SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0005
         (698 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q17IM8 Cluster: Butyrate response factor 1; n=2; Culici...   116   7e-25
UniRef50_Q29J62 Cluster: GA17935-PA; n=1; Drosophila pseudoobscu...   112   9e-24
UniRef50_P47980 Cluster: Protein TIS11; n=2; Drosophila melanoga...   108   1e-22
UniRef50_Q07352 Cluster: Butyrate response factor 1; n=23; Eumet...   107   2e-22
UniRef50_UPI0000DB7760 Cluster: PREDICTED: similar to Tis11 homo...   107   3e-22
UniRef50_Q9W673 Cluster: CCCH zinc finger protein C3H-3; n=6; Xe...   106   5e-22
UniRef50_O16809 Cluster: Tis11 family protein; n=1; Crassostrea ...   105   1e-21
UniRef50_P47974 Cluster: Butyrate response factor 2; n=19; Theri...   105   1e-21
UniRef50_Q6NYS5 Cluster: Zgc:76924; n=2; Danio rerio|Rep: Zgc:76...   104   2e-21
UniRef50_UPI0000584644 Cluster: PREDICTED: similar to TPA-induce...   102   7e-21
UniRef50_Q4RN41 Cluster: Chromosome undetermined SCAF15016, whol...   102   7e-21
UniRef50_UPI0000EB2A28 Cluster: Butyrate response factor 2 (TIS1...   101   2e-20
UniRef50_Q4R9Y4 Cluster: Chromosome undetermined SCAF24931, whol...   100   3e-20
UniRef50_UPI0000D55D7B Cluster: PREDICTED: similar to Butyrate r...    99   5e-20
UniRef50_UPI00015A5DE9 Cluster: UPI00015A5DE9 related cluster; n...   100   7e-20
UniRef50_Q4V8V0 Cluster: Zgc:114130; n=2; Danio rerio|Rep: Zgc:1...    99   9e-20
UniRef50_Q5ISE2 Cluster: ZFP36L3; n=2; Murinae|Rep: ZFP36L3 - Mu...    98   2e-19
UniRef50_Q4H2G7 Cluster: Zinc finger protein; n=1; Ciona intesti...    96   6e-19
UniRef50_Q4T1G4 Cluster: Chromosome 10 SCAF10606, whole genome s...    84   3e-15
UniRef50_A5D6V0 Cluster: LOC564559 protein; n=4; Danio rerio|Rep...    84   3e-15
UniRef50_Q20155 Cluster: Putative uncharacterized protein; n=3; ...    83   6e-15
UniRef50_O93432 Cluster: Zinc finger protein; n=6; Clupeocephala...    82   1e-14
UniRef50_P26651 Cluster: Tristetraproline; n=15; Eutheria|Rep: T...    82   1e-14
UniRef50_Q54MG5 Cluster: Putative uncharacterized protein; n=1; ...    81   3e-14
UniRef50_UPI0000DA488C Cluster: PREDICTED: similar to zinc finge...    79   1e-13
UniRef50_UPI0000499A58 Cluster: zinc finger protein; n=1; Entamo...    79   1e-13
UniRef50_Q6GNE8 Cluster: LOC443666 protein; n=5; Xenopus|Rep: LO...    79   1e-13
UniRef50_Q28CR5 Cluster: Zinc finger protein 36 C3H type like 2;...    77   6e-13
UniRef50_Q01CM9 Cluster: CCCH-type Zn-finger protein; n=2; Ostre...    77   6e-13
UniRef50_UPI0000F2D146 Cluster: PREDICTED: similar to tristetrap...    75   2e-12
UniRef50_Q8SSL1 Cluster: ZINC FINGER PROTEIN; n=1; Encephalitozo...    73   7e-12
UniRef50_A2Y7T0 Cluster: Putative uncharacterized protein; n=3; ...    73   9e-12
UniRef50_P47979 Cluster: Zinc finger protein zfs1; n=1; Schizosa...    72   1e-11
UniRef50_Q4TEK1 Cluster: Chromosome undetermined SCAF5320, whole...    72   2e-11
UniRef50_Q9C9N3 Cluster: C-x8-C-x5-C-x3-H type Zinc finger prote...    71   2e-11
UniRef50_Q1PFF3 Cluster: Zinc finger family protein; n=2; Arabid...    71   2e-11
UniRef50_A7P3F0 Cluster: Chromosome chr1 scaffold_5, whole genom...    71   4e-11
UniRef50_Q0JKW4 Cluster: Os01g0645000 protein; n=3; Oryza sativa...    69   8e-11
UniRef50_Q10MN8 Cluster: Zinc finger C-x8-C-x5-C-x3-H type famil...    66   1e-09
UniRef50_Q28FK2 Cluster: Novel zinc finger C-x8-C-x5-C-x3-H type...    65   1e-09
UniRef50_Q9XTB3 Cluster: Putative uncharacterized protein mex-1;...    64   3e-09
UniRef50_A0BUS9 Cluster: Chromosome undetermined scaffold_13, wh...    60   7e-08
UniRef50_A7PKY7 Cluster: Chromosome chr7 scaffold_20, whole geno...    59   1e-07
UniRef50_Q9U2V4 Cluster: Putative uncharacterized protein; n=6; ...    58   2e-07
UniRef50_Q9XUB2 Cluster: Zinc finger protein mex-5; n=4; Rhabdit...    58   2e-07
UniRef50_Q23CY7 Cluster: Putative uncharacterized protein; n=1; ...    58   3e-07
UniRef50_Q20667 Cluster: Posterior segregation protein 1; n=4; C...    58   3e-07
UniRef50_UPI00006CB1DF Cluster: hypothetical protein TTHERM_0030...    57   4e-07
UniRef50_Q9Y1V9 Cluster: HrZF-1; n=1; Halocynthia roretzi|Rep: H...    57   5e-07
UniRef50_UPI000150A5C2 Cluster: hypothetical protein TTHERM_0005...    56   6e-07
UniRef50_A0BVF0 Cluster: Chromosome undetermined scaffold_13, wh...    56   8e-07
UniRef50_A0DT42 Cluster: Chromosome undetermined scaffold_62, wh...    56   1e-06
UniRef50_Q6C1T6 Cluster: Yarrowia lipolytica chromosome F of str...    55   1e-06
UniRef50_Q9XV46 Cluster: Putative uncharacterized protein moe-3;...    54   3e-06
UniRef50_P47976 Cluster: Zinc finger protein CTH1; n=2; Saccharo...    54   3e-06
UniRef50_Q23359 Cluster: Oocyte maturation defective protein 2; ...    54   4e-06
UniRef50_O18251 Cluster: Putative uncharacterized protein; n=2; ...    54   4e-06
UniRef50_Q22X37 Cluster: Tristetraproline, zinc finger protein; ...    53   6e-06
UniRef50_Q750B3 Cluster: AGR044Cp; n=1; Eremothecium gossypii|Re...    53   6e-06
UniRef50_UPI00006CD9DD Cluster: zinc finger protein; n=1; Tetrah...    53   8e-06
UniRef50_A7TSS3 Cluster: Putative uncharacterized protein; n=1; ...    53   8e-06
UniRef50_A5DY96 Cluster: Putative uncharacterized protein; n=1; ...    53   8e-06
UniRef50_A3LYJ7 Cluster: Predicted protein; n=1; Pichia stipitis...    53   8e-06
UniRef50_A0DQF1 Cluster: Chromosome undetermined scaffold_6, who...    52   1e-05
UniRef50_Q5A5R5 Cluster: Putative uncharacterized protein TIS11;...    52   1e-05
UniRef50_Q6CQJ6 Cluster: Similar to sp|P47976 Saccharomyces cere...    52   1e-05
UniRef50_Q6BMQ7 Cluster: Debaryomyces hansenii chromosome F of s...    52   1e-05
UniRef50_UPI000150A3C4 Cluster: zinc finger protein; n=1; Tetrah...    52   2e-05
UniRef50_UPI0001509FDB Cluster: hypothetical protein TTHERM_0019...    52   2e-05
UniRef50_Q1RPX5 Cluster: Zinc finger protein; n=1; Ciona intesti...    52   2e-05
UniRef50_Q6FVK2 Cluster: Candida glabrata strain CBS138 chromoso...    52   2e-05
UniRef50_Q233A9 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_Q7QX74 Cluster: GLP_217_52342_52923; n=1; Giardia lambl...    51   3e-05
UniRef50_A0BAX1 Cluster: Chromosome undetermined scaffold_1, who...    50   5e-05
UniRef50_P47977 Cluster: Zinc finger protein CTH2; n=2; Saccharo...    50   5e-05
UniRef50_A0CJW1 Cluster: Chromosome undetermined scaffold_2, who...    48   2e-04
UniRef50_A0CM12 Cluster: Chromosome undetermined scaffold_21, wh...    47   5e-04
UniRef50_A5K505 Cluster: Putative uncharacterized protein; n=1; ...    46   7e-04
UniRef50_UPI000150A980 Cluster: zinc finger protein; n=1; Tetrah...    46   9e-04
UniRef50_Q4PE14 Cluster: Putative uncharacterized protein; n=1; ...    46   9e-04
UniRef50_Q5PP65 Cluster: At2g35430; n=2; Arabidopsis thaliana|Re...    44   0.001
UniRef50_Q16HG9 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_UPI00006CBCDB Cluster: Zinc finger protein CTH1; n=1; T...    45   0.002
UniRef50_Q57W26 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q94131 Cluster: Pharynx and intestine in excess protein...    44   0.003
UniRef50_UPI000150A081 Cluster: hypothetical protein TTHERM_0041...    44   0.004
UniRef50_Q9LQM3 Cluster: F5D14.12 protein; n=5; Magnoliophyta|Re...    44   0.004
UniRef50_A0DGR7 Cluster: Chromosome undetermined scaffold_5, who...    43   0.006
UniRef50_Q6Z8U9 Cluster: Putative uncharacterized protein P0686H...    43   0.008
UniRef50_Q8II18 Cluster: Putative uncharacterized protein; n=1; ...    42   0.011
UniRef50_Q8I3N4 Cluster: Putative uncharacterized protein PFE114...    42   0.011
UniRef50_A7PB73 Cluster: Chromosome chr16 scaffold_10, whole gen...    40   0.013
UniRef50_Q9FG30 Cluster: Similarity to unknown protein; n=5; cor...    42   0.015
UniRef50_A7NZI6 Cluster: Chromosome chr6 scaffold_3, whole genom...    42   0.015
UniRef50_A4S9J6 Cluster: Predicted protein; n=2; Ostreococcus|Re...    42   0.015
UniRef50_Q61Q18 Cluster: Putative uncharacterized protein CBG072...    42   0.015
UniRef50_A7AN16 Cluster: Zinc finger C-x8-C-x5-C-x3-H type domai...    42   0.015
UniRef50_A5K9D0 Cluster: Putative uncharacterized protein; n=3; ...    42   0.015
UniRef50_Q57VA5 Cluster: Putative uncharacterized protein; n=1; ...    42   0.019
UniRef50_Q1LXV6 Cluster: Novel protein; n=2; Danio rerio|Rep: No...    41   0.025
UniRef50_Q5BWW8 Cluster: SJCHGC04818 protein; n=1; Schistosoma j...    41   0.025
UniRef50_Q4FX12 Cluster: Putative uncharacterized protein; n=3; ...    41   0.025
UniRef50_Q4CQE4 Cluster: Putative uncharacterized protein; n=2; ...    41   0.025
UniRef50_Q9HBD1 Cluster: Ring finger and CCCH-type zinc finger d...    41   0.025
UniRef50_Q5TC82 Cluster: Roquin; n=30; Tetrapoda|Rep: Roquin - H...    41   0.025
UniRef50_A0CPE8 Cluster: Chromosome undetermined scaffold_23, wh...    41   0.034
UniRef50_Q1LV60 Cluster: Novel protein; n=6; Clupeocephala|Rep: ...    40   0.044
UniRef50_Q61IC6 Cluster: Putative uncharacterized protein CBG103...    40   0.044
UniRef50_Q4QFG8 Cluster: Putative uncharacterized protein; n=2; ...    40   0.044
UniRef50_Q9LT81 Cluster: Gb|AAC36178.1; n=1; Arabidopsis thalian...    40   0.059
UniRef50_Q01MN3 Cluster: H1005F08.11 protein; n=11; Magnoliophyt...    40   0.059
UniRef50_Q57VA6 Cluster: Putative uncharacterized protein; n=1; ...    40   0.059
UniRef50_Q4Q5A6 Cluster: Zinc finger protein 2, putative; n=3; L...    40   0.059
UniRef50_Q6INL5 Cluster: MGC82388 protein; n=2; Xenopus|Rep: MGC...    40   0.078
UniRef50_A7PET7 Cluster: Chromosome chr11 scaffold_13, whole gen...    40   0.078
UniRef50_Q9VV48 Cluster: CG16807-PA; n=2; Sophophora|Rep: CG1680...    40   0.078
UniRef50_Q7PDK4 Cluster: ERYTHROCYTE MEMBRANE PROTEIN PFEMP3; n=...    40   0.078
UniRef50_A5K0Z1 Cluster: Putative uncharacterized protein; n=1; ...    40   0.078
UniRef50_A0BVB4 Cluster: Chromosome undetermined scaffold_13, wh...    40   0.078
UniRef50_Q7PDU0 Cluster: ERYTHROCYTE MEMBRANE PROTEIN PFEMP3; n=...    39   0.10 
UniRef50_Q1RL44 Cluster: Zinc finger protein; n=1; Ciona intesti...    39   0.10 
UniRef50_Q4PBN5 Cluster: Putative uncharacterized protein; n=1; ...    39   0.10 
UniRef50_Q5ACW2 Cluster: Pre-mRNA-splicing factor CWC24; n=1; Ca...    39   0.10 
UniRef50_UPI0000498EC5 Cluster: zinc finger protein; n=1; Entamo...    39   0.14 
UniRef50_Q93XK1 Cluster: Zinc finger protein; n=1; Pisum sativum...    39   0.14 
UniRef50_A7PF03 Cluster: Chromosome chr11 scaffold_13, whole gen...    39   0.14 
UniRef50_Q22HK5 Cluster: Zinc finger protein; n=1; Tetrahymena t...    39   0.14 
UniRef50_A2FRZ9 Cluster: Putative uncharacterized protein; n=1; ...    39   0.14 
UniRef50_A4IAZ9 Cluster: Putative uncharacterized protein; n=3; ...    38   0.18 
UniRef50_A4H7Y5 Cluster: Putative uncharacterized protein; n=1; ...    38   0.18 
UniRef50_A0CQE2 Cluster: Chromosome undetermined scaffold_24, wh...    38   0.18 
UniRef50_UPI0000E4915E Cluster: PREDICTED: hypothetical protein;...    38   0.24 
UniRef50_Q247W7 Cluster: Zinc finger protein, putative; n=1; Tet...    38   0.24 
UniRef50_Q23Q31 Cluster: Viral A-type inclusion protein repeat c...    38   0.24 
UniRef50_A5K0K1 Cluster: Putative uncharacterized protein; n=2; ...    38   0.24 
UniRef50_Q5KEY1 Cluster: Putative uncharacterized protein; n=1; ...    38   0.24 
UniRef50_Q5D6A7 Cluster: Putative CCCH-type zinc finger transcri...    38   0.31 
UniRef50_A5K2J2 Cluster: Putative uncharacterized protein; n=1; ...    38   0.31 
UniRef50_Q752S4 Cluster: Pre-mRNA-splicing factor CWC24; n=1; Er...    38   0.31 
UniRef50_UPI00006CD8B8 Cluster: ankyrin repeat protein; n=1; Tet...    37   0.41 
UniRef50_A7PC73 Cluster: Chromosome chr2 scaffold_11, whole geno...    37   0.41 
UniRef50_Q8IDB9 Cluster: Putative uncharacterized protein PF13_0...    37   0.41 
UniRef50_Q61F69 Cluster: Putative uncharacterized protein CBG117...    37   0.41 
UniRef50_Q1JTE3 Cluster: Putative uncharacterized protein; n=1; ...    37   0.41 
UniRef50_A0DH98 Cluster: Chromosome undetermined scaffold_50, wh...    37   0.41 
UniRef50_A5DV06 Cluster: Pre-mRNA splicing factor CWC24; n=1; Lo...    37   0.41 
UniRef50_Q9ZWA1 Cluster: F11M21.28 protein; n=3; Arabidopsis tha...    37   0.55 
UniRef50_Q8ILK7 Cluster: Putative uncharacterized protein; n=1; ...    37   0.55 
UniRef50_Q5CYT2 Cluster: 3CCCH domain containing protein; n=2; C...    37   0.55 
UniRef50_Q5CN43 Cluster: Asparagine-rich protein; n=2; Cryptospo...    37   0.55 
UniRef50_A0EHE0 Cluster: Chromosome undetermined scaffold_97, wh...    37   0.55 
UniRef50_A0BE14 Cluster: Chromosome undetermined scaffold_101, w...    37   0.55 
UniRef50_Q6CSS6 Cluster: Pre-mRNA-splicing factor CWC24; n=1; Kl...    37   0.55 
UniRef50_Q4S9W1 Cluster: Chromosome undetermined SCAF14694, whol...    36   0.72 
UniRef50_Q39CY9 Cluster: Iron-sulfur cluster binding protein; n=...    36   0.72 
UniRef50_Q4QFH0 Cluster: Putative uncharacterized protein; n=3; ...    36   0.72 
UniRef50_A7RKQ0 Cluster: Predicted protein; n=1; Nematostella ve...    36   0.72 
UniRef50_Q6BYU0 Cluster: Pre-mRNA-splicing factor CWC24; n=2; Sa...    36   0.72 
UniRef50_UPI00006CB748 Cluster: hypothetical protein TTHERM_0034...    36   0.96 
UniRef50_Q8VX90 Cluster: Similarity to the EST C99174; n=1; Pinu...    36   0.96 
UniRef50_A7PMT7 Cluster: Chromosome chr14 scaffold_21, whole gen...    36   0.96 
UniRef50_A7P7S0 Cluster: Chromosome chr9 scaffold_7, whole genom...    36   0.96 
UniRef50_A5BYY2 Cluster: Putative uncharacterized protein; n=1; ...    36   0.96 
UniRef50_Q5CXF0 Cluster: 3CCCH domain containing protein; n=3; C...    36   0.96 
UniRef50_Q4DRR2 Cluster: Putative uncharacterized protein; n=2; ...    36   0.96 
UniRef50_Q4CLW6 Cluster: Zinc finger protein 2, putative; n=4; T...    36   0.96 
UniRef50_Q22VV7 Cluster: CHY zinc finger family protein; n=1; Te...    36   0.96 
UniRef50_Q9C0B0 Cluster: RING finger protein unkempt homolog; n=...    36   0.96 
UniRef50_UPI00006CBF26 Cluster: hypothetical protein TTHERM_0031...    36   1.3  
UniRef50_Q802W8 Cluster: Unkempt homolog; n=4; Danio rerio|Rep: ...    36   1.3  
UniRef50_Q7RIY4 Cluster: Zinc finger C-x8-C-x5-C-x3-H type, puta...    36   1.3  
UniRef50_A0C8C5 Cluster: Chromosome undetermined scaffold_158, w...    36   1.3  
UniRef50_A0AR22 Cluster: UOS5/S1 protein; n=5; Plasmodium (Vinck...    36   1.3  
UniRef50_A2Q179 Cluster: Zinc finger, CCCH-type; n=1; Medicago t...    35   1.7  
UniRef50_Q8I5U7 Cluster: Putative uncharacterized protein; n=1; ...    35   1.7  
UniRef50_Q23GD6 Cluster: Putative uncharacterized protein; n=1; ...    35   1.7  
UniRef50_Q234F6 Cluster: Putative uncharacterized protein; n=1; ...    35   1.7  
UniRef50_Q1RLF3 Cluster: Zinc finger protein; n=1; Ciona intesti...    35   1.7  
UniRef50_A0CKZ8 Cluster: Chromosome undetermined scaffold_20, wh...    35   1.7  
UniRef50_A5DFN2 Cluster: Putative uncharacterized protein; n=1; ...    35   1.7  
UniRef50_Q6CB23 Cluster: Pre-mRNA-splicing factor CWC24; n=1; Ya...    35   1.7  
UniRef50_A3HNF3 Cluster: Bacteriophage Lambda NinG family protei...    35   2.2  
UniRef50_Q6YYB7 Cluster: Auxin transport protein-like protein; n...    35   2.2  
UniRef50_Q00XZ6 Cluster: Zinc finger; n=1; Ostreococcus tauri|Re...    35   2.2  
UniRef50_A7PBS2 Cluster: Chromosome chr16 scaffold_10, whole gen...    35   2.2  
UniRef50_Q4E4I1 Cluster: Putative uncharacterized protein; n=2; ...    35   2.2  
UniRef50_A7SCD8 Cluster: Predicted protein; n=1; Nematostella ve...    35   2.2  
UniRef50_A0D1W1 Cluster: Chromosome undetermined scaffold_34, wh...    35   2.2  
UniRef50_Q96RZ1 Cluster: Unkempt-like protein; n=1; Homo sapiens...    35   2.2  
UniRef50_Q5KCP1 Cluster: Expressed protein; n=2; Filobasidiella ...    35   2.2  
UniRef50_A1DBF2 Cluster: CCCH zinc finger protein; n=8; Eurotiom...    35   2.2  
UniRef50_Q5KB05 Cluster: Pre-mRNA-splicing factor CWC24; n=1; Fi...    35   2.2  
UniRef50_UPI000049839F Cluster: zinc finger protein; n=1; Entamo...    34   2.9  
UniRef50_Q4SJD9 Cluster: Chromosome 4 SCAF14575, whole genome sh...    34   2.9  
UniRef50_Q7XXI8 Cluster: OSJNBa0094O15.14 protein; n=3; Oryza sa...    34   2.9  
UniRef50_Q3E8A4 Cluster: Uncharacterized protein At5g56900.1; n=...    34   2.9  
UniRef50_A3A5V9 Cluster: Putative uncharacterized protein; n=2; ...    34   2.9  
UniRef50_A2XPJ7 Cluster: Putative uncharacterized protein; n=1; ...    34   2.9  
UniRef50_A2WL87 Cluster: Putative uncharacterized protein; n=1; ...    34   2.9  
UniRef50_Q8IJV8 Cluster: Putative uncharacterized protein; n=1; ...    34   2.9  
UniRef50_Q381D1 Cluster: Putative uncharacterized protein; n=1; ...    34   2.9  
UniRef50_A2QMD3 Cluster: Similarity to hypothetical protein CAC2...    34   2.9  
UniRef50_Q6FXX1 Cluster: Pre-mRNA-splicing factor CWC24; n=1; Ca...    34   2.9  
UniRef50_UPI00015B6140 Cluster: PREDICTED: similar to ENSANGP000...    34   3.9  
UniRef50_Q9FNG6 Cluster: Similarity to zinc finger protein; n=4;...    34   3.9  
UniRef50_Q84SL2 Cluster: CCCH-type zinc finger protein-like prot...    34   3.9  
UniRef50_Q8IZP6 Cluster: RING finger protein 113B; n=17; Mammali...    34   3.9  
UniRef50_O15541 Cluster: RING finger protein 113A; n=32; Eumetaz...    34   3.9  
UniRef50_Q06053 Cluster: tRNA-dihydrouridine synthase 3; n=6; Sa...    34   3.9  
UniRef50_Q9P6R8 Cluster: Pre-mRNA-splicing factor cwc24; n=1; Sc...    34   3.9  
UniRef50_Q6BTT1 Cluster: mRNA 3'-end-processing protein YTH1; n=...    27   4.7  
UniRef50_Q5CWX9 Cluster: Yir323cp/Cwc24 p family; CCCH+ringfinge...    33   5.1  
UniRef50_Q4UDF1 Cluster: Zinc finger-like regulatory protein, pu...    33   5.1  
UniRef50_Q4Q6T1 Cluster: Zinc finger-domain protein, putative; n...    33   5.1  
UniRef50_A5K7A7 Cluster: Putative uncharacterized protein; n=1; ...    33   5.1  
UniRef50_Q96GM8 Cluster: Target of EGR1 protein 1; n=17; Euteleo...    33   5.1  
UniRef50_UPI0000E46DA0 Cluster: PREDICTED: hypothetical protein ...    33   6.7  
UniRef50_UPI000051ACE9 Cluster: PREDICTED: similar to Roquin (RI...    33   6.7  
UniRef50_Q9VZ55 Cluster: CG1582-PA; n=5; Diptera|Rep: CG1582-PA ...    33   6.7  
UniRef50_Q245H9 Cluster: Zinc finger protein; n=1; Tetrahymena t...    33   6.7  
UniRef50_A7APX4 Cluster: Zinc finger C-x8-C-x5-C-x3-H type domai...    33   6.7  
UniRef50_O17917 Cluster: Putative RING finger protein 113 homolo...    33   6.7  
UniRef50_P53769 Cluster: Pre-mRNA-splicing factor CWC24; n=3; Sa...    33   6.7  
UniRef50_UPI00004983E6 Cluster: hypothetical protein 134.t00005;...    33   8.9  
UniRef50_Q0P4U9 Cluster: Smad-interacting and CPSF-like protein;...    33   8.9  
UniRef50_A4RUZ0 Cluster: Predicted protein; n=3; Ostreococcus|Re...    33   8.9  
UniRef50_Q9VXP3 Cluster: CG8470-PA; n=2; Sophophora|Rep: CG8470-...    33   8.9  
UniRef50_Q4QJI4 Cluster: Putative uncharacterized protein; n=3; ...    33   8.9  
UniRef50_Q4DT82 Cluster: Zinc finger protein ZFP1; n=6; Trypanos...    33   8.9  
UniRef50_A0ANM4 Cluster: CG4973 protein; n=12; Sophophora|Rep: C...    33   8.9  
UniRef50_A1DB46 Cluster: CCCH zinc finger protein; n=5; Trichoco...    33   8.9  
UniRef50_Q5FVR7 Cluster: Cleavage and polyadenylation specificit...    33   8.9  
UniRef50_Q8BQZ5 Cluster: Cleavage and polyadenylation specificit...    33   8.9  
UniRef50_O95639 Cluster: Cleavage and polyadenylation specificit...    33   8.9  

>UniRef50_Q17IM8 Cluster: Butyrate response factor 1; n=2;
           Culicidae|Rep: Butyrate response factor 1 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 355

 Score =  116 bits (278), Expect = 7e-25
 Identities = 47/49 (95%), Positives = 49/49 (100%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG++ELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR
Sbjct: 106 CQFAHGMQELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 154



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 22/40 (55%), Positives = 23/40 (57%)
 Frame = +2

Query: 134 GHRRLXXXXXXXXXXXXXXXXYKTELCRPFEEAGVCKYGD 253
           GHR+L                YKTELCRPFEEAG CKYGD
Sbjct: 65  GHRKLERTQSEPLPQQVNTSRYKTELCRPFEEAGECKYGD 104



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H  +E R
Sbjct: 85  RYKTELCRPFEEAGECKYGDKCQFAHGMQELR 116



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 124 YKTELCRTFHSVGFCPYGPRCHFV 147


>UniRef50_Q29J62 Cluster: GA17935-PA; n=1; Drosophila
           pseudoobscura|Rep: GA17935-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 268

 Score =  112 bits (269), Expect = 9e-24
 Identities = 45/52 (86%), Positives = 48/52 (92%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           CQFAHG  ELRNLQRHPKYKTE CRTFHSVGFCPYGPRCHFVHNA+EAR ++
Sbjct: 58  CQFAHGFHELRNLQRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQ 109



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 37  RYKTELCRPFEEAGECKYGEKCQFAHGFHELR 68



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/19 (89%), Positives = 18/19 (94%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEEAG CKYG+
Sbjct: 38  YKTELCRPFEEAGECKYGE 56


>UniRef50_P47980 Cluster: Protein TIS11; n=2; Drosophila
           melanogaster|Rep: Protein TIS11 - Drosophila
           melanogaster (Fruit fly)
          Length = 436

 Score =  108 bits (260), Expect = 1e-22
 Identities = 43/52 (82%), Positives = 47/52 (90%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           CQFAHG  ELRN+ RHPKYKTE CRTFHSVGFCPYGPRCHFVHNA+EAR ++
Sbjct: 156 CQFAHGSHELRNVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQ 207



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H + E R
Sbjct: 135 RYKTELCRPFEEAGECKYGEKCQFAHGSHELR 166



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/27 (66%), Positives = 19/27 (70%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTAS 277
           YKTELCRPFEEAG CKYG+       S
Sbjct: 136 YKTELCRPFEEAGECKYGEKCQFAHGS 162


>UniRef50_Q07352 Cluster: Butyrate response factor 1; n=23;
           Eumetazoa|Rep: Butyrate response factor 1 - Homo sapiens
           (Human)
          Length = 338

 Score =  107 bits (258), Expect = 2e-22
 Identities = 41/49 (83%), Positives = 46/49 (93%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG+ ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNAEE R
Sbjct: 135 CQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERR 183



 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 29/74 (39%), Positives = 32/74 (43%)
 Frame = +2

Query: 32  NSVSSGLSWEQHPVLSRASSVPAHRALAGLLDRLGHRRLXXXXXXXXXXXXXXXXYKTEL 211
           N + S L  E  P LS   S    R+ +      G  RL                YKTEL
Sbjct: 65  NQLLSSLKGEPAPALSSRDSRFRDRSFSE-----GGERLLPTQKQPGGGQVNSSRYKTEL 119

Query: 212 CRPFEEAGVCKYGD 253
           CRPFEE G CKYGD
Sbjct: 120 CRPFEENGACKYGD 133



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 114 RYKTELCRPFEENGACKYGDKCQFAHGIHELR 145



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 153 YKTELCRTFHTIGFCPYGPRCHFI 176


>UniRef50_UPI0000DB7760 Cluster: PREDICTED: similar to Tis11 homolog
           CG4070-PA, isoform A; n=2; Apocrita|Rep: PREDICTED:
           similar to Tis11 homolog CG4070-PA, isoform A - Apis
           mellifera
          Length = 401

 Score =  107 bits (257), Expect = 3e-22
 Identities = 42/49 (85%), Positives = 45/49 (91%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG  ELRNL RHPKYKTELCRTFH++GFCPYGPRCHF+HN EEAR
Sbjct: 100 CQFAHGYSELRNLARHPKYKTELCRTFHTIGFCPYGPRCHFIHNFEEAR 148



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 17/19 (89%), Positives = 18/19 (94%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE+G CKYGD
Sbjct: 80  YKTELCRPFEESGTCKYGD 98



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 79  RYKTELCRPFEESGTCKYGDKCQFAHGYSELR 110



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 118 YKTELCRTFHTIGFCPYGPRCHFI 141


>UniRef50_Q9W673 Cluster: CCCH zinc finger protein C3H-3; n=6;
           Xenopus|Rep: CCCH zinc finger protein C3H-3 - Xenopus
           laevis (African clawed frog)
          Length = 364

 Score =  106 bits (255), Expect = 5e-22
 Identities = 41/50 (82%), Positives = 46/50 (92%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHG  ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNAEE R+
Sbjct: 154 CQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRQ 203



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 133 RYKTELCRPFEENGACKYGEKCQFAHGFHELR 164



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 16/19 (84%), Positives = 17/19 (89%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE G CKYG+
Sbjct: 134 YKTELCRPFEENGACKYGE 152



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 172 YKTELCRTFHTIGFCPYGPRCHFI 195


>UniRef50_O16809 Cluster: Tis11 family protein; n=1; Crassostrea
           virginica|Rep: Tis11 family protein - Crassostrea
           virginica (Eastern oyster)
          Length = 401

 Score =  105 bits (251), Expect = 1e-21
 Identities = 40/47 (85%), Positives = 43/47 (91%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG  ELRNL RHPKYKTELCRTFH++GFCPYGPRCHF+HN EE
Sbjct: 136 CQFAHGAHELRNLNRHPKYKTELCRTFHTIGFCPYGPRCHFIHNDEE 182



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 18/32 (56%), Positives = 20/32 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H A E R
Sbjct: 115 RYKTELCRPFEESGHCKYGDKCQFAHGAHELR 146



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/19 (89%), Positives = 18/19 (94%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE+G CKYGD
Sbjct: 116 YKTELCRPFEESGHCKYGD 134



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 154 YKTELCRTFHTIGFCPYGPRCHFI 177


>UniRef50_P47974 Cluster: Butyrate response factor 2; n=19;
           Theria|Rep: Butyrate response factor 2 - Homo sapiens
           (Human)
          Length = 494

 Score =  105 bits (251), Expect = 1e-21
 Identities = 40/49 (81%), Positives = 45/49 (91%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG  ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNA+E R
Sbjct: 174 CQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERR 222



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 153 RYKTELCRPFEESGTCKYGEKCQFAHGFHELR 184



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE+G CKYG+
Sbjct: 154 YKTELCRPFEESGTCKYGE 172



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 192 YKTELCRTFHTIGFCPYGPRCHFI 215


>UniRef50_Q6NYS5 Cluster: Zgc:76924; n=2; Danio rerio|Rep: Zgc:76924
           - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 310

 Score =  104 bits (250), Expect = 2e-21
 Identities = 40/49 (81%), Positives = 44/49 (89%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG  ELRNL RHPKYKTE CRTFH++GFCPYGPRCHF+HNA+E R
Sbjct: 75  CQFAHGYHELRNLSRHPKYKTEPCRTFHTIGFCPYGPRCHFIHNADERR 123



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 54  RYKTELCRPFEENGSCKYGEKCQFAHGYHELR 85



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 16/19 (84%), Positives = 17/19 (89%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE G CKYG+
Sbjct: 55  YKTELCRPFEENGSCKYGE 73


>UniRef50_UPI0000584644 Cluster: PREDICTED: similar to TPA-induced
           protein 11B - mouse isoform 2; n=2; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to TPA-induced
           protein 11B - mouse isoform 2 - Strongylocentrotus
           purpuratus
          Length = 386

 Score =  102 bits (245), Expect = 7e-21
 Identities = 39/49 (79%), Positives = 44/49 (89%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG+ ELR L RHPKYKTELCRTFH+VGFCPYGPRCHF+HN +E +
Sbjct: 138 CQFAHGIHELRVLSRHPKYKTELCRTFHTVGFCPYGPRCHFIHNPDERK 186



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/41 (46%), Positives = 23/41 (56%)
 Frame = +1

Query: 280 ELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           + RN Q   +YKTELCR +   G C YG +C F H   E R
Sbjct: 109 QTRN-QNSSRYKTELCRPYEENGTCKYGDKCQFAHGIHELR 148



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 16/19 (84%), Positives = 17/19 (89%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRP+EE G CKYGD
Sbjct: 118 YKTELCRPYEENGTCKYGD 136



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 156 YKTELCRTFHTVGFCPYGPRCHFI 179


>UniRef50_Q4RN41 Cluster: Chromosome undetermined SCAF15016, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF15016, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 351

 Score =  102 bits (245), Expect = 7e-21
 Identities = 39/49 (79%), Positives = 44/49 (89%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG  ELR+L RHPKYKTE CRTFH++GFCPYGPRCHF+HNA+E R
Sbjct: 56  CQFAHGYHELRSLSRHPKYKTEPCRTFHTIGFCPYGPRCHFIHNADERR 104



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 35  RYKTELCRPFEENGSCKYGEKCQFAHGYHELR 66



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 16/19 (84%), Positives = 17/19 (89%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE G CKYG+
Sbjct: 36  YKTELCRPFEENGSCKYGE 54


>UniRef50_UPI0000EB2A28 Cluster: Butyrate response factor 2 (TIS11D
           protein) (EGF-response factor 2) (ERF-2).; n=1; Canis
           lupus familiaris|Rep: Butyrate response factor 2 (TIS11D
           protein) (EGF-response factor 2) (ERF-2). - Canis
           familiaris
          Length = 485

 Score =  101 bits (242), Expect = 2e-20
 Identities = 38/46 (82%), Positives = 43/46 (93%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAE 393
           CQFAHG  ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNA+
Sbjct: 239 CQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAD 284



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 218 RYKTELCRPFEESGTCKYGEKCQFAHGFHELR 249



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE+G CKYG+
Sbjct: 219 YKTELCRPFEESGTCKYGE 237



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 257 YKTELCRTFHTIGFCPYGPRCHFI 280


>UniRef50_Q4R9Y4 Cluster: Chromosome undetermined SCAF24931, whole
           genome shotgun sequence; n=4; Clupeocephala|Rep:
           Chromosome undetermined SCAF24931, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 477

 Score =  100 bits (240), Expect = 3e-20
 Identities = 38/47 (80%), Positives = 43/47 (91%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHGV ELR + RHPKYKTELCRTFH++GFCPYG RCHF+HNA+E
Sbjct: 168 CQFAHGVDELRGISRHPKYKTELCRTFHTIGFCPYGARCHFIHNADE 214



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 17/32 (53%), Positives = 21/32 (65%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCRT+   G C YG +C F H  +E R
Sbjct: 147 RYKTELCRTYEESGTCKYGTKCQFAHGVDELR 178



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR +EE+G CKYG
Sbjct: 148 YKTELCRTYEESGTCKYG 165


>UniRef50_UPI0000D55D7B Cluster: PREDICTED: similar to Butyrate
           response factor 1 (TIS11B protein) (EGF-inducible
           protein CMG1); n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to Butyrate response factor 1 (TIS11B protein)
           (EGF-inducible protein CMG1) - Tribolium castaneum
          Length = 250

 Score =   99 bits (238), Expect = 5e-20
 Identities = 39/47 (82%), Positives = 43/47 (91%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG  ELR+L RHPKYKTELCRT+H+VGFCPYGPRCHFVHN +E
Sbjct: 117 CQFAHGGAELRSLARHPKYKTELCRTYHTVGFCPYGPRCHFVHNQDE 163



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/28 (64%), Positives = 19/28 (67%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASA 280
           YKTELCRP+EE GVCKYGD        A
Sbjct: 97  YKTELCRPYEEFGVCKYGDKCQFAHGGA 124



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR +   G C YG +C F H   E R
Sbjct: 96  RYKTELCRPYEEFGVCKYGDKCQFAHGGAELR 127


>UniRef50_UPI00015A5DE9 Cluster: UPI00015A5DE9 related cluster; n=1;
           Danio rerio|Rep: UPI00015A5DE9 UniRef100 entry - Danio
           rerio
          Length = 288

 Score = 99.5 bits (237), Expect = 7e-20
 Identities = 38/47 (80%), Positives = 42/47 (89%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG+ ELR L RHPKYKTE CRTFH++GFCPYG RCHF+HNAEE
Sbjct: 90  CQFAHGMEELRGLNRHPKYKTEPCRTFHTIGFCPYGARCHFIHNAEE 136



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 19/32 (59%), Positives = 21/32 (65%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCRTF   G C YG +C F H  EE R
Sbjct: 69  RYKTELCRTFEESGTCKYGAKCQFAHGMEELR 100



 Score = 39.9 bits (89), Expect = 0.059
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR FEE+G CKYG
Sbjct: 70  YKTELCRTFEESGTCKYG 87


>UniRef50_Q4V8V0 Cluster: Zgc:114130; n=2; Danio rerio|Rep:
           Zgc:114130 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 329

 Score = 99.1 bits (236), Expect = 9e-20
 Identities = 40/49 (81%), Positives = 43/49 (87%)
 Frame = +1

Query: 250 G*CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           G CQFAHG  ELR+L RHPKYKTE CRTFHS+GFCPYG RCHFVHNAE+
Sbjct: 94  GKCQFAHGPEELRDLNRHPKYKTEPCRTFHSIGFCPYGIRCHFVHNAED 142



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 19/32 (59%), Positives = 21/32 (65%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCRTF   G C YG +C F H  EE R
Sbjct: 75  RYKTELCRTFAERGLCKYGGKCQFAHGPEELR 106



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 14/18 (77%), Positives = 15/18 (83%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR F E G+CKYG
Sbjct: 76  YKTELCRTFAERGLCKYG 93


>UniRef50_Q5ISE2 Cluster: ZFP36L3; n=2; Murinae|Rep: ZFP36L3 - Mus
           musculus (Mouse)
          Length = 725

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 39/47 (82%), Positives = 40/47 (85%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG RELR L RHPKYKTE CRTFHSVGFCPYG RCHF+HN  E
Sbjct: 143 CQFAHGYRELRTLSRHPKYKTEPCRTFHSVGFCPYGTRCHFIHNQPE 189



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/38 (47%), Positives = 21/38 (55%)
 Frame = +1

Query: 289 NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +L    +YKTELCR F   G C YG +C F H   E R
Sbjct: 116 SLATSERYKTELCRPFEESGICKYGHKCQFAHGYRELR 153



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 16/18 (88%), Positives = 18/18 (100%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCRPFEE+G+CKYG
Sbjct: 123 YKTELCRPFEESGICKYG 140


>UniRef50_Q4H2G7 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 380

 Score = 96.3 bits (229), Expect = 6e-19
 Identities = 36/47 (76%), Positives = 41/47 (87%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG  ELR + RHPKYKTELCRT+H+ GFCPYGPRCHF+HN E+
Sbjct: 151 CQFAHGKHELRRMVRHPKYKTELCRTYHTSGFCPYGPRCHFIHNQED 197



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 18/33 (54%), Positives = 20/33 (60%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +YKTELCR F   G C YG +C F H   E RR
Sbjct: 130 RYKTELCRPFEENGKCKYGDKCQFAHGKHELRR 162



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/19 (89%), Positives = 17/19 (89%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE G CKYGD
Sbjct: 131 YKTELCRPFEENGKCKYGD 149


>UniRef50_Q4T1G4 Cluster: Chromosome 10 SCAF10606, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10
           SCAF10606, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 200

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 32/43 (74%), Positives = 36/43 (83%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAHG  ELR L RHPKYKTE CRTF++ G+CPYG RCHF+H
Sbjct: 158 CQFAHGEAELRGLYRHPKYKTEPCRTFYNFGYCPYGSRCHFIH 200



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 137 RYKTELCRGFQETGTCKYGSKCQFAHGEAELR 168



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 15/28 (53%), Positives = 16/28 (57%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASA 280
           YKTELCR F+E G CKYG         A
Sbjct: 138 YKTELCRGFQETGTCKYGSKCQFAHGEA 165


>UniRef50_A5D6V0 Cluster: LOC564559 protein; n=4; Danio rerio|Rep:
           LOC564559 protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 336

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 31/48 (64%), Positives = 37/48 (77%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEA 399
           CQFAHG  ELR L RHPKYKT+ CRTF+  G+CPYG RCHF+H  + +
Sbjct: 133 CQFAHGENELRGLYRHPKYKTQACRTFYQFGYCPYGSRCHFIHEEKSS 180



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR+F   G C YG +C F H   E R
Sbjct: 112 RYKTELCRSFQEHGSCKYGAKCQFAHGENELR 143



 Score = 36.7 bits (81), Expect = 0.55
 Identities = 14/18 (77%), Positives = 15/18 (83%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR F+E G CKYG
Sbjct: 113 YKTELCRSFQEHGSCKYG 130


>UniRef50_Q20155 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 460

 Score = 83.0 bits (196), Expect = 6e-15
 Identities = 30/44 (68%), Positives = 36/44 (81%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           CQ+AHG  E R + RHPKYKTE C++FH  G+CPYGPRCHF+HN
Sbjct: 219 CQYAHGELEKRPVPRHPKYKTEACQSFHQSGYCPYGPRCHFIHN 262



 Score = 41.5 bits (93), Expect = 0.019
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
 Frame = +1

Query: 298 RHPK-YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           ++PK YKTELCR++   G C YG RC + H   E R
Sbjct: 194 KNPKLYKTELCRSWMDHGRCNYGERCQYAHGELEKR 229


>UniRef50_O93432 Cluster: Zinc finger protein; n=6;
           Clupeocephala|Rep: Zinc finger protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 308

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 32/49 (65%), Positives = 38/49 (77%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG+ +L    RHPKYKTELCRT+H+ G+C YG RC FVHN +E R
Sbjct: 69  CQFAHGLHDLHVPSRHPKYKTELCRTYHTAGYCVYGTRCLFVHNLKEQR 117



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C F H ++E R ++  P+ +   CRTF + G CP+G RCHF+H
Sbjct: 107 CLFVHNLKEQRPIR--PRRRNVPCRTFRAFGVCPFGTRCHFLH 147



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 15/26 (57%), Positives = 17/26 (65%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVH 384
           K +  LCRTF + GFC YG RC F H
Sbjct: 173 KPRGALCRTFSAFGFCLYGTRCRFQH 198



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +YKTELC  +   G C Y  RC F H   +
Sbjct: 48  RYKTELCSRYAETGTCKYAERCQFAHGLHD 77


>UniRef50_P26651 Cluster: Tristetraproline; n=15; Eutheria|Rep:
           Tristetraproline - Homo sapiens (Human)
          Length = 326

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 32/47 (68%), Positives = 35/47 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG+ ELR   RHPKYKTELC  F+  G CPYG RCHF+HN  E
Sbjct: 124 CQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSE 170



 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 18/33 (54%), Positives = 21/33 (63%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +YKTELCRTF   G C YG +C F H   E R+
Sbjct: 103 RYKTELCRTFSESGRCRYGAKCQFAHGLGELRQ 135



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR F E+G C+YG
Sbjct: 104 YKTELCRTFSESGRCRYG 121


>UniRef50_Q54MG5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 437

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 30/46 (65%), Positives = 37/46 (80%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAE 393
           CQFAHG  ELR++ RHPKYKTE C+TF+S+G CPYG RC F+H  +
Sbjct: 216 CQFAHGRDELRSVMRHPKYKTETCKTFYSIGSCPYGSRCRFIHTRD 261



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 17/32 (53%), Positives = 21/32 (65%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR+F   G C YG +C F H  +E R
Sbjct: 195 RYKTELCRSFQETGVCRYGLKCQFAHGRDELR 226



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR F+E GVC+YG
Sbjct: 196 YKTELCRSFQETGVCRYG 213


>UniRef50_UPI0000DA488C Cluster: PREDICTED: similar to zinc finger
           protein 36, C3H type-like 2; n=4; Rattus norvegicus|Rep:
           PREDICTED: similar to zinc finger protein 36, C3H
           type-like 2 - Rattus norvegicus
          Length = 109

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 30/45 (66%), Positives = 36/45 (80%)
 Frame = +1

Query: 259 QFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAE 393
           QF HG  ELR+L  HPKYKTELCRTFH++ FC   PRC+F+HNA+
Sbjct: 65  QFPHGFHELRSLTGHPKYKTELCRTFHTISFCSCSPRCYFIHNAD 109


>UniRef50_UPI0000499A58 Cluster: zinc finger protein; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: zinc finger protein -
           Entamoeba histolytica HM-1:IMSS
          Length = 274

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 29/43 (67%), Positives = 35/43 (81%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAHG +ELR +QRHP+YKTE+C+TFH  G C YG RC F+H
Sbjct: 127 CQFAHGEKELRPVQRHPRYKTEICQTFHQTGTCKYGSRCRFIH 169



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/31 (54%), Positives = 20/31 (64%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           YKTELCR+F   G C YG +C F H  +E R
Sbjct: 107 YKTELCRSFVETGTCRYGNKCQFAHGEKELR 137



 Score = 35.9 bits (79), Expect = 0.96
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCR F E G C+YG+
Sbjct: 107 YKTELCRSFVETGTCRYGN 125



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTE+C+ F + G CKYG     +
Sbjct: 145 YKTEICQTFHQTGTCKYGSRCRFI 168


>UniRef50_Q6GNE8 Cluster: LOC443666 protein; n=5; Xenopus|Rep:
           LOC443666 protein - Xenopus laevis (African clawed frog)
          Length = 320

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 31/47 (65%), Positives = 35/47 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG  ELR   RHPKYKTELC  F+  G CPYGPRC+F+H+  E
Sbjct: 131 CQFAHGKIELREQNRHPKYKTELCHKFYLYGECPYGPRCNFIHHPRE 177



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 18/35 (51%), Positives = 22/35 (62%)
 Frame = +1

Query: 304 PKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           P+YKTELCRT+   G C YG +C F H   E R +
Sbjct: 109 PRYKTELCRTYSETGTCKYGAKCQFAHGKIELREQ 143



 Score = 36.3 bits (80), Expect = 0.72
 Identities = 13/18 (72%), Positives = 14/18 (77%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR + E G CKYG
Sbjct: 111 YKTELCRTYSETGTCKYG 128


>UniRef50_Q28CR5 Cluster: Zinc finger protein 36 C3H type like 2;
           n=4; Xenopus|Rep: Zinc finger protein 36 C3H type like 2
           - Xenopus tropicalis (Western clawed frog) (Silurana
           tropicalis)
          Length = 279

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 31/49 (63%), Positives = 38/49 (77%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG+ ELR   +HPKYKTELCR+FH +G C YG RC F+H+ +E R
Sbjct: 66  CQFAHGLSELRPPVQHPKYKTELCRSFHVLGTCNYGLRCLFIHSPQERR 114



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           +HPK   E CR F + G CPYG RCHF H+
Sbjct: 156 QHPKGFREACRHFAAHGDCPYGARCHFSHS 185



 Score = 41.5 bits (93), Expect = 0.019
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELC  +   GFC Y  RC F H   E R
Sbjct: 45  RYKTELCTRYAESGFCAYRNRCQFAHGLSELR 76



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 14/22 (63%), Positives = 15/22 (68%)
 Frame = +1

Query: 319 ELCRTFHSVGFCPYGPRCHFVH 384
           E CR + S G CPYG RCHF H
Sbjct: 136 EQCRLWRSPGGCPYGARCHFQH 157


>UniRef50_Q01CM9 Cluster: CCCH-type Zn-finger protein; n=2;
           Ostreococcus|Rep: CCCH-type Zn-finger protein -
           Ostreococcus tauri
          Length = 276

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 36/73 (49%), Positives = 42/73 (57%)
 Frame = +1

Query: 166 TGSSATSHKSLQDRALPTV*RSGGL*IWG*CQFAHGVRELRNLQRHPKYKTELCRTFHSV 345
           TGS    H   +     +   SG       CQFAHG  ELR + RHPKYKTE+CRTF + 
Sbjct: 98  TGSPKQQHSLYKTELCRSWEESGTCRYGSKCQFAHGRDELRPVLRHPKYKTEVCRTFAAQ 157

Query: 346 GFCPYGPRCHFVH 384
           G CPYG RC F+H
Sbjct: 158 GSCPYGSRCRFIH 170



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 18/36 (50%), Positives = 23/36 (63%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           Q+H  YKTELCR++   G C YG +C F H  +E R
Sbjct: 103 QQHSLYKTELCRSWEESGTCRYGSKCQFAHGRDELR 138


>UniRef50_UPI0000F2D146 Cluster: PREDICTED: similar to
           tristetraprolin; n=1; Monodelphis domestica|Rep:
           PREDICTED: similar to tristetraprolin - Monodelphis
           domestica
          Length = 448

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 30/43 (69%), Positives = 32/43 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAHG  ELR   RHPKYKTELCR    +G CPYG RCHF+H
Sbjct: 227 CQFAHGPGELRPASRHPKYKTELCRKLLILGSCPYGSRCHFIH 269



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/32 (56%), Positives = 20/32 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCRTF   G C YG +C F H   E R
Sbjct: 206 RYKTELCRTFSESGKCRYGSKCQFAHGPGELR 237



 Score = 35.9 bits (79), Expect = 0.96
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR F E+G C+YG
Sbjct: 207 YKTELCRTFSESGKCRYG 224


>UniRef50_Q8SSL1 Cluster: ZINC FINGER PROTEIN; n=1; Encephalitozoon
           cuniculi|Rep: ZINC FINGER PROTEIN - Encephalitozoon
           cuniculi
          Length = 346

 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 29/43 (67%), Positives = 32/43 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAH   ELR +QRHPKYKTE C+TF   G CPYG RC F+H
Sbjct: 133 CQFAHSKAELRYVQRHPKYKTETCKTFWEEGSCPYGKRCCFIH 175



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 15/36 (41%), Positives = 24/36 (66%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +++  YKTE+CR+   +G+C YG +C F H+  E R
Sbjct: 108 KKYQLYKTEMCRSHTEIGYCRYGDKCQFAHSKAELR 143



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASA 280
           YKTE+CR   E G C+YGD      + A
Sbjct: 113 YKTEMCRSHTEIGYCRYGDKCQFAHSKA 140


>UniRef50_A2Y7T0 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 387

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 30/50 (60%), Positives = 36/50 (72%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHGV ELR + RHP+YKT++CR   + G CPYG RCHF H+   A R
Sbjct: 333 CQFAHGVAELRPVIRHPRYKTQVCRMVLAGGVCPYGHRCHFRHSITPADR 382



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +KTELC  +   G CPYG +C F H   E R
Sbjct: 313 FKTELCNKWEETGACPYGDQCQFAHGVAELR 343



 Score = 33.9 bits (74), Expect = 3.9
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           +KTELC  +EE G C YGD
Sbjct: 313 FKTELCNKWEETGACPYGD 331


>UniRef50_P47979 Cluster: Zinc finger protein zfs1; n=1;
           Schizosaccharomyces pombe|Rep: Zinc finger protein zfs1
           - Schizosaccharomyces pombe (Fission yeast)
          Length = 404

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 28/50 (56%), Positives = 37/50 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHG +EL+   RHPKYK+E CR+F   G+CPYG RC F+H+   A++
Sbjct: 347 CQFAHGNQELKEPPRHPKYKSERCRSFMMYGYCPYGLRCCFLHDESNAQK 396



 Score = 36.7 bits (81), Expect = 0.55
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           YKTE C+ +   G C YG +C F H  +E +
Sbjct: 327 YKTEPCKNWQISGTCRYGSKCQFAHGNQELK 357


>UniRef50_Q4TEK1 Cluster: Chromosome undetermined SCAF5320, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF5320,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 243

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 27/37 (72%), Positives = 32/37 (86%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGP 366
           CQFAHG+ ELR+L RHPKYKTELCRTFH++G+C   P
Sbjct: 144 CQFAHGIHELRSLSRHPKYKTELCRTFHTIGYCLRAP 180



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 123 RYKTELCRPFEENGSCKYGDKCQFAHGIHELR 154



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/43 (48%), Positives = 23/43 (53%)
 Frame = +2

Query: 125 DRLGHRRLXXXXXXXXXXXXXXXXYKTELCRPFEEAGVCKYGD 253
           +RL H+ L                YKTELCRPFEE G CKYGD
Sbjct: 100 ERLIHKCLGPASPTGGSGQVNSSRYKTELCRPFEENGSCKYGD 142


>UniRef50_Q9C9N3 Cluster: C-x8-C-x5-C-x3-H type Zinc finger protein,
           putative; n=1; Arabidopsis thaliana|Rep:
           C-x8-C-x5-C-x3-H type Zinc finger protein, putative -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 310

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 28/50 (56%), Positives = 35/50 (70%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHG+ ELR + RHP+YKTE+CR   +   CPYG RCHF H+  +  R
Sbjct: 253 CQFAHGIDELRPVIRHPRYKTEVCRMMVTGAMCPYGHRCHFRHSLTDQER 302



 Score = 39.5 bits (88), Expect = 0.078
 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 2/46 (4%)
 Frame = +1

Query: 271 GVRELRNLQ--RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           G RE   L+  R    KTELC  +   G C YG  C F H  +E R
Sbjct: 218 GEREALELEVYRQGMMKTELCNKWQETGACCYGDNCQFAHGIDELR 263



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +2

Query: 200 KTELCRPFEEAGVCKYGDN 256
           KTELC  ++E G C YGDN
Sbjct: 234 KTELCNKWQETGACCYGDN 252


>UniRef50_Q1PFF3 Cluster: Zinc finger family protein; n=2;
           Arabidopsis thaliana|Rep: Zinc finger family protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 307

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 28/50 (56%), Positives = 36/50 (72%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHG++ELR + RHP+YKTE+CR   +   CPYG RCHF H+  E  +
Sbjct: 242 CQFAHGIKELRPVIRHPRYKTEVCRMVLAGDNCPYGHRCHFRHSLSEQEK 291



 Score = 41.1 bits (92), Expect = 0.025
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           KTELC  +   G CPYG  C F H  +E R
Sbjct: 223 KTELCNKWQETGTCPYGDHCQFAHGIKELR 252


>UniRef50_A7P3F0 Cluster: Chromosome chr1 scaffold_5, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr1 scaffold_5, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 351

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 29/50 (58%), Positives = 34/50 (68%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHG+ ELR + RHP+YKTE+CR   +   CPYG RCHF H   E  R
Sbjct: 288 CQFAHGIEELRPVIRHPRYKTEVCRMVLAGDACPYGHRCHFRHALTEQER 337



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 16/31 (51%), Positives = 18/31 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +KTELC  +   G CPYG  C F H  EE R
Sbjct: 268 FKTELCNKWQESGTCPYGDHCQFAHGIEELR 298



 Score = 33.5 bits (73), Expect = 5.1
 Identities = 11/20 (55%), Positives = 16/20 (80%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDN 256
           +KTELC  ++E+G C YGD+
Sbjct: 268 FKTELCNKWQESGTCPYGDH 287


>UniRef50_Q0JKW4 Cluster: Os01g0645000 protein; n=3; Oryza
           sativa|Rep: Os01g0645000 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 339

 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 29/50 (58%), Positives = 34/50 (68%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHGV ELR + RHP+YKT +CR   +   CPYG RCHF H+   A R
Sbjct: 285 CQFAHGVTELRPVIRHPRYKTAVCRMVLAGDVCPYGHRCHFRHSLTPAER 334



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +KTELC  +   G CPYG +C F H   E R
Sbjct: 265 FKTELCNKWEETGDCPYGDQCQFAHGVTELR 295



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           +KTELC  +EE G C YGD
Sbjct: 265 FKTELCNKWEETGDCPYGD 283


>UniRef50_Q10MN8 Cluster: Zinc finger C-x8-C-x5-C-x3-H type family
           protein; n=4; Oryza sativa|Rep: Zinc finger
           C-x8-C-x5-C-x3-H type family protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 457

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 27/52 (51%), Positives = 35/52 (67%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           C+FAHG++ELR + RHP+YKT  C+ F +   CPYG RCHF H+   A   E
Sbjct: 402 CRFAHGLQELRPVIRHPRYKTLPCQMFAAASGCPYGHRCHFRHSPLRAAAAE 453



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 16/30 (53%), Positives = 18/30 (60%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           KTELC  +   G CPYG RC F H  +E R
Sbjct: 384 KTELCNKWER-GACPYGARCRFAHGLQELR 412


>UniRef50_Q28FK2 Cluster: Novel zinc finger C-x8-C-x5-C-x3-H type
           (And similar) protein; n=1; Xenopus tropicalis|Rep:
           Novel zinc finger C-x8-C-x5-C-x3-H type (And similar)
           protein - Xenopus tropicalis (Western clawed frog)
           (Silurana tropicalis)
          Length = 297

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 28/48 (58%), Positives = 33/48 (68%), Gaps = 5/48 (10%)
 Frame = +1

Query: 274 VRELRNLQRHPK-----YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           + E +N+   PK     YKTELCRTFH +G C YG RCHF+HNAEE R
Sbjct: 102 IEESKNIFSPPKPLSSRYKTELCRTFHEIGSCKYGSRCHFIHNAEEQR 149



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F E G CKYG   + +
Sbjct: 119 YKTELCRTFHEIGSCKYGSRCHFI 142


>UniRef50_Q9XTB3 Cluster: Putative uncharacterized protein mex-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein mex-1 - Caenorhabditis elegans
          Length = 494

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 5/62 (8%)
 Frame = +1

Query: 226 RSGGL*IWG*CQFAHGVRELRNLQR-----HPKYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           RSG       C+FAHG  ELR   +     HPKYKT+LC  F + G CPYGPRC F+H  
Sbjct: 149 RSGSCPYGEACRFAHGENELRMPSQPRGKAHPKYKTQLCDKFSNFGQCPYGPRCQFIHKL 208

Query: 391 EE 396
           ++
Sbjct: 209 KK 210



 Score = 40.7 bits (91), Expect = 0.034
 Identities = 16/39 (41%), Positives = 19/39 (48%)
 Frame = +1

Query: 286 RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           R  ++   +KT LC  F   G CPYG  C F H   E R
Sbjct: 131 RQKRKEEAFKTALCDAFKRSGSCPYGEACRFAHGENELR 169


>UniRef50_A0BUS9 Cluster: Chromosome undetermined scaffold_13, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_13,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 234

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 24/45 (53%), Positives = 31/45 (68%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           CQFAHG +E  N Q + KYK++LCR+FH    C YG RC F+H +
Sbjct: 126 CQFAHGQKEKINRQCNQKYKSKLCRSFHQDYVCFYGARCQFIHES 170



 Score = 41.1 bits (92), Expect = 0.025
 Identities = 15/39 (38%), Positives = 24/39 (61%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           Q + K+KTE+C+ +  +G C YG +C F H  +E   R+
Sbjct: 101 QSNVKFKTEMCKNWSLLGRCNYGNKCQFAHGQKEKINRQ 139


>UniRef50_A7PKY7 Cluster: Chromosome chr7 scaffold_20, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr7 scaffold_20, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 290

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 23/48 (47%), Positives = 30/48 (62%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEA 399
           CQFAHG  ELR L+   + + E+C+ F + G CPY PRC F H  + A
Sbjct: 159 CQFAHGKEELRPLRYSMRTRPEICKQFAATGSCPYSPRCRFSHQLQSA 206



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           YKTE+CR++  +  C YG +C F H  EE R
Sbjct: 139 YKTEICRSWEDLASCRYGAKCQFAHGKEELR 169


>UniRef50_Q9U2V4 Cluster: Putative uncharacterized protein; n=6;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 205

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 25/48 (52%), Positives = 30/48 (62%), Gaps = 3/48 (6%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQ---RHPKYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           C+FAHGV ELR  Q    H  YKT LC  F + G+C YG RC F+H +
Sbjct: 113 CKFAHGVHELRCQQTTRNHRNYKTVLCDKFTTTGYCKYGARCQFIHRS 160


>UniRef50_Q9XUB2 Cluster: Zinc finger protein mex-5; n=4;
           Rhabditida|Rep: Zinc finger protein mex-5 -
           Caenorhabditis elegans
          Length = 468

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 28/54 (51%), Positives = 36/54 (66%), Gaps = 7/54 (12%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQ---RHP--KYKTELCRTFH--SVGFCPYGPRCHFVHNAEE 396
           C+FAHG++ELR      R+P  KYKT+LC+ F     GFCPYG RC FVH  ++
Sbjct: 292 CKFAHGLKELRATDAPARYPNNKYKTKLCKNFARGGTGFCPYGLRCEFVHPTDK 345



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 2/38 (5%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGF--CPYGPRCHFVHNAEEAR 402
           Q+ P YKT LC   H+ G   C  G RC F H  +E R
Sbjct: 266 QQPPNYKTRLCM-MHASGIKPCDMGARCKFAHGLKELR 302


>UniRef50_Q23CY7 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 212

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C FAHG  E+R     P  Y+T+ C+ FH +GFC YG RC F+H   +
Sbjct: 86  CAFAHGYHEVREKTHLPNNYRTKKCKNFHEIGFCLYGERCQFLHTVHK 133



 Score = 35.9 bits (79), Expect = 0.96
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           K+KTE+C+ + + G C +   C F H   E R +
Sbjct: 65  KFKTEICKYWKNTGHCHFSDSCAFAHGYHEVREK 98


>UniRef50_Q20667 Cluster: Posterior segregation protein 1; n=4;
           Caenorhabditis|Rep: Posterior segregation protein 1 -
           Caenorhabditis elegans
          Length = 264

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 26/48 (54%), Positives = 29/48 (60%), Gaps = 5/48 (10%)
 Frame = +1

Query: 256 CQFAHGVRELR-----NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C+FAHGV ELR       + HPKYKT LC  F   G C YG RC F+H
Sbjct: 119 CRFAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKYGTRCQFIH 166



 Score = 35.9 bits (79), Expect = 0.96
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 256 CQFAHGVRE--LRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C     +RE  +R  ++   +KT LC  +     C YG +C F H   E R
Sbjct: 79  CTVPDDLREEMMRQRRKEDAFKTALCDAYKRSQACSYGDQCRFAHGVHELR 129


>UniRef50_UPI00006CB1DF Cluster: hypothetical protein
           TTHERM_00301750; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00301750 - Tetrahymena
           thermophila SB210
          Length = 383

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 23/47 (48%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = +1

Query: 256 CQFAHGVREL--RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           CQFAHG  EL  ++     +YK++LC +FH+  FCPYG RC F+H +
Sbjct: 240 CQFAHGKNELVDKSTVNKRQYKSKLCNSFHTQKFCPYGNRCMFIHES 286



 Score = 40.7 bits (91), Expect = 0.034
 Identities = 15/36 (41%), Positives = 20/36 (55%)
 Frame = +1

Query: 289 NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           N Q   K+KTE+C+ +   G C YG +C F H   E
Sbjct: 213 NQQETSKFKTEMCKNWMEFGKCNYGKKCQFAHGKNE 248


>UniRef50_Q9Y1V9 Cluster: HrZF-1; n=1; Halocynthia roretzi|Rep:
           HrZF-1 - Halocynthia roretzi (Sea squirt)
          Length = 621

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 256 CQFAHGVREL-RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C FAHG  +L  N    P+YKT +C+    +G CPYG +C F H  +E R
Sbjct: 526 CDFAHGTDDLILNSSSKPRYKTRMCKVLQQIGRCPYGAQCTFAHKQDELR 575



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%)
 Frame = +1

Query: 256 CQFAHGVRELR---NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C F H ++E     N+ +  +YKT LC+T+   G CPYG +C F H  ++
Sbjct: 485 CNFYHDLKEKNDHPNVTKTSRYKTRLCKTWQKAGECPYGVKCDFAHGTDD 534



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 16/30 (53%), Positives = 24/30 (80%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           KY+TE C T+H++G CPYG +C+F H+ +E
Sbjct: 464 KYRTEPCTTYHTIGMCPYGEQCNFYHDLKE 493



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +1

Query: 256 CQFAHGVRELR-NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           C FAH   ELR +L    KYKTE+C  +     C +G  CHF H  EE ++
Sbjct: 565 CTFAHKQDELRTDLSLIYKYKTEICNVWAMGLRCSHGSDCHFAHGREELKQ 615


>UniRef50_UPI000150A5C2 Cluster: hypothetical protein
           TTHERM_00058710; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00058710 - Tetrahymena
           thermophila SB210
          Length = 192

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 2/46 (4%)
 Frame = +1

Query: 256 CQFAHGVRELRN--LQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           C+FAHG ++L N  +Q    YKT+ C+ FH    CPYG RCHF H+
Sbjct: 97  CKFAHGKQDLVNKPIQNSKSYKTKTCKAFHEELNCPYGSRCHFKHD 142



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 14/30 (46%), Positives = 20/30 (66%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           KYKTE+C+ F + G C YG +C F H  ++
Sbjct: 76  KYKTEMCKNFQATGTCNYGKKCKFAHGKQD 105


>UniRef50_A0BVF0 Cluster: Chromosome undetermined scaffold_13, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_13,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 223

 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +1

Query: 256 CQFAHGVRELR-NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           C FAHG  EL+     H KYKT+ C+ F   G+CPYG RC ++H+
Sbjct: 86  CSFAHGDSELQPKTHLHSKYKTKPCKRFFQQGYCPYGIRCQYIHD 130



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 15/30 (50%), Positives = 16/30 (53%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           K KTELC+ F   G C YG  C F H   E
Sbjct: 65  KKKTELCKNFVQTGRCKYGYECSFAHGDSE 94


>UniRef50_A0DT42 Cluster: Chromosome undetermined scaffold_62, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_62,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 198

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +1

Query: 256 CQFAHGVRELR-NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           C FAHG  EL+     H KYKT+ C  + + GFCPYG RC ++H+
Sbjct: 81  CSFAHGYSELQAKTHLHQKYKTKPCNRYFTQGFCPYGIRCQYLHD 125



 Score = 36.7 bits (81), Expect = 0.55
 Identities = 14/34 (41%), Positives = 18/34 (52%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           K KTELC+ F   G C +G  C F H   E + +
Sbjct: 60  KKKTELCKNFQLTGQCKFGNECSFAHGYSELQAK 93


>UniRef50_Q6C1T6 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 395

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 21/43 (48%), Positives = 29/43 (67%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAHG  EL+N+ R PK++++LC+ +   G C Y  RC F H
Sbjct: 352 CQFAHGEHELKNVDRPPKWRSKLCQNWLRTGTCAYNDRCCFKH 394



 Score = 41.5 bits (93), Expect = 0.019
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           YKTE+C +F   G C YG +C F H   E +
Sbjct: 332 YKTEMCSSFQKTGSCSYGEKCQFAHGEHELK 362


>UniRef50_Q9XV46 Cluster: Putative uncharacterized protein moe-3;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein moe-3 - Caenorhabditis elegans
          Length = 367

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 23/47 (48%), Positives = 31/47 (65%), Gaps = 4/47 (8%)
 Frame = +1

Query: 256 CQFAHGVRELR----NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C+FAHG  ELR      +++ KYKT+LC  + + G CPYG RC F+H
Sbjct: 151 CRFAHGEEELRPAKLESRQNNKYKTKLCDKYTTTGLCPYGKRCLFIH 197



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = +1

Query: 286 RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           R +Q+   YKT +C+ +     C +   C F H  EE R
Sbjct: 123 RRMQKPESYKTVICQAWLESKTCTFAENCRFAHGEEELR 161


>UniRef50_P47976 Cluster: Zinc finger protein CTH1; n=2;
           Saccharomyces cerevisiae|Rep: Zinc finger protein CTH1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 325

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG+ EL+  ++   Y+T+ C  +  +G+CPYG RC F H  ++
Sbjct: 225 CQFAHGLNELKFKKKSNNYRTKPCINWSKLGYCPYGKRCCFKHGDDK 271



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 17/41 (41%), Positives = 22/41 (53%)
 Frame = +1

Query: 280 ELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +L  L     YKTELC +F   G+C YG +C F H   E +
Sbjct: 195 QLPQLVNKTLYKTELCESFTIKGYCKYGNKCQFAHGLNELK 235


>UniRef50_Q23359 Cluster: Oocyte maturation defective protein 2;
           n=3; Caenorhabditis|Rep: Oocyte maturation defective
           protein 2 - Caenorhabditis elegans
          Length = 393

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 22/47 (46%), Positives = 31/47 (65%), Gaps = 4/47 (8%)
 Frame = +1

Query: 256 CQFAHGVRELR----NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C+FAHG  ELR      +++ KY+T+LC  + + G CPYG RC F+H
Sbjct: 126 CRFAHGEEELRPSLIEARQNNKYRTKLCDKYTTTGLCPYGKRCLFIH 172



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = +1

Query: 259 QFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           Q+    R    +Q+   YKT +C+ +     C +   C F H  EE R
Sbjct: 89  QYHADPRRRHRMQKPESYKTVICQAWLESKTCAFAENCRFAHGEEELR 136


>UniRef50_O18251 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 199

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 25/52 (48%), Positives = 31/52 (59%), Gaps = 5/52 (9%)
 Frame = +1

Query: 256 CQFAHGVRELR----NLQ-RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C+FAH V EL+    NL   +PKYKT LC  F + G C YG +C F+H   E
Sbjct: 89  CKFAHSVEELQLKHQNLGINNPKYKTVLCDNFSTTGHCKYGTKCQFIHRTVE 140



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = +1

Query: 256 CQFAHGVRE--LRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C  +  VRE  +R  +R   +KT LC+TF     C YG +C F H+ EE
Sbjct: 49  CTISDDVREEMMRLRRRENAFKTALCKTFQLTKACSYGEQCKFAHSVEE 97


>UniRef50_Q22X37 Cluster: Tristetraproline, zinc finger protein;
           n=1; Tetrahymena thermophila SB210|Rep:
           Tristetraproline, zinc finger protein - Tetrahymena
           thermophila SB210
          Length = 294

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRN-LQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           C FAHG  +L+  +  HP YKT+ C+ F   G C YG RC ++H+
Sbjct: 145 CSFAHGKEQLQGKIHLHPNYKTKPCKKFFIKGICSYGNRCQYIHS 189



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           K KTE+C+ + + G C +G +C F H  E+
Sbjct: 124 KLKTEMCKNWTATGTCKFGDKCSFAHGKEQ 153


>UniRef50_Q750B3 Cluster: AGR044Cp; n=1; Eremothecium gossypii|Rep:
           AGR044Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 300

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 20/47 (42%), Positives = 30/47 (63%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG+ EL+  +R  K++T+ C  +   G+C YG RC F H  ++
Sbjct: 206 CQFAHGLHELKFKERSDKFRTKPCINWSKTGYCRYGKRCCFKHGDDD 252



 Score = 40.7 bits (91), Expect = 0.034
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           YKTELC +F + G C Y  +C F H   E + +E
Sbjct: 186 YKTELCESFATTGACKYDNKCQFAHGLHELKFKE 219


>UniRef50_UPI00006CD9DD Cluster: zinc finger protein; n=1;
           Tetrahymena thermophila SB210|Rep: zinc finger protein -
           Tetrahymena thermophila SB210
          Length = 252

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 2/46 (4%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQR--HPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           C+FAHG  EL+      +  ++T+ C+ FH   +CPYG RCHF+H+
Sbjct: 152 CRFAHGKDELQKKPSITNNNFRTKYCKAFHEKMYCPYGQRCHFLHD 197



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 17/34 (50%), Positives = 22/34 (64%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           KYKTELC TF   G C YG +C F H  +E +++
Sbjct: 131 KYKTELCNTFTITGHCDYGAKCRFAHGKDELQKK 164


>UniRef50_A7TSS3 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 304

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 20/43 (46%), Positives = 28/43 (65%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAHG+ E++   R   Y+T+ C  +  +G+CPYG RC F H
Sbjct: 199 CQFAHGLHEVKFKSRSNNYRTKPCINWTKLGYCPYGVRCCFKH 241



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 15/31 (48%), Positives = 21/31 (67%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +KTELC+TF + G+C YG +C F H   E +
Sbjct: 179 FKTELCKTFTTKGYCKYGNKCQFAHGLHEVK 209


>UniRef50_A5DY96 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 504

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 20/43 (46%), Positives = 30/43 (69%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAHG +EL++++R PK++++ C  +   G C YG RC F H
Sbjct: 460 CQFAHGEQELKHVERPPKWRSKPCTNWAKYGSCRYGNRCCFKH 502



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 16/34 (47%), Positives = 19/34 (55%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           YKTELC  F   G C YG +C F H  +E +  E
Sbjct: 440 YKTELCAPFMKTGVCTYGTKCQFAHGEQELKHVE 473



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 13/18 (72%), Positives = 14/18 (77%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELC PF + GVC YG
Sbjct: 440 YKTELCAPFMKTGVCTYG 457


>UniRef50_A3LYJ7 Cluster: Predicted protein; n=1; Pichia
           stipitis|Rep: Predicted protein - Pichia stipitis
           (Yeast)
          Length = 223

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 20/43 (46%), Positives = 29/43 (67%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAHG  EL+ ++R PK++++ C  +  +G C YG RC F H
Sbjct: 179 CQFAHGENELKTVERPPKWRSKPCANWAKLGSCRYGNRCCFKH 221



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           YKTELC +F  +G CPYG +C F H   E +  E
Sbjct: 159 YKTELCVSFMKMGICPYGNKCQFAHGENELKTVE 192


>UniRef50_A0DQF1 Cluster: Chromosome undetermined scaffold_6, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_6,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 198

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHP-KYKTELCRTFHSVGFCPYGPRCHFVH 384
           C FAHG  E+R     P  YKT++C+ + ++G+C YG RC F H
Sbjct: 112 CAFAHGQHEIRQKTHVPHNYKTQVCKNYITIGYCCYGERCQFKH 155



 Score = 39.5 bits (88), Expect = 0.078
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           K KTE+C+ +    +CPYG +C F H   E R++
Sbjct: 91  KVKTEICKYWAIEDYCPYGQQCAFAHGQHEIRQK 124


>UniRef50_Q5A5R5 Cluster: Putative uncharacterized protein TIS11;
           n=1; Candida albicans|Rep: Putative uncharacterized
           protein TIS11 - Candida albicans (Yeast)
          Length = 203

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 20/43 (46%), Positives = 29/43 (67%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAHG  EL++++R PK++++ C  +   G C YG RC F H
Sbjct: 159 CQFAHGENELKHVERPPKWRSKPCANWTKYGSCRYGNRCCFKH 201



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 16/34 (47%), Positives = 19/34 (55%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           YKTELC +F   G CPY  +C F H   E +  E
Sbjct: 139 YKTELCASFMKTGVCPYANKCQFAHGENELKHVE 172


>UniRef50_Q6CQJ6 Cluster: Similar to sp|P47976 Saccharomyces
           cerevisiae YDR151c CTH1; n=1; Kluyveromyces lactis|Rep:
           Similar to sp|P47976 Saccharomyces cerevisiae YDR151c
           CTH1 - Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 310

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 20/47 (42%), Positives = 29/47 (61%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG+ EL+  +R   ++T+ C  +   G+C YG RC F H  +E
Sbjct: 229 CQFAHGLHELKIKERSNNFRTKPCVNWQKYGYCRYGKRCCFKHGDDE 275



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           YKTELC +F + G C YG +C F H   E + +E
Sbjct: 209 YKTELCESFATKGTCKYGNKCQFAHGLHELKIKE 242



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 12/19 (63%), Positives = 13/19 (68%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELC  F   G CKYG+
Sbjct: 209 YKTELCESFATKGTCKYGN 227


>UniRef50_Q6BMQ7 Cluster: Debaryomyces hansenii chromosome F of
           strain CBS767 of Debaryomyces hansenii; n=2;
           Saccharomycetaceae|Rep: Debaryomyces hansenii chromosome
           F of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 287

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 20/43 (46%), Positives = 28/43 (65%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAHG  EL+++ R PK++++ C  +   G C YG RC F H
Sbjct: 243 CQFAHGENELKSVSRPPKWRSKPCANWSKFGSCRYGNRCCFKH 285



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           YKTELC ++  +G CPYG +C F H   E +
Sbjct: 223 YKTELCASYIKMGICPYGNKCQFAHGENELK 253


>UniRef50_UPI000150A3C4 Cluster: zinc finger protein; n=1;
           Tetrahymena thermophila SB210|Rep: zinc finger protein -
           Tetrahymena thermophila SB210
          Length = 375

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 20/45 (44%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
 Frame = +1

Query: 256 CQFAHGVREL-RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           C+FAHG  EL + +  +  +KT+ C+ ++    C YGPRCHFVH+
Sbjct: 265 CKFAHGKNELVQKVAANKHFKTKKCKQYYESCVCNYGPRCHFVHD 309



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           KYKTE+C+ +   G C YG +C F H   E
Sbjct: 244 KYKTEMCKNWVENGKCNYGDKCKFAHGKNE 273


>UniRef50_UPI0001509FDB Cluster: hypothetical protein
           TTHERM_00191720; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00191720 - Tetrahymena
           thermophila SB210
          Length = 421

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 20/50 (40%), Positives = 30/50 (60%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           C FAHG  EL++     +YKT++C+ F   G C  G +CH+ H  +E R+
Sbjct: 234 CDFAHGTEELKSYV--DRYKTQICQQFTQKGSCQNGDKCHYAHGEQEIRQ 281


>UniRef50_Q1RPX5 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 335

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 23/50 (46%), Positives = 28/50 (56%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           C FAHG  EL       KYKT +C+ F + G CPYG +C F H   E R+
Sbjct: 246 CDFAHGSEELV-----VKYKTRMCKIFQATGRCPYGTQCTFAHYEREKRK 290



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           K+KT+ C T++++G CPYG +C+F H  +E
Sbjct: 191 KFKTKPCTTYYTIGTCPYGDKCNFYHTEDE 220



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 256 CQFAHGVRELR-NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C FAH  RE R ++    K+KTE+C+ + +   C +G  CHF H AEE +
Sbjct: 279 CTFAHYEREKRKDISTVYKFKTEMCQLWLN-NKCVFGAACHFAHGAEEMK 327



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C F H   E    +   + KT LC++++S G C YG RC F H +EE
Sbjct: 212 CNFYHTEDE----KNSTRVKTRLCKSWNSSGACEYGERCDFAHGSEE 254


>UniRef50_Q6FVK2 Cluster: Candida glabrata strain CBS138 chromosome
           E complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome E complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 453

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 19/43 (44%), Positives = 29/43 (67%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAHG++EL+  +    ++T+ C  +  +G+CPYG RC F H
Sbjct: 360 CQFAHGLQELKLKKTSNNFRTKPCINWDKLGYCPYGKRCCFKH 402



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           YKTELC TF + GFC YG +C F H  +E + ++
Sbjct: 340 YKTELCETFTTKGFCKYGNKCQFAHGLQELKLKK 373


>UniRef50_Q233A9 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 459

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 21/45 (46%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +1

Query: 256 CQFAHGVREL-RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           C+FAHG  EL   L  +  YKT+LC  +H    C Y  RCHF H+
Sbjct: 203 CRFAHGKEELIERLAMNKNYKTKLCSAYHKEQVCQYAARCHFKHD 247



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +1

Query: 259 QFAHGVRELRNLQR-HPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           Q AH  ++L  L++   KYKTELC+ + S G C YG +C F H  EE   R
Sbjct: 167 QLAH--QQLNQLKKMEQKYKTELCKNWVSKGVCQYGQKCRFAHGKEELIER 215


>UniRef50_Q7QX74 Cluster: GLP_217_52342_52923; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_217_52342_52923 - Giardia lamblia
           ATCC 50803
          Length = 193

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 19/47 (40%), Positives = 30/47 (63%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAH + E ++ +R      +LC  F + G+CPYG RC+F+H + +
Sbjct: 51  CQFAHSMEEFQHRRRSNVKDMKLCTDFITHGYCPYGRRCNFLHQSPD 97



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/34 (52%), Positives = 20/34 (58%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           KYKTE C  F   G C YG RC F H+ EE + R
Sbjct: 30  KYKTEFCNCFAEFGRCDYGDRCQFAHSMEEFQHR 63


>UniRef50_A0BAX1 Cluster: Chromosome undetermined scaffold_1, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_1,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 141

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRN-LQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           C FAHG  ELR+ +  +  +KT+ C+ +H  G C YG RC ++H+
Sbjct: 63  CSFAHGDNELRDRVPANENFKTKPCKNYHKFGTCSYGLRCQYLHS 107



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           K KTE+C+ F   G C Y   C F H   E R R
Sbjct: 42  KKKTEICKNFLFKGSCKYQENCSFAHGDNELRDR 75


>UniRef50_P47977 Cluster: Zinc finger protein CTH2; n=2;
           Saccharomyces cerevisiae|Rep: Zinc finger protein CTH2 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 285

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           CQFAHG+ EL+  +    ++T+ C  +  +G+CPYG RC F H
Sbjct: 190 CQFAHGLGELKVKKSCKNFRTKPCVNWEKLGYCPYGRRCCFKH 232



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/39 (48%), Positives = 23/39 (58%), Gaps = 2/39 (5%)
 Frame = +1

Query: 292 LQRHPK--YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +Q  PK  YKTELC +F   G CPYG +C F H   E +
Sbjct: 162 VQETPKQLYKTELCESFTLKGSCPYGSKCQFAHGLGELK 200


>UniRef50_A0CJW1 Cluster: Chromosome undetermined scaffold_2, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_2,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 211

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELR-NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C +AHG  EL      H  YKT+ C+ F + G+C YG RC ++H
Sbjct: 80  CSYAHGQSELLPKAHLHQNYKTKPCKNFLNYGWCNYGSRCQYIH 123



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           K KTELC+ F   G C +G  C + H   E
Sbjct: 59  KKKTELCKNFTLTGSCKFGSNCSYAHGQSE 88


>UniRef50_A0CM12 Cluster: Chromosome undetermined scaffold_21, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_21,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 284

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           Q +PKYKT LC+ + + G C  G RCHF H   E R
Sbjct: 8   QMNPKYKTSLCKHWTTTGNCSIGSRCHFAHGERELR 43


>UniRef50_A5K505 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium vivax|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 2172

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/51 (41%), Positives = 28/51 (54%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           C +AHG  ELR    +  +KT+LC+ F   G CP G +C   H   E R+R
Sbjct: 554 CVYAHGEGELRATPDY--FKTKLCKYFDKEGTCPSGDKCRHAHGQAELRQR 602


>UniRef50_UPI000150A980 Cluster: zinc finger protein; n=1;
           Tetrahymena thermophila SB210|Rep: zinc finger protein -
           Tetrahymena thermophila SB210
          Length = 607

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           C FAHG+ +LR+      YKT LC  F   G C  G +C + H   E ++R
Sbjct: 503 CCFAHGIDDLRHTDDF--YKTSLCFNFSKEGKCENGDKCRYAHGENELKKR 551


>UniRef50_Q4PE14 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 409

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           YKTE+CR +   GFC YG RC F H   E R+
Sbjct: 312 YKTEICRNWEEKGFCYYGDRCQFAHGEHELRQ 343



 Score = 39.1 bits (87), Expect = 0.10
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTF 336
           CQFAHG  ELR + R+P +KT+ C+ F
Sbjct: 332 CQFAHGEHELRQVPRNPLWKTKPCKRF 358



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTE+CR +EE G C YGD
Sbjct: 312 YKTEICRNWEEKGFCYYGD 330


>UniRef50_Q5PP65 Cluster: At2g35430; n=2; Arabidopsis thaliana|Rep:
           At2g35430 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 252

 Score = 44.4 bits (100), Expect(2) = 0.001
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           + P +KT +C  + + G+CP+G  CHF H   E
Sbjct: 140 KSPNWKTRICNKWQTTGYCPFGSHCHFAHGPSE 172



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPR-CHFVHNAEEAR 402
           +KT+LC  F + G CPY    CHF H+AEE R
Sbjct: 72  FKTKLCFKFRA-GTCPYSASSCHFAHSAEELR 102



 Score = 20.6 bits (41), Expect(2) = 0.001
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +1

Query: 256 CQFAHGVRELR 288
           C FAH   ELR
Sbjct: 92  CHFAHSAEELR 102


>UniRef50_Q16HG9 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 1048

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +1

Query: 268 HGVRELR---NLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           HG R+L+   +L  + KYK  LCR  +  G CP GP C F H+ EE  +
Sbjct: 376 HGNRKLQEPGHLAHNSKYKISLCRDLNLRGTCPRGPNCTFAHSEEELEK 424


>UniRef50_UPI00006CBCDB Cluster: Zinc finger protein CTH1; n=1;
           Tetrahymena thermophila SB210|Rep: Zinc finger protein
           CTH1 - Tetrahymena thermophila SB210
          Length = 279

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = +1

Query: 259 QFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           Q +    E +NL +  +YKTELCR +   G C YG +C + H   E +++
Sbjct: 62  QESSSTTEPQNLIQKERYKTELCRNYQIHGTCNYGKKCQYAHGRHELQQK 111



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = +1

Query: 256 CQFAHGVRELRNL---QRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           CQ+AHG  EL+     + +  YKT  C+ F +   CPYG RC + H+
Sbjct: 99  CQYAHGRHELQQKPERKTNQYYKTRPCKEFFNTLTCPYGQRCKYNHD 145


>UniRef50_Q57W26 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 364

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           +YKT+LC+ F   G CPY  RC F H  EE R  E
Sbjct: 64  RYKTKLCKNFVQYGTCPYDIRCMFAHGEEELRTAE 98


>UniRef50_Q94131 Cluster: Pharynx and intestine in excess protein 1;
           n=1; Caenorhabditis elegans|Rep: Pharynx and intestine
           in excess protein 1 - Caenorhabditis elegans
          Length = 335

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +H +YKT LC  F   G+CPY   C + H  +E R
Sbjct: 95  KHTEYKTRLCDAFRREGYCPYNDNCTYAHGQDELR 129


>UniRef50_UPI000150A081 Cluster: hypothetical protein
           TTHERM_00411520; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00411520 - Tetrahymena
           thermophila SB210
          Length = 295

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           KYKT LCR + + G C  G +CHF H  EE R
Sbjct: 36  KYKTNLCRHWQTSGNCQIGAKCHFAHGQEELR 67


>UniRef50_Q9LQM3 Cluster: F5D14.12 protein; n=5; Magnoliophyta|Rep:
           F5D14.12 protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 384

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +KT +C  +   G+CP+G +CHF H A E  R
Sbjct: 261 WKTRICNKWEITGYCPFGAKCHFAHGAAELHR 292



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +KT+LC  F + G CPY   C+F H  EE RR
Sbjct: 92  FKTKLCCKFRA-GTCPYITNCNFAHTVEELRR 122



 Score = 33.9 bits (74), Expect = 3.9
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           +K   C+ F++   CPYG  C F+H+ E +R RE
Sbjct: 173 FKGRHCKKFYTEEGCPYGESCTFLHD-EASRNRE 205


>UniRef50_A0DGR7 Cluster: Chromosome undetermined scaffold_5, whole
           genome shotgun sequence; n=7; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_5,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 235

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 18/32 (56%), Positives = 20/32 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           KYKT+LCR F + G C  G RC F H  EE R
Sbjct: 12  KYKTQLCRHFITNGNCALGARCQFAHGREELR 43


>UniRef50_Q6Z8U9 Cluster: Putative uncharacterized protein
           P0686H11.8; n=4; Oryza sativa|Rep: Putative
           uncharacterized protein P0686H11.8 - Oryza sativa subsp.
           japonica (Rice)
          Length = 628

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHF 378
           C++AH   ELR +   PKY+TE CR + +   C YG +C +
Sbjct: 562 CEYAHSQDELRVIDARPKYRTEPCRYWLAGKGCWYGDKCRY 602


>UniRef50_Q8II18 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium falciparum 3D7|Rep: Putative uncharacterized
           protein - Plasmodium falciparum (isolate 3D7)
          Length = 1722

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           C +AHG  ELR       +KT+LC+ F++ G CP    C   H   E R+
Sbjct: 567 CVYAHGELELRAPPDF--FKTKLCKFFNTSGMCPLSDNCRHAHGQNELRK 614


>UniRef50_Q8I3N4 Cluster: Putative uncharacterized protein PFE1145w;
           n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein PFE1145w - Plasmodium falciparum
           (isolate 3D7)
          Length = 1552

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 21/51 (41%), Positives = 27/51 (52%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           C FAH V ELR+      YKT LC+ F + G+C     C   H  +E +RR
Sbjct: 377 CNFAHHVEELRSTDEF--YKTTLCKFFLN-GYCKADKNCRHAHGYKELKRR 424


>UniRef50_A7PB73 Cluster: Chromosome chr16 scaffold_10, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr16 scaffold_10, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 253

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           Q+   +KT +C  + + G CP+G +CHF H
Sbjct: 210 QKPSNWKTRICNKWETTGSCPFGNKCHFAH 239



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +KT+LC  F + G CPY   C+F H  EE RR
Sbjct: 73  FKTKLCGKFRA-GVCPYITNCNFAHGMEELRR 103



 Score = 37.9 bits (84), Expect(2) = 0.013
 Identities = 17/44 (38%), Positives = 26/44 (59%)
 Frame = +1

Query: 280 ELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           E+R  +    YK   C+ F++   CPYG  C F+H+ E++R RE
Sbjct: 143 EMRCGESQRSYKGRHCKKFYTEEGCPYGDSCTFLHD-EQSRARE 185



 Score = 23.4 bits (48), Expect(2) = 0.013
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +1

Query: 256 CQFAHGVRELR 288
           C FAHG+ ELR
Sbjct: 92  CNFAHGMEELR 102


>UniRef50_Q9FG30 Cluster: Similarity to unknown protein; n=5; core
           eudicotyledons|Rep: Similarity to unknown protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 240

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +1

Query: 301 HP--KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           HP   YKT++C  + S G C YG RCHF H   E RR
Sbjct: 201 HPGSNYKTKICDRY-SKGNCTYGDRCHFAHGESELRR 236



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 13/41 (31%), Positives = 21/41 (51%)
 Frame = +1

Query: 262 FAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           F    +E+ ++      K++ C  F S   CP+G  CHF+H
Sbjct: 21  FKRSKQEMESISTGLGSKSKPCTKFFSTSGCPFGDNCHFLH 61


>UniRef50_A7NZI6 Cluster: Chromosome chr6 scaffold_3, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr6 scaffold_3, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 815

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHS-VGFCPYGPRCHFVHNAEEARRR 408
           RHP +KT LC  F S  G C +G  C + H  EE R+R
Sbjct: 66  RHPLWKTSLCSYFRSHSGSCSHGDACRYAHGEEELRQR 103


>UniRef50_A4S9J6 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 249

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 19/39 (48%), Positives = 21/39 (53%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           Q + K KT LCR F S   C +G RC F H  EE R  E
Sbjct: 59  QVNEKIKTRLCRNFESPQGCRFGDRCVFAHGEEELRTEE 97



 Score = 40.7 bits (91), Expect = 0.034
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           +KT++C ++   G CP+G RCH+ H  EE ++R
Sbjct: 203 FKTKICDSWVRNGQCPFGRRCHYAHGNEELQQR 235


>UniRef50_Q61Q18 Cluster: Putative uncharacterized protein CBG07225;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG07225 - