SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0011
         (548 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q34505 Cluster: Cytochrome c oxidase subunit I; n=46; N...    86   4e-16
UniRef50_Q30DC3 Cluster: Cytochrome c oxidase subunit I; n=30; P...    79   5e-14
UniRef50_Q5GGF4 Cluster: Cytochrome c oxidase subunit I; n=2742;...    74   2e-12
UniRef50_Q8HN76 Cluster: Cytochrome c oxidase subunit I; n=21; A...    69   5e-11
UniRef50_P00395 Cluster: Cytochrome c oxidase subunit 1; n=44498...    64   3e-09
UniRef50_A1INK5 Cluster: Cytochrome c oxidase subunit I; n=71; P...    63   5e-09
UniRef50_Q951H1 Cluster: Cytochrome c oxidase subunit I; n=388; ...    62   6e-09
UniRef50_Q9MIY8 Cluster: Cytochrome c oxidase subunit 1; n=861; ...    61   2e-08
UniRef50_Q8SK39 Cluster: Cytochrome c oxidase subunit I; n=455; ...    60   3e-08
UniRef50_Q6ZLV6 Cluster: Cytochrome c oxidase subunit I; n=941; ...    60   3e-08
UniRef50_Q6RHX4 Cluster: Cytochrome c oxidase subunit I; n=26; E...    58   1e-07
UniRef50_Q9MCX7 Cluster: Cytochrome c oxidase subunit I; n=181; ...    56   5e-07
UniRef50_A2T435 Cluster: Cytochrome c oxidase subunit I; n=126; ...    53   5e-06
UniRef50_Q5W4C3 Cluster: Cytochrome oxidase subunit I; n=79; Pte...    51   2e-05
UniRef50_P48866 Cluster: Cytochrome c oxidase subunit 1; n=179; ...    51   2e-05
UniRef50_Q6TP93 Cluster: Cytochrome c oxidase subunit I; n=2; Br...    50   5e-05
UniRef50_A7UG06 Cluster: Cytochrome oxidase subunits 1 and 2 pol...    50   5e-05
UniRef50_P60620 Cluster: Cytochrome c oxidase subunit 1; n=2931;...    50   5e-05
UniRef50_Q4FH11 Cluster: Cytochrome c oxidase subunit I; n=26; B...    49   6e-05
UniRef50_Q1L7C2 Cluster: Cytochrome c oxidase subunit I; n=2; Mi...    49   6e-05
UniRef50_Q8SHP5 Cluster: Cytochrome c oxidase subunit I; n=15; F...    49   6e-05
UniRef50_Q1XA94 Cluster: Cytochrome c oxidase subunit I; n=825; ...    49   8e-05
UniRef50_Q35528 Cluster: Cytochrome oxidase subunit I; n=39; Aph...    47   3e-04
UniRef50_Q28SZ5 Cluster: Cytochrome-c oxidase; n=50; cellular or...    47   3e-04
UniRef50_O03826 Cluster: Cytochrome oxidase subunit I; n=21; Pro...    46   8e-04
UniRef50_O47573 Cluster: Cytochrome c oxidase subunit I; n=42; N...    45   0.001
UniRef50_Q8WFY0 Cluster: Cytochrome oxidase subunit I; n=5; Euma...    44   0.002
UniRef50_Q5VIA7 Cluster: Cytochrome oxidase subunit I; n=1; Psyc...    43   0.004
UniRef50_Q6Y3P5 Cluster: Cytochrome oxidase subunit I; n=4; Tali...    42   0.007
UniRef50_Q9G8S1 Cluster: Cytochrome c oxidase subunit 1; n=1; Na...    41   0.022
UniRef50_Q5W914 Cluster: Cytochrome c oxidase subunit I; n=9; Co...    40   0.038
UniRef50_Q5UC96 Cluster: Cytochrome c oxidase subunit I; n=48; F...    40   0.038
UniRef50_Q1NET5 Cluster: Cytochrome-c oxidase; n=3; Alphaproteob...    38   0.15 
UniRef50_Q8LX70 Cluster: Cytochrome c oxidase subunit I; n=4; Ch...    37   0.27 
UniRef50_Q1XAB3 Cluster: Cytochrome oxidase subunit I; n=14; Neo...    37   0.27 
UniRef50_P29649 Cluster: Cytochrome c oxidase subunit 1; n=441; ...    37   0.27 
UniRef50_Q8LX74 Cluster: Cytochrome c oxidase subunit I; n=1; Ch...    36   0.47 
UniRef50_Q85HI4 Cluster: Cytochrome c oxidase subunit I; n=7; Ec...    36   0.47 
UniRef50_Q9B8X8 Cluster: Cytochrome c oxidase subunit I; n=517; ...    36   0.62 
UniRef50_Q7YEU6 Cluster: Endonuclease; n=4; Fungi/Metazoa group|...    36   0.62 
UniRef50_Q0AI64 Cluster: Cytochrome-c oxidase; n=3; Proteobacter...    35   1.1  
UniRef50_Q8ZXD1 Cluster: Cytochrome C oxidase subunit I /III; n=...    35   1.1  
UniRef50_Q9TAP9 Cluster: Cytochrome c oxidase subunit I; n=2; To...    34   1.9  
UniRef50_Q94ZM7 Cluster: COI protein; n=2; Sessilia|Rep: COI pro...    34   1.9  
UniRef50_P14544 Cluster: Cytochrome c oxidase subunit 1; n=7; Eu...    34   1.9  
UniRef50_A3ZTG1 Cluster: Cytochrome c oxidase subunit I; n=1; Bl...    34   2.5  
UniRef50_Q4XXN6 Cluster: Putative uncharacterized protein; n=1; ...    34   2.5  
UniRef50_Q02766 Cluster: Cytochrome c oxidase subunit 1; n=107; ...    34   2.5  
UniRef50_Q9XLV8 Cluster: Cytochrome c oxidase subunit I; n=1; Di...    33   3.3  
UniRef50_Q11EK8 Cluster: Cytochrome c oxidase, subunit I; n=5; P...    33   5.8  
UniRef50_Q79VD7 Cluster: Cytochrome c oxidase subunit 1; n=93; A...    33   5.8  
UniRef50_Q1H1C1 Cluster: Cytochrome-c oxidase; n=1; Methylobacil...    32   7.6  
UniRef50_Q1CZF1 Cluster: Cytochrome c oxidase, subunit I; n=1; M...    32   7.6  
UniRef50_A6C0L1 Cluster: Cytochrome c oxidase subunit I; n=1; Pl...    32   7.6  
UniRef50_Q9MLW1 Cluster: Cytochrome c oxidase subunit I; n=5; Na...    32   7.6  
UniRef50_P34956 Cluster: Quinol oxidase subunit 1 (EC 1.10.3.-) ...    32   7.6  
UniRef50_Q0H8Y3 Cluster: Probable intron-encoded endonuclease aI...    32   7.6  

>UniRef50_Q34505 Cluster: Cytochrome c oxidase subunit I; n=46;
           Neoptera|Rep: Cytochrome c oxidase subunit I - Eueides
           tales
          Length = 95

 Score = 86.2 bits (204), Expect = 4e-16
 Identities = 43/72 (59%), Positives = 50/72 (69%)
 Frame = -1

