SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0010
         (598 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9QXL8 Cluster: Nucleoside diphosphate kinase 7; n=27; ...    62   7e-09
UniRef50_UPI000155C941 Cluster: PREDICTED: similar to nm23-H7; n...    61   2e-08
UniRef50_Q9Y5B8 Cluster: Nucleoside diphosphate kinase 7; n=13; ...    60   3e-08
UniRef50_UPI0000F1E245 Cluster: PREDICTED: similar to Ndpkz4 pro...    60   4e-08
UniRef50_A0DYI7 Cluster: Nucleoside diphosphate kinase; n=6; Euk...    60   5e-08
UniRef50_Q4S118 Cluster: Chromosome 1 SCAF14770, whole genome sh...    56   5e-07
UniRef50_Q7QBD0 Cluster: ENSANGP00000014742; n=2; Culicidae|Rep:...    56   6e-07
UniRef50_UPI00015B63B4 Cluster: PREDICTED: similar to Ndpkz4 pro...    54   2e-06
UniRef50_UPI0000D56ADF Cluster: PREDICTED: similar to Nucleoside...    54   2e-06
UniRef50_UPI00006CEB9B Cluster: V-type ATPase 116kDa subunit fam...    53   6e-06
UniRef50_UPI0000DB7C61 Cluster: PREDICTED: similar to Nucleoside...    49   7e-05
UniRef50_UPI00005637F3 Cluster: nucleoside diphosphate kinase-Z4...    46   7e-04
UniRef50_Q581Q9 Cluster: Nucleoside diphosphate kinase, putative...    44   0.003
UniRef50_A4IBS5 Cluster: Nucleoside diphosphate kinase, putative...    42   0.011
UniRef50_A6ERK7 Cluster: Hyalin repeat protein; n=1; unidentifie...    36   0.55 
UniRef50_UPI00006CBFD9 Cluster: hypothetical protein TTHERM_0040...    36   0.96 
UniRef50_Q2UHL2 Cluster: Predicted protein; n=1; Aspergillus ory...    35   1.7  
UniRef50_Q5DYK3 Cluster: Methyl-accepting chemotaxis protein; n=...    34   2.2  
UniRef50_A5HY09 Cluster: Spore coat protein; n=4; Clostridium bo...    33   5.1  
UniRef50_Q3VNL1 Cluster: TPR repeat; n=1; Pelodictyon phaeoclath...    33   6.7  
UniRef50_A5K3H7 Cluster: Putative uncharacterized protein; n=5; ...    33   6.7  
UniRef50_Q8IEQ5 Cluster: Putative uncharacterized protein MAL13P...    32   8.9  

>UniRef50_Q9QXL8 Cluster: Nucleoside diphosphate kinase 7; n=27;
           Eumetazoa|Rep: Nucleoside diphosphate kinase 7 - Mus
           musculus (Mouse)
          Length = 395

 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 30/79 (37%), Positives = 47/79 (59%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           ++++F  E YD +A  ++   L ++P D SV++ D K  +  LKR +   L L+ L IGN
Sbjct: 24  ERFAFIAEWYDPNASLLRRYELLFYPVDGSVEMHDVKNRRTFLKRTKYEDLRLEDLFIGN 83

Query: 435 IVNIFSKLLYIQDCGSCYT 491
            VN+FS+ L + D G  YT
Sbjct: 84  KVNVFSRQLVLIDYGDQYT 102


>UniRef50_UPI000155C941 Cluster: PREDICTED: similar to nm23-H7; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           nm23-H7 - Ornithorhynchus anatinus
          Length = 541

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 30/79 (37%), Positives = 46/79 (58%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           +++ F  E YD +A  ++   L ++P D SV++ D K  +  LKR +   ++LD L IGN
Sbjct: 62  ERFVFLSEWYDPNASLLRRFELLFYPKDGSVEMFDVKNHRTFLKRTKYDSVHLDDLFIGN 121

Query: 435 IVNIFSKLLYIQDCGSCYT 491
            V IFS+ L + D G  YT
Sbjct: 122 KVTIFSRQLMLVDYGDQYT 140


>UniRef50_Q9Y5B8 Cluster: Nucleoside diphosphate kinase 7; n=13;
           Eutheria|Rep: Nucleoside diphosphate kinase 7 - Homo
           sapiens (Human)
          Length = 376

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 30/79 (37%), Positives = 47/79 (59%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           +++ F  E YD +A  ++   L ++P D SV++ D K  +  LKR +   L+L+ L IGN
Sbjct: 5   ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64

