SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0013
         (698 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9BL19 Cluster: Ribosomal protein, large subunit protei...    57   5e-07
UniRef50_Q8WTK4 Cluster: Ribosomal protein, large subunit protei...    57   5e-07
UniRef50_A7QP86 Cluster: Chromosome chr1 scaffold_136, whole gen...    56   1e-06
UniRef50_Q7TPJ7 Cluster: Ac2-210; n=3; Eutheria|Rep: Ac2-210 - R...    54   3e-06
UniRef50_P18621 Cluster: 60S ribosomal protein L17; n=135; Eukar...    54   3e-06
UniRef50_Q93VI3 Cluster: 60S ribosomal protein L17-1; n=18; Euka...    53   8e-06
UniRef50_O48557 Cluster: 60S ribosomal protein L17; n=53; Eukary...    52   1e-05
UniRef50_Q7RR03 Cluster: Ribosomal protein L22; n=1; Plasmodium ...    46   0.001
UniRef50_Q8IDI5 Cluster: Ribosomal protein L17, putative; n=5; P...    41   0.034
UniRef50_P05740 Cluster: 60S ribosomal protein L17-A; n=27; Euka...    41   0.034
UniRef50_Q5CVN1 Cluster: 60S ribosomal protein L17; n=9; Eukaryo...    39   0.10 
UniRef50_UPI00015601D6 Cluster: PREDICTED: hypothetical protein;...    38   0.18 
UniRef50_A7PPU4 Cluster: Chromosome chr18 scaffold_24, whole gen...    38   0.24 
UniRef50_UPI0001553410 Cluster: PREDICTED: hypothetical protein;...    37   0.41 
UniRef50_Q5DHE6 Cluster: SJCHGC09296 protein; n=5; Bilateria|Rep...    37   0.55 
UniRef50_Q1DNR0 Cluster: Putative uncharacterized protein; n=1; ...    36   1.3  
UniRef50_Q9SV87 Cluster: NAM/NAP like protein; n=3; core eudicot...    35   2.2  
UniRef50_Q8SRH7 Cluster: 60S RIBOSOMAL PROTEIN L17; n=1; Encepha...    35   2.2  
UniRef50_A4QTL6 Cluster: Predicted protein; n=1; Magnaporthe gri...    35   2.2  
UniRef50_A0UKV9 Cluster: Putative uncharacterized protein; n=2; ...    34   2.9  
UniRef50_A7RP24 Cluster: Predicted protein; n=1; Nematostella ve...    34   2.9  
UniRef50_O14339 Cluster: 60S ribosomal protein L17-A; n=4; Dikar...    34   2.9  
UniRef50_Q53MZ6 Cluster: Integrase core domain, putative; n=13; ...    34   3.9  
UniRef50_A4B909 Cluster: Putative alpha amylase; n=1; Reinekea s...    33   5.1  
UniRef50_P77073 Cluster: AF/R2 fimbrial major subunit Afr2G; n=2...    33   6.7  
UniRef50_P23624 Cluster: Meiosis-specific protein SPO13; n=3; Sa...    33   6.7  
UniRef50_Q2H526 Cluster: Putative uncharacterized protein; n=1; ...    33   8.9  
UniRef50_P65093 Cluster: Uncharacterized protein Rv3785/MT3893; ...    33   8.9  

>UniRef50_Q9BL19 Cluster: Ribosomal protein, large subunit protein
           17, isoform a; n=5; Eukaryota|Rep: Ribosomal protein,
           large subunit protein 17, isoform a - Caenorhabditis
           elegans
          Length = 187

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           N  KSCKARGS+LRVHFKN +E AMA+R MPLR
Sbjct: 12  NSTKSCKARGSDLRVHFKNTHEAAMALRGMPLR 44


>UniRef50_Q8WTK4 Cluster: Ribosomal protein, large subunit protein
           17, isoform b; n=48; Bilateria|Rep: Ribosomal protein,
           large subunit protein 17, isoform b - Caenorhabditis
           elegans
          Length = 159

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           N  KSCKARGS+LRVHFKN +E AMA+R MPLR
Sbjct: 12  NSTKSCKARGSDLRVHFKNTHEAAMALRGMPLR 44


>UniRef50_A7QP86 Cluster: Chromosome chr1 scaffold_136, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr1 scaffold_136, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 261

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 25/32 (78%), Positives = 27/32 (84%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPL 604
           NP KSCKARG +LRVHFKN  ETA AIRK+PL
Sbjct: 88  NPTKSCKARGLDLRVHFKNTRETAHAIRKLPL 119


>UniRef50_Q7TPJ7 Cluster: Ac2-210; n=3; Eutheria|Rep: Ac2-210 -
           Rattus norvegicus (Rat)
          Length = 220

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           NP KSCK+RGSNLRVHFKN  ETA AI+ M +R
Sbjct: 10  NPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIR 42


>UniRef50_P18621 Cluster: 60S ribosomal protein L17; n=135;
           Eukaryota|Rep: 60S ribosomal protein L17 - Homo sapiens
           (Human)
          Length = 184

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           NP KSCK+RGSNLRVHFKN  ETA AI+ M +R
Sbjct: 10  NPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIR 42



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           +YLK+V  +K+C+PFRR+    +GRC
Sbjct: 46  KYLKDVTLQKQCVPFRRYNG-GVGRC 70


>UniRef50_Q93VI3 Cluster: 60S ribosomal protein L17-1; n=18;
           Eukaryota|Rep: 60S ribosomal protein L17-1 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 176

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 24/32 (75%), Positives = 27/32 (84%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPL 604
           N  KSCKARG++LRVHFKN  ETA AIRK+PL
Sbjct: 10  NITKSCKARGADLRVHFKNTRETAHAIRKLPL 41


>UniRef50_O48557 Cluster: 60S ribosomal protein L17; n=53;
           Eukaryota|Rep: 60S ribosomal protein L17 - Zea mays
           (Maize)
          Length = 171

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 23/33 (69%), Positives = 26/33 (78%)
 Frame = +2

Query: 506 GNPAKSCKARGSNLRVHFKNXYETAMAIRKMPL 604
           GNP KS KA G +LRVHFKN  ETA A+RK+PL
Sbjct: 9   GNPTKSAKAMGRDLRVHFKNTRETAFALRKLPL 41


>UniRef50_Q7RR03 Cluster: Ribosomal protein L22; n=1; Plasmodium
           yoelii yoelii|Rep: Ribosomal protein L22 - Plasmodium
           yoelii yoelii
          Length = 249

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/32 (65%), Positives = 23/32 (71%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPL 604
           NP K  KA   +LRVHFKN YETA AIR+M L
Sbjct: 10  NPGKCAKAAAVDLRVHFKNTYETARAIRRMNL 41


>UniRef50_Q8IDI5 Cluster: Ribosomal protein L17, putative; n=5;
           Plasmodium|Rep: Ribosomal protein L17, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 203

 Score = 40.7 bits (91), Expect = 0.034
 Identities = 19/32 (59%), Positives = 21/32 (65%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPL 604
           N  K  K  G +LRVHFKN YE A AIR+M L
Sbjct: 10  NLGKCAKGAGVDLRVHFKNTYEAARAIRRMKL 41


>UniRef50_P05740 Cluster: 60S ribosomal protein L17-A; n=27;
           Eukaryota|Rep: 60S ribosomal protein L17-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 184

 Score = 40.7 bits (91), Expect = 0.034
 Identities = 20/27 (74%), Positives = 20/27 (74%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAI 589
           NPAKS  ARGS LRV FKN  ETA AI
Sbjct: 10  NPAKSASARGSYLRVSFKNTRETAQAI 36


>UniRef50_Q5CVN1 Cluster: 60S ribosomal protein L17; n=9;
           Eukaryota|Rep: 60S ribosomal protein L17 -
           Cryptosporidium parvum Iowa II
          Length = 187

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 512 PAKSCKARGSNLRVHFKNXYETAMAIRKMPL 604
           P+KS   +GS+LRV +KN YETA AI+ M L
Sbjct: 11  PSKSVMCKGSDLRVSYKNTYETATAIKGMYL 41


>UniRef50_UPI00015601D6 Cluster: PREDICTED: hypothetical protein;
           n=1; Equus caballus|Rep: PREDICTED: hypothetical protein
           - Equus caballus
          Length = 191

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMP 601
           N  KSCK+R SNL VHFKN  ET   ++++P
Sbjct: 21  NLTKSCKSRSSNLHVHFKNTRETVF-LKRVP 50


>UniRef50_A7PPU4 Cluster: Chromosome chr18 scaffold_24, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr18 scaffold_24, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 330

 Score = 37.9 bits (84), Expect = 0.24
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPL 604
           NP K CK R S+ RVHFKN  ET  A  ++ L
Sbjct: 10  NPTKFCKTRDSDFRVHFKNTRETTDATSRLLL 41


>UniRef50_UPI0001553410 Cluster: PREDICTED: hypothetical protein;
           n=1; Mus musculus|Rep: PREDICTED: hypothetical protein -
           Mus musculus
          Length = 405

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = +2

Query: 512 PAKSCKARGSNLRVHFKNXYETAMAI 589
           P KSCK+ GSNL VHFKN +E +  I
Sbjct: 76  PHKSCKSWGSNLCVHFKNIWEISQVI 101


>UniRef50_Q5DHE6 Cluster: SJCHGC09296 protein; n=5; Bilateria|Rep:
           SJCHGC09296 protein - Schistosoma japonicum (Blood
           fluke)
          Length = 193

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +2

Query: 515 AKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           +K+CKAR   LR HFKN +E A A++ M L+
Sbjct: 14  SKTCKARIPYLRTHFKNMHECACAVKGMTLQ 44



 Score = 35.9 bits (79), Expect = 0.96
 Identities = 15/17 (88%), Positives = 16/17 (94%)
 Frame = +1

Query: 622 YLKNVIDKKECIPFRRF 672
           YLKNVI+KKE IPFRRF
Sbjct: 49  YLKNVIEKKEIIPFRRF 65


>UniRef50_Q1DNR0 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 644

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 30/107 (28%), Positives = 42/107 (39%), Gaps = 4/107 (3%)
 Frame = -2

Query: 472 RKTKNTVRTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGAS 293
           RK +     A  + K P+    + P       PE  +   PRRG K  +R +S     A 
Sbjct: 334 RKRRKNATRAPASDKEPLQHHKEWPESTQPGQPENTRAVKPRRGRKRRSRGSSKSSGEAF 393

Query: 292 LGNGDSVTS----NAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYST 164
              G S  S      HR+   +  L D L+  SN SD    G+  +T
Sbjct: 394 SDEGTSSKSTIPVTVHRICN-ISALEDMLSDKSNVSDDEHSGSHTAT 439


>UniRef50_Q9SV87 Cluster: NAM/NAP like protein; n=3; core
           eudicotyledons|Rep: NAM/NAP like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 341

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -2

Query: 301 GASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEY 170
           G  +G  ++V S+ H+  +  W + D L T   G++ SSRG  Y
Sbjct: 265 GLDVGTCETVASHNHQQGLGEWAMMDRLVTCHMGNEDSSRGITY 308


>UniRef50_Q8SRH7 Cluster: 60S RIBOSOMAL PROTEIN L17; n=1;
           Encephalitozoon cuniculi|Rep: 60S RIBOSOMAL PROTEIN L17
           - Encephalitozoon cuniculi
          Length = 183

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRF 672
           +YLKNVI K EC+PFRR+
Sbjct: 47  QYLKNVIAKTECVPFRRY 64


>UniRef50_A4QTL6 Cluster: Predicted protein; n=1; Magnaporthe
           grisea|Rep: Predicted protein - Magnaporthe grisea (Rice
           blast fungus) (Pyricularia grisea)
          Length = 699

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 253 VLIWVWRLTDHLTTASNGSDS-SSRGTEYSTTCRTARRAYSKARMACDT 110
           VLIW  RLT +L  AS G D+ +   T +STTC       S+ +  CDT
Sbjct: 422 VLIWTGRLTKYLAGASIGHDNINFYNTPFSTTCTCCT---SRLKDLCDT 467


>UniRef50_A0UKV9 Cluster: Putative uncharacterized protein; n=2;
           Burkholderia cepacia complex|Rep: Putative
           uncharacterized protein - Burkholderia multivorans ATCC
           17616
          Length = 760

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 23/75 (30%), Positives = 35/75 (46%)
 Frame = -2

Query: 352 PRRGAKLNARSTSILVRGASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTE 173
           PRRG +++      + R   L     ++   HR+L+WVWR    L +AS       R  E
Sbjct: 594 PRRG-RIDHVDRLFVRRVEPLSGDVGLSGRTHRMLLWVWRAARAL-SASRAHTRRRRCRE 651

Query: 172 YSTTCRTARRAYSKA 128
            +     +RRA S+A
Sbjct: 652 SARRTMRSRRASSRA 666


>UniRef50_A7RP24 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 934

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = -1

Query: 470 ENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATTRSEAQRAL 321
           E EK+  + EL+    S  HF   E ++R   RA+ED+    +SE ++ L
Sbjct: 264 EEEKYGKDGELRMLKESLAHFQAEEAKKREQIRAMEDQRKQEQSEKEKEL 313


>UniRef50_O14339 Cluster: 60S ribosomal protein L17-A; n=4;
           Dikarya|Rep: 60S ribosomal protein L17-A -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 187

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 16/30 (53%), Positives = 18/30 (60%)
 Frame = +2

Query: 518 KSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           K  KARG+ LR HFKN  E A  I  M L+
Sbjct: 13  KCAKARGAYLRTHFKNSREVAFTINGMSLK 42


>UniRef50_Q53MZ6 Cluster: Integrase core domain, putative; n=13;
           Magnoliophyta|Rep: Integrase core domain, putative -
           Oryza sativa subsp. japonica (Rice)
          Length = 1584

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = +3

Query: 456 VFFVFRVKYTLIKKREPETLRNHAKRVVQTSVFTLRTHMRPQW--QSERCRSVRAVSLPQ 629
           V F FR+ +   K+RE E     AK   Q S F  R  +RPQW  +S+R RSVR  ++P+
Sbjct: 485 VGFCFRLAHKQKKEREREI--TFAKSKWQKSGFPSRKPVRPQWVPRSDR-RSVRPANVPR 541


>UniRef50_A4B909 Cluster: Putative alpha amylase; n=1; Reinekea sp.
           MED297|Rep: Putative alpha amylase - Reinekea sp. MED297
          Length = 1012

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 20/67 (29%), Positives = 31/67 (46%)
 Frame = -2

Query: 391 DSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSVTSNAHRVLIWVWRLTDHLTT 212
           D+ QPP +   +V      LNA  T+ L    +  +GD++T N      WVW+  D L  
Sbjct: 27  DNNQPPTI---SVESGTITLNALETTALNYSINDPDGDALTVNVTNAPTWVWQEGDQLIL 83

Query: 211 ASNGSDS 191
           +    D+
Sbjct: 84  SPTNPDA 90


>UniRef50_P77073 Cluster: AF/R2 fimbrial major subunit Afr2G; n=2;
           Escherichia coli|Rep: AF/R2 fimbrial major subunit Afr2G
           - Escherichia coli
          Length = 279

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 13/47 (27%), Positives = 26/47 (55%)
 Frame = -2

Query: 301 GASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTT 161
           G ++  G ++  ++    +W W+L D +T ASN +D ++  T  + T
Sbjct: 32  GGTIDIGGTIEVDSQYDDLWTWKLGDAITVASNAADMNAEKTSLTIT 78


>UniRef50_P23624 Cluster: Meiosis-specific protein SPO13; n=3;
           Saccharomyces|Rep: Meiosis-specific protein SPO13 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 291

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 18/51 (35%), Positives = 27/51 (52%)
 Frame = -2

Query: 481 YLTRKTKNTVRTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLN 329
           YL  K+ NT++     I+RP  D S     D EQPP+   T V  + +++N
Sbjct: 96  YLKNKSSNTLKNERQTIERPSFDNSLR-FEDIEQPPKSTSTPVLSQSSQIN 145


>UniRef50_Q2H526 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 418

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +2

Query: 275 AVSVPERRSSDEYGRRARVELRSASWHRGLQELWRLFAVVVR 400
           A+ V  R +S E GRR ++ + +A+WHR ++  WRL   V R
Sbjct: 333 AIGVETRTASLEDGRR-QLGVYTAAWHRRMEHEWRLSFTVDR 373


>UniRef50_P65093 Cluster: Uncharacterized protein Rv3785/MT3893;
           n=14; Mycobacterium tuberculosis complex|Rep:
           Uncharacterized protein Rv3785/MT3893 - Mycobacterium
           tuberculosis
          Length = 357

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 16/48 (33%), Positives = 21/48 (43%)
 Frame = -2

Query: 229 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLL 86
           TDHL       D  S   +Y    R AR  + +     D+GG A WL+
Sbjct: 51  TDHLEARLASLDKFSTAWDYRARARAARALHGEPVRCQDSGGGARWLI 98


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 680,279,784
Number of Sequences: 1657284
Number of extensions: 12753311
Number of successful extensions: 36410
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 35058
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36389
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55371905986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).