Query: 218 YSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*YQNLP 39
           YSD PD+Y+S NIISS GSYIS  S+        ES+ N R+ LFS N+PSSIE YQN P
Sbjct: 1   YSDYPDNYMSWNIISSFGSYISLFSMILIIIIIWESMINQRMILFSLNMPSSIEWYQNFP 60

Query: 38  PAXXSYNERPIL 3
           P+  SYNE PIL
Sbjct: 61  PSEHSYNELPIL 72


>UniRef50_Q30DC3 Cluster: Cytochrome c oxidase subunit I; n=30;
           Panarthropoda|Rep: Cytochrome c oxidase subunit I -
           Pagyris cymothoe
          Length = 487

 Score = 79.4 bits (187), Expect = 5e-14
 Identities = 42/64 (65%), Positives = 46/64 (71%)
 Frame = -1

Query: 194 IS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*YQNLPPAXXSYNE 15
           +S NIISSLGSYIS LS+        ES+ N RI LFS N+PSSIE YQNLPPA  SYNE
Sbjct: 421 VSWNIISSLGSYISLLSMMMIIIIIWESMINQRIILFSLNMPSSIEWYQNLPPAEHSYNE 480

Query: 14  RPIL 3
            PIL
Sbjct: 481 LPIL 484


>UniRef50_Q5GGF4 Cluster: Cytochrome c oxidase subunit I; n=2742;
           Bilateria|Rep: Cytochrome c oxidase subunit I - Cotesia
           melitaearum (Parasitoid wasp)
          Length = 499

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 41/119 (34%), Positives = 58/119 (48%)
 Frame = -1

Query: 371 LLGDLLX*XPLCYRPFIKXXXTKNSXFYNIYWSKYXIXSQHFLGLAGIPRRYSDXPDSYI 192
           +LG  +   P+ +   +     K   +            QHFLGL+G+PRRYSD PD Y+
Sbjct: 373 ILGGFIYWFPMFFGLMMNEYFLKIHFYLTFIGVNLIFFPQHFLGLSGMPRRYSDYPDMYL 432

Query: 191 S*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*YQNLPPAXXSYNE 15
           + N+ SS GS IS + V        ES+   R  +F   + SSIE +   PP   SY+E
Sbjct: 433 NWNLFSSFGSLISLIGVFLFIFIIWESLIMQRFVIFVKFINSSIEWFHLYPPLDHSYDE 491



 Score = 42.7 bits (96), Expect = 0.005
 Identities = 31/90 (34%), Positives = 40/90 (44%), Gaps = 2/90 (2%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXIG--YYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYV 335
           F+FLF VGGLTGV+L+NS +    + T Y                    + IY     + 
Sbjct: 328 FIFLFTVGGLTGVVLSNSSVDVVLHDTYYGVAHFHYVLSMGAVFSILGGF-IYWFPMFF- 385

Query: 334 TGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
            GL +    LKI  +  FIGVN  F P  F
Sbjct: 386 -GLMMNEYFLKIHFYLTFIGVNLIFFPQHF 414



 Score = 32.7 bits (71), Expect = 5.8
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           +D+  HDTY  VA FHYVLS
Sbjct: 347 VDVVLHDTYYGVAHFHYVLS 366


>UniRef50_Q8HN76 Cluster: Cytochrome c oxidase subunit I; n=21;
           Aphidomorpha|Rep: Cytochrome c oxidase subunit I -
           Phylloxera sp. DAD-2001a
          Length = 83

 Score = 69.3 bits (162), Expect = 5e-11
 Identities = 32/80 (40%), Positives = 50/80 (62%)
 Frame = -1

Query: 242 GLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSS 63
           GL G+PRRYSD P++Y++ NI+SS+GS IS  S+         S+   ++ +F  NL +S
Sbjct: 1   GLNGMPRRYSDYPNNYLTWNIMSSIGSMISTFSIIILIYWLWNSLFLKKMTIFKLNLNNS 60

Query: 62  IE*YQNLPPAXXSYNERPIL 3
           I    N+PP   +Y+E P++
Sbjct: 61  IGWIHNMPPIGHTYSELPLI 80


>UniRef50_P00395 Cluster: Cytochrome c oxidase subunit 1; n=44498;
           root|Rep: Cytochrome c oxidase subunit 1 - Homo sapiens
           (Human)
          Length = 513

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 32/80 (40%), Positives = 46/80 (57%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXN 75
           QHFLGL+G+PRRYSD PD+Y + NI+SS+GS+IS  +V        E+  + R  L    
Sbjct: 428 QHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEE 487

Query: 74  LPSSIE*YQNLPPAXXSYNE 15
              ++E     PP   ++ E
Sbjct: 488 PSMNLEWLYGCPPPYHTFEE 507



 Score = 42.7 bits (96), Expect = 0.005
 Identities = 32/90 (35%), Positives = 41/90 (45%), Gaps = 2/90 (2%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANS--XIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYV 335
           F+FLF VGGLTG++LANS   I  + T Y+                    G      L+ 
Sbjct: 344 FIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMG--GFIHWFPLF- 400

Query: 334 TGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
           +G +L     KI    +FIGVN TF P  F
Sbjct: 401 SGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430



 Score = 37.1 bits (82), Expect = 0.27
 Identities = 16/20 (80%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI  HDTY VVA FHYVLS
Sbjct: 363 LDIVLHDTYYVVAHFHYVLS 382


>UniRef50_A1INK5 Cluster: Cytochrome c oxidase subunit I; n=71;
           Pancrustacea|Rep: Cytochrome c oxidase subunit I -
           Psilochaeta pampiana
          Length = 76

 Score = 62.9 bits (146), Expect = 5e-09
 Identities = 33/73 (45%), Positives = 45/73 (61%)
 Frame = -1

Query: 221 RYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*YQNL 42
           RY+D P+ + + N+IS++GS IS L +        ES+   R+ LFS  L SSIE  QN 
Sbjct: 1   RYADYPEVHTTWNVISTIGSTISFLGILYFFYIIWESLITQRMVLFSIQLCSSIEWLQNS 60

Query: 41  PPAXXSYNERPIL 3
           PPA  SY+E P+L
Sbjct: 61  PPAEHSYSELPLL 73


>UniRef50_Q951H1 Cluster: Cytochrome c oxidase subunit I; n=388;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Picoides
           borealis
          Length = 513

 Score = 62.5 bits (145), Expect = 6e-09
 Identities = 33/80 (41%), Positives = 45/80 (56%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXN 75
           QHFLGLAG+PRRYSD PD+Y   N +SS+GS IS  +V        E+  + R  L    
Sbjct: 429 QHFLGLAGMPRRYSDYPDAYTLWNTMSSIGSLISMTAVIMLLFIIWEAFASKRKVLQPEL 488

Query: 74  LPSSIE*YQNLPPAXXSYNE 15
           + ++IE     PP   ++ E
Sbjct: 489 IXTNIEWIHGCPPPYHTFEE 508



 Score = 39.9 bits (89), Expect = 0.038
 Identities = 31/90 (34%), Positives = 40/90 (44%), Gaps = 2/90 (2%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANS--XIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYV 335
           F+FLF VGGLTG++LANS   I  + T Y+                    G      L+ 
Sbjct: 345 FIFLFTVGGLTGIVLANSSLDIALHDTYYVVAHFHYVLSMGAVFAILA--GFTHWFPLF- 401