Query: 435 IVNIFSKLLYIQDCGSCYT 491
            VN+FS+ L + D G  YT
Sbjct: 65  KVNVFSRQLVLIDYGDQYT 83


>UniRef50_UPI0000F1E245 Cluster: PREDICTED: similar to Ndpkz4
           protein; n=1; Danio rerio|Rep: PREDICTED: similar to
           Ndpkz4 protein - Danio rerio
          Length = 418

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 30/81 (37%), Positives = 46/81 (56%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           ++++F  E YD  A  ++   L Y+P D SV++ D K  +  L+R +L  L  + L +GN
Sbjct: 3   ERFAFLAEWYDPSAALLRRYQLLYYPKDGSVEMFDMKNQRTFLRRTKLEELQPEDLFVGN 62

Query: 435 IVNIFSKLLYIQDCGSCYTEN 497
            VNIFS+ L +   G  YT N
Sbjct: 63  RVNIFSRQLNLISYGDQYTAN 83


>UniRef50_A0DYI7 Cluster: Nucleoside diphosphate kinase; n=6;
           Eukaryota|Rep: Nucleoside diphosphate kinase -
           Paramecium tetraurelia
          Length = 376

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 28/84 (33%), Positives = 46/84 (54%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           ++Y F  E +D  A  I+   L YF  D ++++ D K  +  LKR + P + L  L +G+
Sbjct: 6   ERYVFIVEWFDTSASLIRSYNLIYFMADKTIEMFDLKNKRIFLKRCEYPSVQLKDLYVGS 65

Query: 435 IVNIFSKLLYIQDCGSCYTENAFQ 506
           IV +FS+ L I D    +T + F+
Sbjct: 66  IVTVFSRQLKIVDYADVFTRSKFE 89


>UniRef50_Q4S118 Cluster: Chromosome 1 SCAF14770, whole genome
           shotgun sequence; n=2; Tetraodon nigroviridis|Rep:
           Chromosome 1 SCAF14770, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 378

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 29/79 (36%), Positives = 45/79 (56%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           ++Y+F  +  D  A   +   L Y+P D SV++ D K+ +  LKRV+   L+   L +GN
Sbjct: 1   ERYAFLADWVDPAAAARRRFQLFYYPNDGSVEMYDLKRQQKFLKRVRYDTLDPKDLFVGN 60

Query: 435 IVNIFSKLLYIQDCGSCYT 491
            VN+FS+ L + D G  YT
Sbjct: 61  RVNVFSRQLNLMDYGDEYT 79


>UniRef50_Q7QBD0 Cluster: ENSANGP00000014742; n=2; Culicidae|Rep:
           ENSANGP00000014742 - Anopheles gambiae str. PEST
          Length = 366

 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 28/74 (37%), Positives = 43/74 (58%)
 Frame = +3

Query: 276 EMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGNIVNIFSK 455
           E Y ++AD  + L +++FP DNSV+++D K  K  L+R ++  LN +   IG  + IF K
Sbjct: 4   EWYQKEADLNRQLVVSFFPSDNSVELVDLKTRKTFLRRTKIEELNENDFFIGAKLLIFGK 63

Query: 456 LLYIQDCGSCYTEN 497
            + I D G   T N
Sbjct: 64  QINILDYGDAKTRN 77


>UniRef50_UPI00015B63B4 Cluster: PREDICTED: similar to Ndpkz4
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to Ndpkz4 protein - Nasonia vitripennis
          Length = 360

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 27/71 (38%), Positives = 39/71 (54%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           D+Y F  E YD+ A  ++   L YFP DNSV++ D K  K  L+R +   +      +G 
Sbjct: 6   DRYIFEAEWYDKVAYTLRKFYLYYFPSDNSVELFDLKTRKTFLRRTKCEGVEAKDFYVGA 65

Query: 435 IVNIFSKLLYI 467
           IV IFS+ + I
Sbjct: 66  IVTIFSRSIKI 76


>UniRef50_UPI0000D56ADF Cluster: PREDICTED: similar to Nucleoside
           diphosphate kinase 7 (NDK 7) (NDP kinase 7) (nm23-R7);
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           Nucleoside diphosphate kinase 7 (NDK 7) (NDP kinase 7)
           (nm23-R7) - Tribolium castaneum
          Length = 387

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 29/80 (36%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           DK SF  E +D D+   K L LNY+P D++V++ D    +  LKR     ++ D + +GN
Sbjct: 11  DKLSFIAEWFDFDSAYQKRLLLNYYPVDSTVELYDIDLKRPFLKRSFYECISRDDVFVGN 70

Query: 435 IVNIFSKLLYIQDCGSCYTE 494
            V I+ + L I D   C T+
Sbjct: 71  KVRIYDRQLKIVDYADCRTK 90


>UniRef50_UPI00006CEB9B Cluster: V-type ATPase 116kDa subunit family
            protein; n=2; Tetrahymena thermophila SB210|Rep: V-type
            ATPase 116kDa subunit family protein - Tetrahymena
            thermophila SB210
          Length = 2005

 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 29/83 (34%), Positives = 45/83 (54%)
 Frame = +3

Query: 258  KYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGNI 437
            +Y F  E +D  A  I+   L YF  D ++++ D K  K  LKR +    + D L IG+I
Sbjct: 948  RYIFIVEWFDTAASLIRTYYLTYFTQDKTIEMYDLKNKKVFLKRCEYAIKDSD-LYIGSI 1006

Query: 438  VNIFSKLLYIQDCGSCYTENAFQ 506
            +N++S+ L I D    +T + FQ
Sbjct: 1007 LNVYSRQLKIVDFADVFTRSKFQ 1029


>UniRef50_UPI0000DB7C61 Cluster: PREDICTED: similar to Nucleoside
           diphosphate kinase 7 (NDK 7) (NDP kinase 7) (nm23-R7);
           n=1; Apis mellifera|Rep: PREDICTED: similar to
           Nucleoside diphosphate kinase 7 (NDK 7) (NDP kinase 7)
           (nm23-R7) - Apis mellifera
          Length = 326

 Score = 49.2 bits (112), Expect = 7e-05
 Identities = 21/45 (46%), Positives = 29/45 (64%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKR 389
           +KY+F  E YD+ A  +K   L Y+PFDN+V++ D K  K  LKR
Sbjct: 6   EKYTFEAEWYDKVASVLKKFYLYYYPFDNTVELFDLKTKKTFLKR 50


>UniRef50_UPI00005637F3 Cluster: nucleoside diphosphate kinase-Z4;
           n=1; Giardia lamblia ATCC 50803|Rep: nucleoside
           diphosphate kinase-Z4 - Giardia lamblia ATCC 50803
          Length = 387

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +3

Query: 258 KYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGNI 437
           +YSF    YD  AD+ +   L+Y+P    + + +    +  LK+ Q P  N     +G  
Sbjct: 5   RYSFNVLWYDRIADQDRPYILSYYPDTREIDMYEVATKRVFLKKCQYPEFNFADCHVGGT 64

Query: 438 VNIFSKLLYIQDCGSCYTENA 500
           V I+S+ L I    + +T NA
Sbjct: 65  VTIYSRQLKIVGYANDFTCNA 85


>UniRef50_Q581Q9 Cluster: Nucleoside diphosphate kinase, putative;
           n=2; Trypanosoma|Rep: Nucleoside diphosphate kinase,
           putative - Trypanosoma brucei
          Length = 349

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +3

Query: 258 KYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGNI 437
           + SF CE YD  A  +    L ++  D +V+I +  K +  LKR   P LN D  ++G+ 
Sbjct: 9   RLSFYCEQYDHIAHRMNHYVLQFYFEDRTVEIREVTKNRLHLKRAHFPHLNRDDFKVGSS 68

Query: 438 VNIFSKLL 461
           +++   ++
Sbjct: 69  LSLLGGVI 76


>UniRef50_A4IBS5 Cluster: Nucleoside diphosphate kinase, putative;
           n=5; Trypanosomatidae|Rep: Nucleoside diphosphate
           kinase, putative - Leishmania infantum
          Length = 337

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 264 SFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGNIVN 443
           +F  E +D  A   +     YF  D ++++ + K  +  LKR   P L+ + L +G  +N
Sbjct: 8   TFVVEYFDPQASLSRTYQFCYFTDDKTIEMYNLKTKRLFLKRCAYPSLSPNELYVGATIN 67

Query: 444 IFSKLLYIQDCG 479
           +FS+ L I D G
Sbjct: 68  VFSRPLRIIDYG 79


>UniRef50_A6ERK7 Cluster: Hyalin repeat protein; n=1; unidentified
           eubacterium SCB49|Rep: Hyalin repeat protein -
           unidentified eubacterium SCB49
          Length = 1008

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 11/31 (35%), Positives = 23/31 (74%)
 Frame = -2

Query: 138 NFVKKYAFIFVVCFISTQSSHQRNEFSVMNN 46
           N + +Y F+F++CF+ST ++ + N F+ +N+
Sbjct: 2   NKITQYVFVFIMCFLSTLNAQEENSFTSLNS 32


>UniRef50_UPI00006CBFD9 Cluster: hypothetical protein TTHERM_00409040;
            n=1; Tetrahymena thermophila SB210|Rep: hypothetical
            protein TTHERM_00409040 - Tetrahymena thermophila SB210
          Length = 1362

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 13/23 (56%), Positives = 18/23 (78%)
 Frame = +3

