SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0009
         (698 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A0Q3A6 Cluster: DNA helicase, putative; n=1; Clostridiu...    34   2.9  
UniRef50_Q8XJU1 Cluster: Exopolyphosphatase; n=3; Clostridium pe...    34   3.9  
UniRef50_Q24CA3 Cluster: Putative uncharacterized protein; n=1; ...    33   8.9  

>UniRef50_A0Q3A6 Cluster: DNA helicase, putative; n=1; Clostridium
           novyi NT|Rep: DNA helicase, putative - Clostridium novyi
           (strain NT)
          Length = 1246

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +1

Query: 259 VETGENRQFIHINEPPIIVQEHDSQPQEKVCSTTKDVFWDRSKIRLLLKLCLEDRF-KNI 435
           +E  E  QF H  EP II++E++++   K  +          +I   L+  ++D +   I
Sbjct: 200 IEIIEEMQFYH--EPIIILREYNTKVWNKELNGLLKFINGSQEIPSTLEALVDDNYLMKI 257

Query: 436 NKQKTLWHDIG 468
           +K K LW+D+G
Sbjct: 258 DKNKDLWNDVG 268


>UniRef50_Q8XJU1 Cluster: Exopolyphosphatase; n=3; Clostridium
           perfringens|Rep: Exopolyphosphatase - Clostridium
           perfringens
          Length = 502

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 15/25 (60%), Positives = 17/25 (68%)
 Frame = +1

Query: 412 LEDRFKNINKQKTLWHDIGIACRYY 486
           L D FKNI K  +L HD GI+ RYY
Sbjct: 351 LGDEFKNILKTASLLHDCGISIRYY 375


>UniRef50_Q24CA3 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 78

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = +1

Query: 583 YNTCEEVFKECKSLPSSFLETWGDPKVR 666
           YN C+E  K+C+  PSS   T GD K R
Sbjct: 26  YNICDEQVKQCQPAPSSHAPTCGDIKGR 53


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 657,343,888
Number of Sequences: 1657284
Number of extensions: 12732656
Number of successful extensions: 29165
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 28069
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29155
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55371905986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).