Query: 334 TGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
           TG +L +   K     +F GVN TF P  F
Sbjct: 402 TGYTLNNAWAKAHFGVMFTGVNLTFFPQHF 431



 Score = 37.1 bits (82), Expect = 0.27
 Identities = 16/20 (80%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI  HDTY VVA FHYVLS
Sbjct: 364 LDIALHDTYYVVAHFHYVLS 383


>UniRef50_Q9MIY8 Cluster: Cytochrome c oxidase subunit 1; n=861;
           root|Rep: Cytochrome c oxidase subunit 1 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 516

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 32/80 (40%), Positives = 44/80 (55%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXN 75
           QHFLGLAG+PRRYSD PD+Y   N +SS+GS IS ++V        E+    R  L    
Sbjct: 428 QHFLGLAGMPRRYSDYPDAYALWNTVSSIGSLISLVAVIMFLFILWEAFTAKREVLSVEL 487

Query: 74  LPSSIE*YQNLPPAXXSYNE 15
             +++E     PP   ++ E
Sbjct: 488 TATNVEWLHGCPPPYHTFEE 507



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 31/94 (32%), Positives = 43/94 (45%), Gaps = 6/94 (6%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXIG------YYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXAD 347
           F+FLF VGGLTG++LANS +       YY   +                  +++ ++   
Sbjct: 344 FIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLF--- 400

Query: 346 XLYVTGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
               TG +L S   KI    +FIGVN TF P  F
Sbjct: 401 ----TGYTLNSVWTKIHFGVMFIGVNLTFFPQHF 430



 Score = 37.1 bits (82), Expect = 0.27
 Identities = 16/20 (80%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI  HDTY VVA FHYVLS
Sbjct: 363 LDIVLHDTYYVVAHFHYVLS 382


>UniRef50_Q8SK39 Cluster: Cytochrome c oxidase subunit I; n=455;
           cellular organisms|Rep: Cytochrome c oxidase subunit I -
           Pandaka lidwilli
          Length = 507

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 33/80 (41%), Positives = 43/80 (53%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXN 75
           QHFLGLAG+PRRYSD PD+Y   N +SSLGS IS  +V        E+    R+      
Sbjct: 417 QHFLGLAGMPRRYSDYPDAYTLWNTVSSLGSLISLTAVIMFLFIIWEAFAAKRVVSGVEL 476

Query: 74  LPSSIE*YQNLPPAXXSYNE 15
             ++IE     PP   ++ E
Sbjct: 477 TSTNIEWLYGCPPPYHTFEE 496


>UniRef50_Q6ZLV6 Cluster: Cytochrome c oxidase subunit I; n=941;
           Eukaryota|Rep: Cytochrome c oxidase subunit I -
           Ophisurus macrorhynchos
          Length = 546

 Score = 60.1 bits (139), Expect = 3e-08
 Identities = 32/80 (40%), Positives = 43/80 (53%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXN 75
           QHFLGLAG+PRRYSD PD+Y   N +SS+GS +S  +V        E+    R   +   
Sbjct: 428 QHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSLVSLTAVVLFLFILWEAFSAKREVKWVEL 487

Query: 74  LPSSIE*YQNLPPAXXSYNE 15
             S+IE     PP   ++ E
Sbjct: 488 TTSNIEWLNGCPPPYHTFEE 507



 Score = 43.6 bits (98), Expect = 0.003
 Identities = 31/94 (32%), Positives = 42/94 (44%), Gaps = 6/94 (6%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXIG------YYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXAD 347
           F+FLF VGGLTG++LANS I       YY   +                  +++ ++   
Sbjct: 344 FIFLFTVGGLTGIVLANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLF--- 400

Query: 346 XLYVTGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
               TG +L     KI    +FIGVN TF P  F
Sbjct: 401 ----TGYTLHDTWTKIHFGVMFIGVNLTFFPQHF 430



 Score = 36.3 bits (80), Expect = 0.47
 Identities = 15/20 (75%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           +DI  HDTY VVA FHYVLS
Sbjct: 363 IDIVLHDTYYVVAHFHYVLS 382


>UniRef50_Q6RHX4 Cluster: Cytochrome c oxidase subunit I; n=26;
           Endopterygota|Rep: Cytochrome c oxidase subunit I -
           Partamona helleri
          Length = 88

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 34/76 (44%), Positives = 42/76 (55%)
 Frame = -1

Query: 230 IPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*Y 51
           +PRRYSD PDSY   N ISS+GS IS  S+        ES  + R+ LF  +  SS+E  
Sbjct: 2   MPRRYSDYPDSYYCWNFISSMGSMISMNSLLFLIFTIFESFMSKRLILFKFH-QSSLEWL 60

Query: 50  QNLPPAXXSYNERPIL 3
            N PP     NE P+L
Sbjct: 61  NNYPPFNHMCNEIPLL 76


>UniRef50_Q9MCX7 Cluster: Cytochrome c oxidase subunit I; n=181;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Piculus
           rubiginosus
          Length = 504

 Score = 56.0 bits (129), Expect = 5e-07
 Identities = 27/53 (50%), Positives = 34/53 (64%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXR 96
           QHFLGLAG+PRRYSD PD+Y   N +SS+GS IS  +V        E+  + R
Sbjct: 429 QHFLGLAGMPRRYSDYPDAYTLWNTMSSIGSLISMTAVIMLLFIIWEAFASKR 481



 Score = 41.1 bits (92), Expect = 0.016
 Identities = 32/90 (35%), Positives = 40/90 (44%), Gaps = 2/90 (2%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANS--XIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYV 335
           F+FLF VGGLTG++LANS   I  + T Y+                    G      L+ 
Sbjct: 345 FIFLFTVGGLTGIVLANSSLDIALHDTYYVVAHFHYVLSMGAVFAILA--GFTHWFPLF- 401

Query: 334 TGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
           TG +L S   K     +F GVN TF P  F
Sbjct: 402 TGYTLNSAWAKAHFGVMFTGVNLTFFPQHF 431



 Score = 37.1 bits (82), Expect = 0.27
 Identities = 16/20 (80%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI  HDTY VVA FHYVLS
Sbjct: 364 LDIALHDTYYVVAHFHYVLS 383


>UniRef50_A2T435 Cluster: Cytochrome c oxidase subunit I; n=126;
           Fungi/Metazoa group|Rep: Cytochrome c oxidase subunit I
           - Placozoan sp. BZ2423
          Length = 498

 Score = 52.8 bits (121), Expect = 5e-06
 Identities = 24/38 (63%), Positives = 30/38 (78%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSV 141
           QHFLGLAG+PRRY+D PD++   N ISS GS IS ++V
Sbjct: 395 QHFLGLAGLPRRYADYPDNFEDFNQISSFGSIISIIAV 432



 Score = 39.1 bits (87), Expect = 0.066
 Identities = 25/88 (28%), Positives = 37/88 (42%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYVTG 329
           F+FLF +GGLTG++L+NS +                          + G Y      +TG
Sbjct: 311 FIFLFTIGGLTGIVLSNSSLDILLHDTYYVVAHFHYVLSMGAVFAIFGGFYLWFG-KITG 369