Query: 288  EDADEIKDLTLNYFPFDNSVQII 356
            ED D++K   +NYFPFD S++II
Sbjct: 1107 EDCDKLKQQIINYFPFDTSIKII 1129


>UniRef50_Q2UHL2 Cluster: Predicted protein; n=1; Aspergillus
           oryzae|Rep: Predicted protein - Aspergillus oryzae
          Length = 459

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 16/45 (35%), Positives = 28/45 (62%)
 Frame = -3

Query: 596 AKSIFHDERGLFSQVHWELSAXIMAKYLALLESVFRVAGAAILDI 462
           A+ ++H  RGLF  VHW++S  I+A  L +L  +    G+++ D+
Sbjct: 229 AQDMYH--RGLFHGVHWDISNMILAASLTMLYIILARKGSSVEDM 271


>UniRef50_Q5DYK3 Cluster: Methyl-accepting chemotaxis protein; n=1;
           Vibrio fischeri ES114|Rep: Methyl-accepting chemotaxis
           protein - Vibrio fischeri (strain ATCC 700601 / ES114)
          Length = 533

 Score = 34.3 bits (75), Expect = 2.2
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 3/79 (3%)
 Frame = +3

Query: 234 SNGIRLLDKYSFXCEMYDEDADEIKD---LTLNYFPFDNSVQIIDAKKGKNVLKRVQLPP 404
           +N   LL+KY      YD + D++K+   L      ++N++++   KKG N    + L  
Sbjct: 81  NNSTILLNKYLTEYGTYDANEDDLKEYAKLKKLITAYNNAIELA-LKKGNNYNYEINLDL 139

Query: 405 LNLDMLQIGNIVNIFSKLL 461
           LN  +  I NI NI  K +
Sbjct: 140 LNKALKSIENIKNINKKYI 158


>UniRef50_A5HY09 Cluster: Spore coat protein; n=4; Clostridium
           botulinum|Rep: Spore coat protein - Clostridium
           botulinum A str. ATCC 3502
          Length = 337

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 19/47 (40%), Positives = 28/47 (59%)
 Frame = +3

Query: 252 LDKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRV 392
           L KY+   +++D+    IKD+    +P  N V IID  KGK +LK+V
Sbjct: 9   LKKYNLSSDLFDQYDFIIKDI----YPIRN-VYIIDTSKGKKILKKV 50


>UniRef50_Q3VNL1 Cluster: TPR repeat; n=1; Pelodictyon
           phaeoclathratiforme BU-1|Rep: TPR repeat - Pelodictyon
           phaeoclathratiforme BU-1
          Length = 772

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 8/106 (7%)
 Frame = +3

Query: 219 QVDIDSNGIRLLDKYSFXCEMYDEDADEIKDLTL-------NYFPFDNSVQIIDAKKGKN 377
           QV  D++ +RLL +      +  E+   I+D+TL         +  DN   I +   GK 
Sbjct: 189 QVSDDADTLRLLWQIGSAVGLKPEETAHIRDVTLLSPFLPRGLYYLDNLESIAETPGGKK 248

Query: 378 VLKRV-QLPPLNLDMLQIGNIVNIFSKLLYIQDCGSCYTENAFQKC 512
           +L  + QLP + L      N+ ++    +YI    +    + F KC
Sbjct: 249 LLSELSQLPGIRLLASSRVNLDSVLGNSIYIDRLDTDSAVSLFTKC 294


>UniRef50_A5K3H7 Cluster: Putative uncharacterized protein; n=5;
            cellular organisms|Rep: Putative uncharacterized protein
            - Plasmodium vivax
          Length = 3370

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = -2

Query: 423  VTYLNLMVVVVLVSKHFCLSSRLLFEPNCQMENN*GLNLLFRQHPHHTFHTXNYIYQVVV 244
            + Y+N +VV  ++    C + + +F    +   +  LNL+      + FH  NY  + ++
Sbjct: 824  LNYINDIVVGNIIKNAICFNYKYIFN-GIKRHISIYLNLISHVETKYIFHQNNYNLKNLI 882

Query: 243  YHCYRYQPV 217
            YH Y  Q V
Sbjct: 883  YHLYMDQIV 891


>UniRef50_Q8IEQ5 Cluster: Putative uncharacterized protein
           MAL13P1.29; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein MAL13P1.29 - Plasmodium
           falciparum (isolate 3D7)
          Length = 1341

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = +3

Query: 249 LLDKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLK 386
           +L KY+   +  D+     KD+  NY+ +DN +QI + K  KN+ K
Sbjct: 264 ILSKYNSIKKSADKKDKSKKDIKQNYWYYDNLLQIYEHKYLKNISK 309


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 539,767,103
Number of Sequences: 1657284
Number of extensions: 9717075
Number of successful extensions: 24294
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 23587
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24279
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41902926763
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).