin, putative - Plasmodium vivax
          Length = 668

 Score = 39.9 bits (89), Expect = 0.044
 Identities = 14/40 (35%), Positives = 25/40 (62%)
 Frame = +2

Query: 383 NFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCD 502
           NF++G +G+GNNW+ G       + +  L++++KE E  D
Sbjct: 215 NFIYGLNGSGNNWSYGFNVHAKNICEDFLNLIQKEMESND 254


>UniRef50_Q8AVA7 Cluster: Cryptic tubulin; n=3; Tetrapoda|Rep:
           Cryptic tubulin - Xenopus laevis (African clawed frog)
          Length = 423

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 24/71 (33%), Positives = 33/71 (46%), Gaps = 4/71 (5%)
 Frame = +2

Query: 305 AVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVL----D 472
           A+ VD EP  +  +        FR  N + G+ G GNNWA G+   G +   S+L    +
Sbjct: 44  AICVDSEPKVVRKLGKQVTRGNFRDSNLIVGRRGRGNNWAFGYSGVGGDTEKSLLARTME 103

Query: 473 VVRKEAEGCDC 505
             R E E  DC
Sbjct: 104 SFRHELERRDC 114



 Score = 35.5 bits (78), Expect = 0.96
 Identities = 11/21 (52%), Positives = 18/21 (85%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWEVI 191
           +V +Q GQCGNQIG ++W+++
Sbjct: 3   LVWLQVGQCGNQIGQEWWQIV 23


>UniRef50_Q6AU00 Cluster: Alpha tubulin; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Alpha tubulin - Oryza sativa subsp.
           japonica (Rice)
          Length = 195

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G Q+G   WE+   EHGI A G    D
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSD 39


>UniRef50_A0JJL8 Cluster: Beta-tubulin; n=13; Sordariomycetes|Rep:
           Beta-tubulin - Phaeoacremonium venezuelense
          Length = 90

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 24/57 (42%), Positives = 31/57 (54%)
 Frame = +1

Query: 256 HQCLL*RSFRGQVRPASCDGGP*AWNHGLRPFRAVWANLPTGQLRLRTVWGGE*LGE 426
           H+ LL R    QVR     G   A +HG RP R++   +P  QLRLR VW  + LG+
Sbjct: 31  HERLLQRGLWQQVRAPCRPGRLGARHHGCRPCRSLRPAVPPRQLRLRPVWCWQQLGQ 87


>UniRef50_A7ARU2 Cluster: Tubulin, putative; n=1; Babesia bovis|Rep:
           Tubulin, putative - Babesia bovis
          Length = 498

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 18/67 (26%), Positives = 31/67 (46%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           R +++D +  T+  V           +N V G   AGNNW+  ++  G +   +V D++ 
Sbjct: 73  RCILIDTDLSTITEVLQKQHHCHIDNENIVCGTEAAGNNWSVAYFHHGPQYHQTVEDLID 132

Query: 482 KEAEGCD 502
              E CD
Sbjct: 133 HNLEKCD 139


>UniRef50_Q3SEG6 Cluster: Beta_tubulin,putative; n=1; Paramecium
           tetraurelia|Rep: Beta_tubulin,putative - Paramecium
           tetraurelia
          Length = 435

 Score = 37.9 bits (84), Expect = 0.18
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGID 212
           MREI+HI  G CG +IG KF+E +  ++ I+
Sbjct: 1   MREIIHIGLGNCGVRIGCKFYEQLIQDYQIE 31


>UniRef50_A5C6C9 Cluster: Serine/threonine protein phosphatase; n=7;
           Magnoliophyta|Rep: Serine/threonine protein phosphatase
           - Vitis vinifera (Grape)
          Length = 1318

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 24/65 (36%), Positives = 28/65 (43%), Gaps = 5/65 (7%)
 Frame = -3

Query: 470 PVPNQPVQ---PPLCNXLSPSYSPPQ--TVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P PN   Q   PPLCN  S   SPP   T ++RS P+            P    QG PS 
Sbjct: 498 PQPNPATQQAXPPLCNPTSQKLSPPSTTTTQQRSSPLSSSTMQILPSPIPTLTTQGRPSP 557

Query: 305 LAGRT 291
           +A  T
Sbjct: 558 VACST 562


>UniRef50_UPI0000DB7B89 Cluster: PREDICTED: similar to
           delta-tubulin; n=1; Apis mellifera|Rep: PREDICTED:
           similar to delta-tubulin - Apis mellifera
          Length = 365

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +2

Query: 404 GAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCD 502
           G  NNWA G+  +G EL D +L+ +R+E E  D
Sbjct: 58  GCANNWAFGYLVKGYELSDVILNCIRQEIEKLD 90


>UniRef50_Q4XML3 Cluster: Delta tubulin, putative; n=5; Plasmodium
           (Vinckeia)|Rep: Delta tubulin, putative - Plasmodium
           chabaudi
          Length = 709

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 12/44 (27%), Positives = 25/44 (56%)
 Frame = +2

Query: 371 FRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCD 502
           +  +N ++G +G+GNNW+ G       + +  ++++ KE E  D
Sbjct: 241 YNKNNVIYGLNGSGNNWSYGFNVHAKNICEDFINLINKELEKND 284


>UniRef50_Q8J1W3 Cluster: Beta-tubulin; n=1; Colletotrichum sp.|Rep:
           Beta-tubulin - Colletotrichum sp
          Length = 80

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = +3

Query: 189 ISDEHGIDATGAYSGDSDLQLE 254
           IS EHG+D+ G Y+G S+LQLE
Sbjct: 3   ISGEHGLDSNGVYNGTSELQLE 24


>UniRef50_Q4S633 Cluster: Chromosome 9 SCAF14729, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 9 SCAF14729, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 404

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 16/35 (45%), Positives = 19/35 (54%)
 Frame = +3

Query: 117 IMREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           + RE+V I  GQ G QIG   WE+   EH I   G
Sbjct: 1   VQREVVSIHVGQAGVQIGNACWELFCLEHHIGPDG 35



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTM 337
           N +++  S G++VPRAV VDLEP  +
Sbjct: 52  NTFFHTGSSGRHVPRAVYVDLEPSVV 77


>UniRef50_UPI00005A461E Cluster: PREDICTED: hypothetical protein
           XP_863642; n=1; Canis lupus familiaris|Rep: PREDICTED:
           hypothetical protein XP_863642 - Canis familiaris
          Length = 341

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
 Frame = -3

Query: 422 PSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGP--PSQLAGRTCPLK 279
           PS+ PP+  RRRSCP     + +   RSP    QGP  P  L    CP +
Sbjct: 92  PSHGPPERTRRRSCP----CECSSAPRSPSACPQGPSAPDGLPETPCPAR 137


>UniRef50_Q4Q0R3 Cluster: Delta tubulin, putative; n=3;
           Leishmania|Rep: Delta tubulin, putative - Leishmania
           major
          Length = 559

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +2

Query: 377 PDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE 493
           P   V    G+ NNWA G++ +G    D++++ +R+E+E
Sbjct: 152 PQQCVTRGEGSANNWAFGYHQQGQSRRDAIVECLRRESE 190



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = +3

Query: 132 VHIQAGQCGNQIGAKFWEVISDE 200
           VH+  GQCGNQ+G  F + ++ E
Sbjct: 4   VHVFVGQCGNQVGTAFLDTVASE 26


>UniRef50_UPI000049A5F8 Cluster: hypothetical protein 149.t00006;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 149.t00006 - Entamoeba histolytica HM-1:IMSS
          Length = 168

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 17/56 (30%), Positives = 25/56 (44%)
 Frame = -3

Query: 473 HPVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           +P+ NQ VQPP    + P   PP    +   P  +F Q     + P++    PP Q
Sbjct: 114 YPIQNQYVQPPPDQYIQPPL-PPDQFTQPPLPPDQFTQPPPPPQQPYYAPPPPPQQ 168


>UniRef50_Q3SEH3 Cluster: Beta_tubulin,putative; n=4; Paramecium
           tetraurelia|Rep: Beta_tubulin,putative - Paramecium
           tetraurelia
          Length = 439

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQ 248
           MREI+ +Q G  GN++G KFWE    E  ID+   +  D DLQ
Sbjct: 1   MREILVLQLGGFGNKMGVKFWE----EMYIDS--EFESDIDLQ 37



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 29/90 (32%), Positives = 41/90 (45%), Gaps = 2/90 (2%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQI-FRPDN-FVFGQSGAGNNWAK 427
           S N+ +   S    +PR V VDL           P+    F P N F F  S +GNN+  
Sbjct: 47  SSNILFYNLSEKTPLPRTVQVDLGQDL-------PYSNTDFNPCNQFSFNYS-SGNNFGF 98

Query: 428 GHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
                  ++VD + D +R+E E CD L+ F
Sbjct: 99  VKNNCCNQIVDIIFDRIRQEIEQCDSLQGF 128


>UniRef50_A0BVH8 Cluster: Chromosome undetermined scaffold_13, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_13,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 403

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 18/74 (24%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +2

Query: 290 KYVPRAVMVDLEPGTMDS-VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSV 466
           K + +++++D+EP  ++  +++  + + F     +  Q G+GNNWA G    G    +++
Sbjct: 49  KQIAKSLLIDMEPKVVERCLKAEYYDKAFS----LTKQEGSGNNWAYGFNNHGPANKNAI 104