Query: 328 LSLXSXILKIQXFTIFIGVNXTFXPNIF 245
            +       I  + +F+GVN TF P  F
Sbjct: 370 YAYKDIYGLIHFWLMFLGVNITFFPQHF 397



 Score = 36.7 bits (81), Expect = 0.35
 Identities = 16/20 (80%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI  HDTY VVA FHYVLS
Sbjct: 330 LDILLHDTYYVVAHFHYVLS 349


>UniRef50_Q5W4C3 Cluster: Cytochrome oxidase subunit I; n=79;
           Pterygota|Rep: Cytochrome oxidase subunit I -
           Biopyrellia bipuncta
          Length = 68

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 27/61 (44%), Positives = 36/61 (59%)
 Frame = -1

Query: 185 NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*YQNLPPAXXSYNERPI 6
           N+IS++GS IS L +        ES+ + R  +F   L SS+E  QN PPA  SYNE P+
Sbjct: 5   NVISTIGSTISFLGIIYFFYLVWESLVSQRQVIFPVQLNSSMEWLQNTPPAEHSYNELPL 64

Query: 5   L 3
           L
Sbjct: 65  L 65


>UniRef50_P48866 Cluster: Cytochrome c oxidase subunit 1; n=179;
           cellular organisms|Rep: Cytochrome c oxidase subunit 1 -
           Chondrus crispus (Carragheen)
          Length = 532

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 31/91 (34%), Positives = 44/91 (48%), Gaps = 8/91 (8%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXN--------XR 96
           HFLGLAG+PRR  D PD+Y   N+I+S GSYI+  S          S+ +          
Sbjct: 436 HFLGLAGMPRRIPDYPDAYAGWNLIASYGSYIALFSTLFFFYIVFVSLTSNNPCTNFPWE 495

Query: 95  INLFSXNLPSSIE*YQNLPPAXXSYNERPIL 3
            N       S++E     PPA  ++ E P++
Sbjct: 496 FNKSKTYGVSTLEWIVTSPPAYHTFEEMPLI 526



 Score = 45.6 bits (103), Expect = 8e-04
 Identities = 32/92 (34%), Positives = 44/92 (47%), Gaps = 2/92 (2%)
 Frame = -2

Query: 514 IRFVFLFXVGGLTGVILANS--XIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXL 341
           I F+FLF +GGLTG++LANS   I  + T Y+                  + G Y     
Sbjct: 349 IGFIFLFTIGGLTGIVLANSGLDISLHDTYYVVAHFHYVLSMGAVFAI--FAGFYYWFG- 405

Query: 340 YVTGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
            +TGL     + +I  ++ FIGVN TF P  F
Sbjct: 406 KITGLQYPETLGQIHFWSTFIGVNLTFMPMHF 437



 Score = 37.5 bits (83), Expect = 0.20
 Identities = 16/20 (80%), Positives = 17/20 (85%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI+ HDTY VVA FHYVLS
Sbjct: 370 LDISLHDTYYVVAHFHYVLS 389


>UniRef50_Q6TP93 Cluster: Cytochrome c oxidase subunit I; n=2;
           Bruchidius|Rep: Cytochrome c oxidase subunit I -
           Bruchidius aff. varius GLK-2003
          Length = 339

 Score = 49.6 bits (113), Expect = 5e-05
 Identities = 34/83 (40%), Positives = 40/83 (48%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYVTG 329
           FVFLF VGGLTGV+LANS I                            GI     L+ TG
Sbjct: 257 FVFLFTVGGLTGVVLANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGIVQWFPLF-TG 315

Query: 328 LSLXSXILKIQXFTIFIGVNXTF 260
           ++L +  LKIQ   +FIGVN TF
Sbjct: 316 VTLNNFFLKIQFIIMFIGVNLTF 338



 Score = 36.3 bits (80), Expect = 0.47
 Identities = 15/20 (75%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           +DI  HDTY VVA FHYVLS
Sbjct: 276 IDIVLHDTYYVVAHFHYVLS 295


>UniRef50_A7UG06 Cluster: Cytochrome oxidase subunits 1 and 2
           polyprotein; n=1; Phaeosphaeria nodorum SN15|Rep:
           Cytochrome oxidase subunits 1 and 2 polyprotein -
           Phaeosphaeria nodorum SN15
          Length = 789

 Score = 49.6 bits (113), Expect = 5e-05
 Identities = 22/34 (64%), Positives = 26/34 (76%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYIS 153
           QHFLGL G+PRR SD PD++   N ISS+GS IS
Sbjct: 428 QHFLGLQGMPRRISDYPDAFTGWNFISSIGSIIS 461



 Score = 43.6 bits (98), Expect = 0.003
 Identities = 28/90 (31%), Positives = 40/90 (44%), Gaps = 2/90 (2%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANS--XIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYV 335
           FVF+F +GGL+GV+LAN+   I ++ T Y+                 + W  +    L  
Sbjct: 344 FVFMFTIGGLSGVVLANASLDIAFHDTYYVVAHFHYVLSMGAVFALFSGWYFWIPKIL-- 401

Query: 334 TGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
            GL       K   + +F GVN TF P  F
Sbjct: 402 -GLDYNLLYSKAHFWVLFTGVNLTFFPQHF 430



 Score = 37.1 bits (82), Expect = 0.27
 Identities = 16/20 (80%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI  HDTY VVA FHYVLS
Sbjct: 363 LDIAFHDTYYVVAHFHYVLS 382


>UniRef50_P60620 Cluster: Cytochrome c oxidase subunit 1; n=2931;
           cellular organisms|Rep: Cytochrome c oxidase subunit 1 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 527

 Score = 49.6 bits (113), Expect = 5e-05
 Identities = 21/37 (56%), Positives = 27/37 (72%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSV 141
           HFLGL+G+PRR  D PD+Y   N +SS GSYIS + +
Sbjct: 431 HFLGLSGMPRRIPDYPDAYAGWNALSSFGSYISVVGI 467



 Score = 37.9 bits (84), Expect = 0.15
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 2/92 (2%)
 Frame = -2

Query: 514 IRFVFLFXVGGLTGVILANS--XIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXL 341
           + F+FLF +GGLTG++LANS   I  + T Y+                  + G Y     
Sbjct: 344 VGFIFLFTIGGLTGIVLANSGLDIALHDTYYVVAHFHYVLSMGAVFAL--FAGFYYWVG- 400

Query: 340 YVTGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
            + G +    + +I  +  F GVN TF P  F
Sbjct: 401 KIFGRTYPETLGQIHFWITFFGVNLTFFPMHF 432



 Score = 37.1 bits (82), Expect = 0.27
 Identities = 16/20 (80%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI  HDTY VVA FHYVLS
Sbjct: 365 LDIALHDTYYVVAHFHYVLS 384


>UniRef50_Q4FH11 Cluster: Cytochrome c oxidase subunit I; n=26;
           Bilateria|Rep: Cytochrome c oxidase subunit I - Samia
           cynthia ricini (Indian eri silkmoth)
          Length = 510

 Score = 49.2 bits (112), Expect = 6e-05
 Identities = 40/89 (44%), Positives = 42/89 (47%), Gaps = 3/89 (3%)
 Frame = -2

