SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0006
         (698 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B63E8 Cluster: PREDICTED: hypothetical protein;...    51   3e-05
UniRef50_UPI0000D56638 Cluster: PREDICTED: hypothetical protein;...    49   1e-04
UniRef50_A6R6J8 Cluster: Predicted protein; n=1; Ajellomyces cap...    35   2.2  
UniRef50_A7BS37 Cluster: Putative uncharacterized protein; n=1; ...    33   8.9  
UniRef50_Q0USP9 Cluster: Predicted protein; n=1; Phaeosphaeria n...    33   8.9  

>UniRef50_UPI00015B63E8 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 1379

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/87 (29%), Positives = 39/87 (44%)
 Frame = +2

Query: 239 FRASERDHQDAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRVHTMSLPRASAPPGLRP 418
           F    R  Q AA  +M IV   +    HW  +++D     GD++H+ S  R       RP
Sbjct: 664 FAEGNRGRQSAAVCLMAIVFSKVYEPRHWSAEVLDEATITGDKLHSRSALRLGENKSFRP 723

Query: 419 NEIIDQFHVTNFNVRLEIESEXLTGEL 499
           NEII +F + +  + L +      G L
Sbjct: 724 NEIISEFFLADRRISLRVHDCVEAGTL 750



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 1/86 (1%)
 Frame = +2

Query: 239  FRASERDHQDAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRVHTMSLPRAS-APPGLR 415
            + +  R  Q  A S + IVV ++     W P+L+D  LKYGD +HT  +  A      L 
Sbjct: 1193 YPSENRGLQSCAISAVAIVVSSLHAPSSWTPELLDACLKYGDLLHTECVRLAQPGSRNLS 1252

Query: 416  PNEIIDQFHVTNFNVRLEIESEXLTG 493
            P+E++  F V +   R+ +    + G
Sbjct: 1253 PSELLRAFVVGDVRARICLRENLMAG 1278



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/95 (28%), Positives = 45/95 (47%)
 Frame = +2

Query: 236  LFRASERDHQDAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRVHTMSLPRASAPPGLR 415
            +F  S R  Q AAN I+G+ +  I+    W  + +D IL  G  VH  S    +    LR
Sbjct: 884  IFSESIRGRQTAANCIIGLAMAVIKNPTSWTRRTLDEILTIGVNVHRESQKHTTKSSTLR 943

Query: 416  PNEIIDQFHVTNFNVRLEIESEXLTGELKAGKQVP 520
            P +I+  F++    +  ++E + + G +     VP
Sbjct: 944  PKDIVRIFNIGVTVLAADVEEKTIAGIVADAPAVP 978



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 28/102 (27%), Positives = 56/102 (54%), Gaps = 14/102 (13%)
 Frame = +2

Query: 236 LFRASERDHQDAANSIMGIVVENI-EPHIHWKPQLIDGILKYGDRV---HTMSLPRAS-- 397
           LF+   RD Q AA++++ +    + +PH+ W PQ++D ILK  D++   +  ++P A   
Sbjct: 437 LFKKESRDRQQAASALVALATTKLFDPHL-WYPQVLDDILKMADKLTGENAGNIPEAEDE 495

Query: 398 ---APPGLR----PNEIID-QFHVTNFNVRLEIESEXLTGEL 499
              A   +R    P+E+++ +F +    + +++E E   G+L
Sbjct: 496 DHPAESAIRDYLLPSEVVEREFFIGRNEIAVDVEEEAAAGQL 537



 Score = 39.1 bits (87), Expect = 0.10
 Identities = 21/57 (36%), Positives = 30/57 (52%)
 Frame = +1

Query: 508 KTGAVLNLKRAINRFFESYKHGVICAKSYCVAVWKATDDKAICLWEPHAVGPNGKNV 678
           K  AVL+LKR +  FF  +  GV+   S  VA+W  T D    L++P +   +G  V
Sbjct: 30  KDPAVLSLKRGLEEFFAQHADGVLECSSAAVAIW--TQDDYFYLFDPKSCDASGLRV 84


>UniRef50_UPI0000D56638 Cluster: PREDICTED: hypothetical protein; n=1;
            Tribolium castaneum|Rep: PREDICTED: hypothetical protein
            - Tribolium castaneum
          Length = 1809

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 508  KTGAVLNLKRAINRFFESYKHGVICAKSYCVAVWKATDDKAICLWEPHAVGPNG 669
            K   +LNL++   +FFE Y  GV+  + Y +AVWK   D+   L++P++ G  G
Sbjct: 1432 KNSDILNLRQGFEKFFERYTRGVLLVQRYKLAVWKQCHDEFFYLFDPNSRGATG 1485



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = +1

Query: 520  VLNLKRAINRFFESYKHGVICAKSYCVAVWKATDDKAICLWEPHAVGPNG 669
            VLNL+  +  FF   + G++   +Y VA+W+  D     +++PH  GP+G
Sbjct: 1203 VLNLQTGLEDFFSKKQFGLLHCNTYTVALWQLGD--YFYMFDPHPCGPSG 1250


>UniRef50_A6R6J8 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 501

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = +2

Query: 209 RKTGTRRGILFRASERDHQDAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRV 370
           R+ G R G++F  S        N I G +V NIE    W+ QL  GI+  G  V
Sbjct: 431 RQIGIRTGVMFAVSSLASL-TGNPIGGALVGNIEQPTFWRMQLFSGIVMAGGAV 483


>UniRef50_A7BS37 Cluster: Putative uncharacterized protein; n=1;
           Beggiatoa sp. PS|Rep: Putative uncharacterized protein -
           Beggiatoa sp. PS
          Length = 394

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 4/84 (4%)
 Frame = +2

Query: 191 RPSFGQRKTGTRRG-ILFRASERDHQDAANSIMGIVV---ENIEPHIHWKPQLIDGILKY 358
           RP++ Q      +G ++   S+    +A   ++GIVV   EN+E +   +P L++ +L+ 
Sbjct: 307 RPAYKQLFYRDDKGRLIVTISQNSVGNAITELLGIVVKREENVETYAAVEPALVNRLLEA 366

Query: 359 GDRVHTMSLPRASAPPGLRPNEII 430
            DR+   +L  A A P     E +
Sbjct: 367 RDRLVEANLGEAIAAPNWPNGEFV 390


>UniRef50_Q0USP9 Cluster: Predicted protein; n=1; Phaeosphaeria
           nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 536

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = +1

Query: 265 GRGELYNG-YSGREHRTSHPLEAAADRRNPQVRRQGPHDVSAQSFCSARTTPQRDYRPVP 441
           G GE   G ++    R   P ++A   +N  V   G  ++ +Q+F S    P  D  PVP
Sbjct: 426 GAGEALRGTFNNTVDRRFAPADSAVHAKNQAVIEAGRSEIESQNFASRPRPPAADAPPVP 485


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 612,767,358
Number of Sequences: 1657284
Number of extensions: 11004763
Number of successful extensions: 31145
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 30252
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31142
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55371905986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).