Query: 467 LDVVRKEAEGCDCL 508
           L ++    E C  L
Sbjct: 105 LQIMDTLLEECGYL 118


>UniRef50_Q6NN85 Cluster: Protein phosphatase Slingshot; n=5;
           Sophophora|Rep: Protein phosphatase Slingshot -
           Drosophila melanogaster (Fruit fly)
          Length = 1045

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = -1

Query: 571 SKESPYQIQYLLPENELAENPQTIAAFCFFSNYIQYRINQFSPLCVMXFRPVIPRPRLSE 392
           +K+    ++ L PE  +AE P+ +      SN   Y + Q   L +    P+  R R+ +
Sbjct: 616 TKQQSQSMENLTPERSVAEEPKNMR--FPGSNGENYSVTQNQVLHIQKHTPLSVRTRIHD 673

Query: 391 DEVVRSEDLPKRP 353
            E  R++ LP++P
Sbjct: 674 LEAHRADQLPQQP 686


>UniRef50_Q7SB97 Cluster: Sorting nexin mvp-1; n=9;
           Pezizomycotina|Rep: Sorting nexin mvp-1 - Neurospora
           crassa
          Length = 780

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%)
 Frame = +2

Query: 338 DSVRSGPFGQIFRPDNFVFGQSGAGN-NWAKGHYTEGAELVDSVLDVVRKEAEG 496
           D+  +GPFG    P   V G  G  N N + GH   G+ + +++L  +  E EG
Sbjct: 371 DNAITGPFGDSGGPGQSVSGSVGGSNPNRSIGHVRSGSNVEENILVTLMPEKEG 424


>UniRef50_UPI0000DC0C7D Cluster: UPI0000DC0C7D related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0C7D UniRef100 entry -
           Rattus norvegicus
          Length = 366

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           M E + I  GQ G QI    WE+   EHGI   G
Sbjct: 5   MHEYISIYIGQAGIQISNACWELYCSEHGIQPDG 38


>UniRef50_Q7XSJ2 Cluster: OSJNBb0085C12.3 protein; n=2; Oryza sativa
            (japonica cultivar-group)|Rep: OSJNBb0085C12.3 protein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1356

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = -3

Query: 458  QPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLAG 297
            +P  PP     +P  +PP + R    P   FAQ A    + + QA G  SQ AG
Sbjct: 1202 RPTPPPHGGFRAPFSTPPSSARPSVVPPTGFAQFAMTQAAHFSQAAGSASQAAG 1255


>UniRef50_A3AU36 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 206

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 1/58 (1%)
 Frame = -3

Query: 470 PVPNQ-PVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 300
           P P+  P  PP     SP Y+P    RR + P    A   R   SP +    PP + A
Sbjct: 59  PSPDYTPASPPHRRAASPDYTPESPPRRAASPDYSPASPPRRAASPDYTPMSPPGRAA 116


>UniRef50_UPI0000DD8653 Cluster: PREDICTED: hypothetical protein;
           n=2; Catarrhini|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 163

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 17/47 (36%), Positives = 22/47 (46%)
 Frame = -3

Query: 425 SPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRTCP 285
           S +  PPQ  RRR CP+G  A +A     PW +     S   G+  P
Sbjct: 8   SAAKQPPQQPRRRHCPLG-LAHSAPAAECPWTRISSQSSCFLGQPKP 53


>UniRef50_Q0UET6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1542

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = -3

Query: 476 LHPVPNQPVQPPLCNXLSPSYSP--PQTVRRRSCPVGRFAQ 360
           LH  P QP Q  +   L   YSP  PQ + R   PVGR AQ
Sbjct: 334 LHEEPEQPPQHYVAQHLEEHYSPRAPQPLPRTPSPVGRPAQ 374


>UniRef50_UPI0000DD82B6 Cluster: PREDICTED: hypothetical protein;
           n=3; Homo/Pan/Gorilla group|Rep: PREDICTED: hypothetical
           protein - Homo sapiens
          Length = 322

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 1/64 (1%)
 Frame = -3

Query: 476 LHPVPNQPVQPPLCNXLS-PSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 300
           LHP P+ P +P +C     P+   PQ  R    P     ++ R G  P       P  LA
Sbjct: 142 LHPDPSPPSRPFICPPAGQPAVPGPQAARLLPQPRRAAPRSPRPGGDPDPTPPAAPLPLA 201

Query: 299 GRTC 288
            RTC
Sbjct: 202 ERTC 205


>UniRef50_Q74AC9 Cluster: Putative uncharacterized protein; n=6;
           Desulfuromonadales|Rep: Putative uncharacterized protein
           - Geobacter sulfurreducens
          Length = 284