Query: 262 FXPNIF*V*LEYLDDIQIXQTHIFHEI*FLH*---VHIFLDYQ***XXLLFENQ*XTNEL 92
           F  NIF   LEYLDDI I Q     EI F H     H    Y      LLFENQ    EL
Sbjct: 422 FSLNIFSGSLEYLDDILIIQILTSLEISFHHSDLTFHCLPSYS---YSLLFENQSFITEL 478

Query: 91  TYFL*ISXHQLNDIKIYHQXXXHIMNDQF 5
            Y   +    LND KIY Q   H+MN QF
Sbjct: 479 LYLPSMYLLLLNDTKIYLQQSIHMMNYQF 507


>UniRef50_Q1L7C2 Cluster: Cytochrome c oxidase subunit I; n=2;
           Microphotus|Rep: Cytochrome c oxidase subunit I -
           Microphotus octarthrus
          Length = 65

 Score = 49.2 bits (112), Expect = 6e-05
 Identities = 27/62 (43%), Positives = 34/62 (54%)
 Frame = -1

Query: 218 YSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*YQNLP 39
           YSD PD Y   N ISS+GS +S +S+        +SI   +  LFS   PSS+E  Q  P
Sbjct: 2   YSDYPDVYSMWNSISSIGSLMSMVSIIFFIMILWKSISVKKKTLFSYQTPSSLEWIQKTP 61

Query: 38  PA 33
           PA
Sbjct: 62  PA 63


>UniRef50_Q8SHP5 Cluster: Cytochrome c oxidase subunit I; n=15;
           Fungi/Metazoa group|Rep: Cytochrome c oxidase subunit I
           - Trichoderma reesei (Hypocrea jecorina)
          Length = 635

 Score = 49.2 bits (112), Expect = 6e-05
 Identities = 21/34 (61%), Positives = 26/34 (76%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYIS 153
           QHFLGL G+PRR SD PD++   N+ISS GS +S
Sbjct: 535 QHFLGLQGMPRRISDYPDAFAGWNLISSFGSIVS 568


>UniRef50_Q1XA94 Cluster: Cytochrome c oxidase subunit I; n=825;
           Eukaryota|Rep: Cytochrome c oxidase subunit I -
           Paracoccidioides brasiliensis
          Length = 710

 Score = 48.8 bits (111), Expect = 8e-05
 Identities = 22/34 (64%), Positives = 26/34 (76%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYIS 153
           QHFLGL G+PRR SD PD++   N+ISS GS IS
Sbjct: 454 QHFLGLQGMPRRISDYPDAFEGWNLISSFGSIIS 487



 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 2/90 (2%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSX--IGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYV 335
           FV +F +GGL+GV+LAN+   I ++ T Y+                 + W  +      +
Sbjct: 370 FVVMFTIGGLSGVVLANASENIAFHDTYYVVAHFHYVLSMGAVFALFSGWYFWIPK---I 426

Query: 334 TGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
            GLS  +   KI  + +FIGVN TF P  F
Sbjct: 427 IGLSYDTKASKIHFWILFIGVNLTFFPQHF 456



 Score = 33.5 bits (73), Expect = 3.3
 Identities = 14/19 (73%), Positives = 15/19 (78%)
 Frame = -3

Query: 447 DITXHDTYXVVAXFHYVLS 391
           +I  HDTY VVA FHYVLS
Sbjct: 390 NIAFHDTYYVVAHFHYVLS 408


>UniRef50_Q35528 Cluster: Cytochrome oxidase subunit I; n=39;
           Aphidoidea|Rep: Cytochrome oxidase subunit I - Pemphigus
           microsetosus
          Length = 68

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 24/61 (39%), Positives = 35/61 (57%)
 Frame = -1

Query: 185 NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*YQNLPPAXXSYNERPI 6
           N+ISS+GS IS +S+         S    ++ +F  NL +SIE   NLPP   SY+E P+
Sbjct: 5   NMISSIGSMISTMSIIILIYTLWNSFFLKKMVMFKLNLNNSIEWIHNLPPLEHSYSELPL 64

Query: 5   L 3
           +
Sbjct: 65  V 65


>UniRef50_Q28SZ5 Cluster: Cytochrome-c oxidase; n=50; cellular
           organisms|Rep: Cytochrome-c oxidase - Jannaschia sp.
           (strain CCS1)
          Length = 628

 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYIS 153
           QHFLG  G+PRRY D PD++   N +SS+G++IS
Sbjct: 533 QHFLGRQGMPRRYIDYPDAFALWNYVSSIGAFIS 566



 Score = 34.7 bits (76), Expect = 1.4
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 5/93 (5%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXI--GYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYV 335
           F+FLF +GG TG+IL+ + +   Y+ T Y+                   +GI+ A   ++
Sbjct: 449 FIFLFTLGGTTGIILSQAGVDRAYHDTYYVVAHFHYVMSLGA------VFGIFAAVYYWI 502

Query: 334 ---TGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
              +G        ++  +  FIG N TF P  F
Sbjct: 503 GKMSGRQYPEWAGQVHFWVFFIGTNITFFPQHF 535



 Score = 32.3 bits (70), Expect = 7.6
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           +D   HDTY VVA FHYV+S
Sbjct: 468 VDRAYHDTYYVVAHFHYVMS 487


>UniRef50_O03826 Cluster: Cytochrome oxidase subunit I; n=21;
           Prodoxidae|Rep: Cytochrome oxidase subunit I - Greya
           powelli
          Length = 52

 Score = 45.6 bits (103), Expect = 8e-04
 Identities = 23/37 (62%), Positives = 25/37 (67%)
 Frame = -1

Query: 113 SIXNXRINLFSXNLPSSIE*YQNLPPAXXSYNERPIL 3
           S+ N  I LFS N+ SSIE  QN PPA  SYNE PIL
Sbjct: 13  SMINKNIVLFSLNMNSSIEWLQNFPPAEHSYNELPIL 49


>UniRef50_O47573 Cluster: Cytochrome c oxidase subunit I; n=42;
           Nematoda|Rep: Cytochrome c oxidase subunit I -
           Onchocerca volvulus
          Length = 548

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 3/86 (3%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXR---INLFS 81
           HF GL G+PR+  D PD Y +  IISSLGS I+ +          +SI   R   ++ ++
Sbjct: 439 HFAGLQGMPRKILDYPDCYSTFQIISSLGSVITFVGFVLFNYLLIDSIFFSRFLGVSFYN 498

Query: 80  XNLPSSIE*YQNLPPAXXSYNERPIL 3
            + P+      N+PP   S+ E   +
Sbjct: 499 YHSPAYA---LNVPPLPDSFTEEAFI 521



 Score = 36.3 bits (80), Expect = 0.47
 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 3/91 (3%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXL---Y 338
           F+FLF VGGL+G+IL+ + +       L                   +GI+    L   Y
Sbjct: 354 FIFLFTVGGLSGIILSAASLDI----ILHDTYYVVAHFHYTLSLGAIYGIFCGFCLWLPY 409

Query: 337 VTGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
           + G+S  S ++       F+G N TF P  F
Sbjct: 410 MYGISFDSVMMMAVFVCFFVGTNMTFFPMHF 440



