SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0007
         (618 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8EVY2 Cluster: Putative uncharacterized protein MYPE42...    32   9.5  
UniRef50_Q7RM68 Cluster: Var1p, putative; n=3; Plasmodium (Vinck...    32   9.5  
UniRef50_Q245Q6 Cluster: Putative uncharacterized protein; n=1; ...    32   9.5  

>UniRef50_Q8EVY2 Cluster: Putative uncharacterized protein MYPE4270;
           n=1; Mycoplasma penetrans|Rep: Putative uncharacterized
           protein MYPE4270 - Mycoplasma penetrans
          Length = 281

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%)
 Frame = -3

Query: 553 LFFFKSLI*VLLKFLIFYNIHLQ*YLHAMQCH--AIMFFVYLCF 428
           ++FF  L  +    ++F N   + ++H + CH  A +FF Y+CF
Sbjct: 151 IYFFMHLYLLTYGVMVFSNSRNRKWIHLLDCHIFAAIFFGYVCF 194


>UniRef50_Q7RM68 Cluster: Var1p, putative; n=3; Plasmodium
           (Vinckeia)|Rep: Var1p, putative - Plasmodium yoelii
           yoelii
          Length = 397

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +2

Query: 17  EYPCNYVYKVFILNTILLFFRTLSCKYL*LFRYFSLKMD 133
           +Y  NY  ++FI+NT+  FF T+S   +   +YF  +++
Sbjct: 244 QYEDNYTKELFIINTLKYFFSTISNSIIQNIKYFEKEIE 282


>UniRef50_Q245Q6 Cluster: Putative uncharacterized protein; n=1;
            Tetrahymena thermophila SB210|Rep: Putative
            uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1555

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = +1

Query: 271  ENRQFIHINEPPIIVQEHDSQPQEKVCSTTKDVFWDRSKIRLLLKLCLEDRFKNINKQKT 450
            +N+Q +  N+P II   ++ Q +   C   K      ++I L   LC+     ++N    
Sbjct: 1372 QNQQSVQFNKPSIIYSSNNPQMESSQCQRIKTFNQTTNQIDLFSILCMNTLLSDLNTYFN 1431

Query: 451  LWHDIASHV 477
              ++I S+V
Sbjct: 1432 NINNITSNV 1440


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 569,452,377
Number of Sequences: 1657284
Number of extensions: 10851211
Number of successful extensions: 25605
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 24690
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25596
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 44807090004
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).