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 4/131 (3%)
 Frame = +2

Query: 95  GVPNF*CNHEGNRPHPGGSMRESDRSKVLGSN-LGRARH*RHGCLQRRLRPAA*SINVYY 271
           G P   C  EG   H GG      R  + GS    RA+H  H C  R+  P    +    
Sbjct: 102 GTPADPCRTEGR--HRGGCRAGGRREGIHGSRGRHRAQHPDHQCRHRQRGPRGGGLLRLE 159

Query: 272 NEASGGKYVPRAVMVDLEPGT--MDSVRSGPFGQIFRPDNFVFGQS-GAGNNWAKGHYTE 442
           +   GG+ VP       E G   M   R    G +F   +F+ G + GAG        T 
Sbjct: 160 HRRPGGRKVPHGT-THQEKGVIRMSEERGTSVGTVFL--SFLAGAAVGAGLGLLLAPKT- 215

Query: 443 GAELVDSVLDV 475
           G E+ ++++D+
Sbjct: 216 GKEMRENIMDL 226


>UniRef50_Q1GTZ1 Cluster: Short-chain dehydrogenase/reductase SDR;
           n=1; Sphingopyxis alaskensis|Rep: Short-chain
           dehydrogenase/reductase SDR - Sphingopyxis alaskensis
           (Sphingomonas alaskensis)
          Length = 241

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 16/39 (41%), Positives = 20/39 (51%)
 Frame = +2

Query: 299 PRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGN 415
           P AV+V L PGT+D+  S PF +   P   V     A N
Sbjct: 177 PEAVVVALHPGTVDTAMSRPFQRAVAPGTLVTPPIAAAN 215


>UniRef50_Q75I84 Cluster: Putative uncharacterized protein
            OSJNBa0004L11.23; n=1; Oryza sativa (japonica
            cultivar-group)|Rep: Putative uncharacterized protein
            OSJNBa0004L11.23 - Oryza sativa subsp. japonica (Rice)
          Length = 998

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 19/56 (33%), Positives = 25/56 (44%)
 Frame = -3

Query: 458  QPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRT 291
            +P  PP     +P  +PP + R    P   FAQ A    + + QA G  SQ A  T
Sbjct: 877  RPTPPPHGGFRAPFSTPPSSARPSVVPPTGFAQFAMTQAAHFSQAAGSASQAAAST 932


>UniRef50_UPI0000EB078E Cluster: UPI0000EB078E related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB078E UniRef100
           entry - Canis familiaris
          Length = 509

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = -3

Query: 410 PPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRTCPLK 279
           PP T RR  C + R  + A  GR P    +GP +Q      P +
Sbjct: 49  PPATGRRPRCSLRRLERAAAGGRPPGGPGRGPAAQAGAPGAPAR 92


>UniRef50_Q0RVI3 Cluster: Aldehyde dehydrogenase; n=1; Rhodococcus
           sp. RHA1|Rep: Aldehyde dehydrogenase - Rhodococcus sp.
           (strain RHA1)
          Length = 484

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 13/58 (22%), Positives = 26/58 (44%)
 Frame = +2

Query: 320 LEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE 493
           ++P T D + + P     + D  V     A + W    ++E + ++D + D + K  E
Sbjct: 38  IDPATEDVIATAPVADSAQVDQAVHAALKAFHTWQHSTFSERSTIIDRIADAIEKRRE 95


>UniRef50_A3HX59 Cluster: Putative uncharacterized protein; n=1;
           Algoriphagus sp. PR1|Rep: Putative uncharacterized
           protein - Algoriphagus sp. PR1
          Length = 1017

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = +2

Query: 320 LEPGTMDSVRSGPFGQIFRPDNF--VFGQSGAGNNWAKGHY-TEGAELVDSVLD 472
           + P   D V +   G IF+PD    VF  +  G  W K  Y T+ A  VD V+D
Sbjct: 149 IHPDNPDVVYAAVMGDIFKPDETRGVFKTTDGGETWEKVLYSTDVAGAVDLVMD 202


>UniRef50_Q01IW3 Cluster: OSIGBa0102I15.7 protein; n=18; Oryza
            sativa|Rep: OSIGBa0102I15.7 protein - Oryza sativa (Rice)
          Length = 1176

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 19/56 (33%), Positives = 26/56 (46%)
 Frame = -3

Query: 458  QPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRT 291
            +P  PP     +P  +PP + R    P   FAQ A    + + QA G  SQ+A  T
Sbjct: 1002 RPTPPPHGGFRTPFSTPPSSARPSVVPPTGFAQFAMTQAAHFSQAAGSASQVAVST 1057


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 629,184,955
Number of Sequences: 1657284
Number of extensions: 13548613
Number of successful extensions: 42387
Number of sequences better than 10.0: 135
Number of HSP's better than 10.0 without gapping: 40026
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42296
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41902926763
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).