 Score = 35.1 bits (77), Expect = 1.1
 Identities = 15/20 (75%), Positives = 15/20 (75%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI  HDTY VVA FHY LS
Sbjct: 373 LDIILHDTYYVVAHFHYTLS 392


>UniRef50_Q8WFY0 Cluster: Cytochrome oxidase subunit I; n=5;
           Eumalacostraca|Rep: Cytochrome oxidase subunit I -
           Paguristes turgidus
          Length = 68

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 23/61 (37%), Positives = 36/61 (59%)
 Frame = -1

Query: 185 NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*YQNLPPAXXSYNERPI 6
           N++SS+GS +S ++V        E++   R  +FS +L SSIE   + PPA  SY E P+
Sbjct: 5   NVVSSMGSMVSLVAVLGFIMIVWEALVASRPVMFSLSLASSIEWEHSYPPADHSYMEIPM 64

Query: 5   L 3
           +
Sbjct: 65  I 65


>UniRef50_Q5VIA7 Cluster: Cytochrome oxidase subunit I; n=1; Psyche
           norvegica|Rep: Cytochrome oxidase subunit I - Psyche
           norvegica
          Length = 63

 Score = 43.2 bits (97), Expect = 0.004
 Identities = 21/38 (55%), Positives = 25/38 (65%)
 Frame = -1

Query: 116 ESIXNXRINLFSXNLPSSIE*YQNLPPAXXSYNERPIL 3
           +S    RI LF  N+ SSIE +QN PPA  SY+E PIL
Sbjct: 23  KSFLTQRILLFPSNMTSSIEWFQNTPPANHSYDEMPIL 60


>UniRef50_Q6Y3P5 Cluster: Cytochrome oxidase subunit I; n=4;
           Talitridae|Rep: Cytochrome oxidase subunit I - Talitrus
           saltator
          Length = 59

 Score = 42.3 bits (95), Expect = 0.007
 Identities = 18/56 (32%), Positives = 34/56 (60%)
 Frame = -1

Query: 170 LGSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*YQNLPPAXXSYNERPIL 3
           LGSY+S +++        E+  + R+ +F  ++P+S+E +   PPA  SY++ P+L
Sbjct: 1   LGSYLSLVAMIIFIMMILEAFISKRVYMFHMHMPTSLEWHHPSPPADHSYDDTPLL 56


>UniRef50_Q9G8S1 Cluster: Cytochrome c oxidase subunit 1; n=1;
           Naegleria gruberi|Rep: Cytochrome c oxidase subunit 1 -
           Naegleria gruberi
          Length = 633

 Score = 40.7 bits (91), Expect = 0.022
 Identities = 18/37 (48%), Positives = 24/37 (64%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSV 141
           HFLG  G+PRR  D PD Y   N ++S G++IS  S+
Sbjct: 432 HFLGSGGMPRRIPDYPDMYQYHNTLASFGAFISFFSL 468



 Score = 39.1 bits (87), Expect = 0.066
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 2/90 (2%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXI--GYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYV 335
           FV LF +GG+TG+IL+N+ I    + T Y+                  Y G Y      +
Sbjct: 347 FVVLFTIGGITGIILSNAGIDTSIHDTHYVVGHFHYVLSMGAVFAI--YGGFYYW-WGKM 403

Query: 334 TGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
           TGLS    + +   +  FIGVN TF P  F
Sbjct: 404 TGLSYSESLGQAHFWMTFIGVNFTFFPMHF 433


>UniRef50_Q5W914 Cluster: Cytochrome c oxidase subunit I; n=9;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Lingula
           unguis
          Length = 573

 Score = 39.9 bits (89), Expect = 0.038
 Identities = 23/67 (34%), Positives = 33/67 (49%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRINLFSXNL 72
           H++GL G+PRRY D PD +     IS+ G + S L++        E     R  LF+  +
Sbjct: 435 HWMGLTGMPRRYQDYPDIHSVWQAISTTGGFCSYLAMGLFISAIWEVYLVQRPLLFAFFV 494

Query: 71  PSSIE*Y 51
            S  E Y
Sbjct: 495 RSESEYY 501



 Score = 33.1 bits (72), Expect = 4.4
 Identities = 25/87 (28%), Positives = 34/87 (39%)
 Frame = -2

Query: 514 IRFVFLFXVGGLTGVILANSXIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYV 335
           I  V LF +GGLTGVILAN+ +                          + G +     + 
Sbjct: 348 IGVVLLFTIGGLTGVILANAALSTLLHDSYYVVAHFHYVLSMGAVFAIFGGFWFWFPFW- 406

Query: 334 TGLSLXSXILKIQXFTIFIGVNXTFXP 254
           TG+     ++       FIGVN TF P
Sbjct: 407 TGMVPRKDLVLTHFMLTFIGVNFTFFP 433


>UniRef50_Q5UC96 Cluster: Cytochrome c oxidase subunit I; n=48;
           Formicidae|Rep: Cytochrome c oxidase subunit I -
           Pheidole capellinii
          Length = 68

 Score = 39.9 bits (89), Expect = 0.038
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = -1

Query: 197 YIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXR--INLFSXNLPSSIE*YQNLPPAXXS 24
           ++S NIISS+GS IS LS+        E++   +  IN+F  N  +S+E     PP   S
Sbjct: 4   FLSWNIISSIGSLISMLSLTLLMFIIWEALSTKKKIINMFFLN--ASLEWQNFYPPLNHS 61

Query: 23  YNERP 9
           YNE P
Sbjct: 62  YNEIP 66


>UniRef50_Q1NET5 Cluster: Cytochrome-c oxidase; n=3;
           Alphaproteobacteria|Rep: Cytochrome-c oxidase -
           Sphingomonas sp. SKA58
          Length = 556

 Score = 37.9 bits (84), Expect = 0.15
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLG 165
           HFLGL+G+PRRY D P+++   N I+S G
Sbjct: 471 HFLGLSGMPRRYPDYPEAFAYWNGIASHG 499



 Score = 34.3 bits (75), Expect = 1.9
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXI 449
           F+FLF VGG+TGV+LAN  +
Sbjct: 386 FIFLFTVGGVTGVVLANGGV 405



 Score = 33.1 bits (72), Expect = 4.4
 Identities = 14/20 (70%), Positives = 15/20 (75%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           +D   HDTY VVA FHYVLS
Sbjct: 405 VDDVLHDTYYVVAHFHYVLS 424


>UniRef50_Q8LX70 Cluster: Cytochrome c oxidase subunit I; n=4;
           Chaoborus|Rep: Cytochrome c oxidase subunit I -
           Chaoborus crystallinus (Phantom midge) (Tipula
           crystallina)
          Length = 207

 Score = 37.1 bits (82), Expect = 0.27
 Identities = 16/20 (80%), Positives = 18/20 (90%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXI 449
           FVFLF VGGLTGV+LANS +
Sbjct: 48  FVFLFTVGGLTGVVLANSSL 67



 Score = 37.1 bits (82), Expect = 0.27
 Identities = 16/20 (80%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI  HDTY VVA FHYVLS
Sbjct: 67  LDIVLHDTYYVVAHFHYVLS 86


>UniRef50_Q1XAB3 Cluster: Cytochrome oxidase subunit I; n=14;
           Neoptera|Rep: Cytochrome oxidase subunit I - Kalotermes
           flavicollis
          Length = 57

 Score = 37.1 bits (82), Expect = 0.27
 Identities = 22/52 (42%), Positives = 27/52 (51%)
 Frame = -1

Query: 158 ISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*YQNLPPAXXSYNERPIL 3
           IS +SV        ES+   R  LF     +SIE  QNLPPA  SY+E P +
Sbjct: 2   ISFVSVLMFIFIMWESMSTNRQILFPTQTSNSIEWIQNLPPAEHSYSELPTI 53


>UniRef50_P29649 Cluster: Cytochrome c oxidase subunit 1; n=441;
           Bilateria|Rep: Cytochrome c oxidase subunit 1 - Pantodon
           buchholtzi (Butterflyfish)
          Length = 184

 Score = 37.1 bits (82), Expect = 0.27
 Identities = 16/20 (80%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI  HDTY VVA FHYVLS
Sbjct: 128 LDIVLHDTYYVVAHFHYVLS 147



 Score = 36.7 bits (81), Expect = 0.35
 Identities = 15/20 (75%), Positives = 18/20 (90%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXI 449
           F+FLF VGGLTG+ILANS +
Sbjct: 109 FIFLFTVGGLTGIILANSSL 128


>UniRef50_Q8LX74 Cluster: Cytochrome c oxidase subunit I; n=1;
           Chaoborus punctipennis|Rep: Cytochrome c oxidase subunit
           I - Chaoborus punctipennis
          Length = 205

 Score = 36.3 bits (80), Expect = 0.47
 Identities = 33/103 (32%), Positives = 44/103 (42%)
 Frame = -2

Query: 349 DXLYVTGLSLXSXILKIQXFTIFIGVNXTFXPNIF*V*LEYLDDIQIXQTHIFHEI*FLH 170
           D  Y+    L    LK      F+ +   F  NIF    EYLDDIQI    +  E+ +  
Sbjct: 100 DTHYLQDFLLMQNDLKFNLQLYFLELILHFSHNIFLDLPEYLDDIQIFLMDLIVEMLYQD 159

Query: 169 *VHIFLDYQ***XXLLFENQ*XTNELTYFL*ISXHQLNDIKIY 41
               +L  +     LLFE +    +  YFL    H LND KI+
Sbjct: 160 LDLYYLLLELSISYLLFEKELSQIDQFYFLLNYRHLLNDTKIF 202


>UniRef50_Q85HI4 Cluster: Cytochrome c oxidase subunit I; n=7;
           Echinoida|Rep: Cytochrome c oxidase subunit I -
           Echinometra oblonga
          Length = 386

 Score = 36.3 bits (80), Expect = 0.47
 Identities = 15/20 (75%), Positives = 18/20 (90%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXI 449
           FVFLF +GGLTG++LANS I
Sbjct: 321 FVFLFTLGGLTGIVLANSSI 340



 Score = 35.9 bits (79), Expect = 0.62
 Identities = 14/20 (70%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           +D+  HDTY VVA FHYVLS
Sbjct: 340 IDVVLHDTYYVVAHFHYVLS 359


>UniRef50_Q9B8X8 Cluster: Cytochrome c oxidase subunit I; n=517;
           Bilateria|Rep: Cytochrome c oxidase subunit I -
           Schistosoma mansoni (Blood fluke)
          Length = 609

 Score = 35.9 bits (79), Expect = 0.62
 Identities = 16/36 (44%), Positives = 23/36 (63%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLS 144
           H+LG+ G+PRR S     Y   N+ISS+G  +S +S
Sbjct: 520 HYLGIHGLPRRVSCYDQEYYWVNVISSIGGVLSVVS 555



 Score = 34.7 bits (76), Expect = 1.4
 Identities = 15/20 (75%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LDI  HDT+ VVA FHYVLS
Sbjct: 454 LDILFHDTWFVVAHFHYVLS 473


>UniRef50_Q7YEU6 Cluster: Endonuclease; n=4; Fungi/Metazoa
           group|Rep: Endonuclease - Saccharomyces servazzii
           (Yeast)
          Length = 675

 Score = 35.9 bits (79), Expect = 0.62
 Identities = 15/22 (68%), Positives = 19/22 (86%)
 Frame = -2

Query: 514 IRFVFLFXVGGLTGVILANSXI 449
           I F+FLF VGGLTGV+LAN+ +
Sbjct: 342 IAFLFLFTVGGLTGVVLANASL 363


>UniRef50_Q0AI64 Cluster: Cytochrome-c oxidase; n=3;
           Proteobacteria|Rep: Cytochrome-c oxidase - Nitrosomonas
           eutropha (strain C71)
          Length = 703

 Score = 35.1 bits (77), Expect = 1.1
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = -2

Query: 514 IRFVFLFXVGGLTGVILANSXIGY 443
           + F+FLF +GG+TG++LAN  + Y
Sbjct: 405 LAFIFLFVIGGITGIMLANPILDY 428


>UniRef50_Q8ZXD1 Cluster: Cytochrome C oxidase subunit I /III; n=4;
           cellular organisms|Rep: Cytochrome C oxidase subunit I
           /III - Pyrobaculum aerophilum
          Length = 800

 Score = 35.1 bits (77), Expect = 1.1
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = -3

Query: 468 F*PILLLDITXHDTYXVVAXFHYVLS 391
           F P++ LD+  HDTY V+  FHY+++
Sbjct: 366 FFPVITLDLHLHDTYFVLGHFHYIVN 391


>UniRef50_Q9TAP9 Cluster: Cytochrome c oxidase subunit I; n=2;
           Toxoplasma gondii|Rep: Cytochrome c oxidase subunit I -
           Toxoplasma gondii
          Length = 192

 Score = 34.3 bits (75), Expect = 1.9
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           +DI  HDTY +VA FH+VLS
Sbjct: 77  MDIALHDTYYIVAHFHFVLS 96


>UniRef50_Q94ZM7 Cluster: COI protein; n=2; Sessilia|Rep: COI
           protein - Balanus crenatus
          Length = 58

 Score = 34.3 bits (75), Expect = 1.9
 Identities = 18/53 (33%), Positives = 27/53 (50%)
 Frame = -1

Query: 167 GSYISRLSVXXXXXXX*ESIXNXRINLFSXNLPSSIE*YQNLPPAXXSYNERP 9
           GS +S +S         E++ + R  +FS NL S++E     PP   SY+E P
Sbjct: 1   GSTLSFISTLGFIYIGWEAMVSQRPTIFSPNLSSNLEWVHTTPPHYHSYDELP 53


>UniRef50_P14544 Cluster: Cytochrome c oxidase subunit 1; n=7;
           Eukaryota|Rep: Cytochrome c oxidase subunit 1 -
           Leishmania tarentolae (Sauroleishmania tarentolae)
          Length = 549

 Score = 34.3 bits (75), Expect = 1.9
 Identities = 14/20 (70%), Positives = 15/20 (75%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           +DI  HDTY VV  FHYVLS
Sbjct: 365 IDIMLHDTYFVVGHFHYVLS 384


>UniRef50_A3ZTG1 Cluster: Cytochrome c oxidase subunit I; n=1;
           Blastopirellula marina DSM 3645|Rep: Cytochrome c
           oxidase subunit I - Blastopirellula marina DSM 3645
          Length = 595

 Score = 33.9 bits (74), Expect = 2.5
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVL 394
           +DI  HDTY +VA FHYVL
Sbjct: 411 VDIVIHDTYFIVAHFHYVL 429


>UniRef50_Q4XXN6 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 329

 Score = 33.9 bits (74), Expect = 2.5
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           +D+  HDTY V+A FH+VLS
Sbjct: 73  IDVALHDTYYVIAHFHFVLS 92



 Score = 33.1 bits (72), Expect = 4.4
 Identities = 15/30 (50%), Positives = 19/30 (63%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGS 162
           HFLG   +PRR  D PD+    N+I S+GS
Sbjct: 140 HFLGFNVMPRRIPDYPDALNGWNMICSIGS 169


>UniRef50_Q02766 Cluster: Cytochrome c oxidase subunit 1; n=107;
           Alveolata|Rep: Cytochrome c oxidase subunit 1 -
           Plasmodium falciparum
          Length = 476

 Score = 33.9 bits (74), Expect = 2.5
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           +D+  HDTY V+A FH+VLS
Sbjct: 369 IDVALHDTYYVIAHFHFVLS 388



 Score = 33.1 bits (72), Expect = 4.4
 Identities = 15/30 (50%), Positives = 19/30 (63%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGS 162
           HFLG   +PRR  D PD+    N+I S+GS
Sbjct: 436 HFLGFNVMPRRIPDYPDALNGWNMICSIGS 465


>UniRef50_Q9XLV8 Cluster: Cytochrome c oxidase subunit I; n=1;
           Diplonema papillatum|Rep: Cytochrome c oxidase subunit I
           - Diplonema papillatum
          Length = 287

 Score = 33.5 bits (73), Expect = 3.3
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           +D+  HD+Y VVA FHYVLS
Sbjct: 119 VDLVMHDSYYVVAHFHYVLS 138


>UniRef50_Q11EK8 Cluster: Cytochrome c oxidase, subunit I; n=5;
           Proteobacteria|Rep: Cytochrome c oxidase, subunit I -
           Mesorhizobium sp. (strain BNC1)
          Length = 845

 Score = 32.7 bits (71), Expect = 5.8
 Identities = 13/19 (68%), Positives = 14/19 (73%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVL 394
           +D   HDTY VVA FHYVL
Sbjct: 390 IDFQVHDTYFVVAHFHYVL 408


>UniRef50_Q79VD7 Cluster: Cytochrome c oxidase subunit 1; n=93;
           Actinobacteria (class)|Rep: Cytochrome c oxidase subunit
           1 - Corynebacterium glutamicum (Brevibacterium flavum)
          Length = 584

 Score = 32.7 bits (71), Expect = 5.8
 Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 2/40 (5%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDS--YIS*NIISSLGSYISRLSV 141
           QH++G  G+PRRY+D  DS  +   N IS++ S++  LSV
Sbjct: 450 QHWVGNMGMPRRYADYLDSDGFTIYNQISTVFSFLLGLSV 489


>UniRef50_Q1H1C1 Cluster: Cytochrome-c oxidase; n=1; Methylobacillus
           flagellatus KT|Rep: Cytochrome-c oxidase -
           Methylobacillus flagellatus (strain KT / ATCC 51484 /
           DSM 6875)
          Length = 631

 Score = 32.3 bits (70), Expect = 7.6
 Identities = 13/18 (72%), Positives = 14/18 (77%)
 Frame = -3

Query: 447 DITXHDTYXVVAXFHYVL 394
           D+  HDTY VVA FHYVL
Sbjct: 385 DMQAHDTYFVVAHFHYVL 402


>UniRef50_Q1CZF1 Cluster: Cytochrome c oxidase, subunit I; n=1;
           Myxococcus xanthus DK 1622|Rep: Cytochrome c oxidase,
           subunit I - Myxococcus xanthus (strain DK 1622)
          Length = 556

 Score = 32.3 bits (70), Expect = 7.6
 Identities = 11/19 (57%), Positives = 15/19 (78%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVL 394
           LD+  HDTY VVA FH+++
Sbjct: 388 LDVAWHDTYFVVAHFHFIM 406


>UniRef50_A6C0L1 Cluster: Cytochrome c oxidase subunit I; n=1;
           Planctomyces maris DSM 8797|Rep: Cytochrome c oxidase
           subunit I - Planctomyces maris DSM 8797
          Length = 606

 Score = 32.3 bits (70), Expect = 7.6
 Identities = 11/19 (57%), Positives = 15/19 (78%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVL 394
           +D+  HDTY +VA FHY+L
Sbjct: 414 VDVYFHDTYFIVAHFHYIL 432


>UniRef50_Q9MLW1 Cluster: Cytochrome c oxidase subunit I; n=5;
           Naupactini|Rep: Cytochrome c oxidase subunit I -
           Galapaganus collaris
          Length = 406

 Score = 32.3 bits (70), Expect = 7.6
 Identities = 14/19 (73%), Positives = 14/19 (73%)
 Frame = -3

Query: 447 DITXHDTYXVVAXFHYVLS 391
           DI  HDTY VVA  HYVLS
Sbjct: 282 DIILHDTYYVVAHXHYVLS 300


>UniRef50_P34956 Cluster: Quinol oxidase subunit 1 (EC 1.10.3.-)
           (Quinol oxidase polypeptide I) (Quinol oxidase aa3-600,
           subunit qoxB) (Oxidase aa(3)-600 subunit 1); n=45;
           Bacillales|Rep: Quinol oxidase subunit 1 (EC 1.10.3.-)
           (Quinol oxidase polypeptide I) (Quinol oxidase aa3-600,
           subunit qoxB) (Oxidase aa(3)-600 subunit 1) - Bacillus
           subtilis
          Length = 649

 Score = 32.3 bits (70), Expect = 7.6
 Identities = 16/35 (45%), Positives = 26/35 (74%), Gaps = 2/35 (5%)
 Frame = -1

Query: 254 QHFLGLAGIPRR-YSDXP-DSYIS*NIISSLGSYI 156
           Q+FLGL G+PRR Y+  P D + + N IS++G+++
Sbjct: 467 QYFLGLQGMPRRIYTYGPNDGWTTLNFISTVGAFM 501


>UniRef50_Q0H8Y3 Cluster: Probable intron-encoded endonuclease aI8
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI8 (EC
           3.1.-.-)]; n=103; Eukaryota|Rep: Probable intron-encoded
           endonuclease aI8 precursor [Contains: Truncated
           non-functional cytochrome oxidase 1; Intron-encoded
           endonuclease aI8 (EC 3.1.-.-)] - Ustilago maydis (Smut
           fungus)
          Length = 645

 Score = 32.3 bits (70), Expect = 7.6
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = -2

Query: 508 FVFLFXVGGLTGVILANSXI 449
           F+ LF +GGLTGVILAN+ +
Sbjct: 343 FIALFTIGGLTGVILANASL 362


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 312,116,573
Number of Sequences: 1657284
Number of extensions: 4007016
Number of successful extensions: 5977
Number of sequences better than 10.0: 57
Number of HSP's better than 10.0 without gapping: 5745
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5963
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 35822246242
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).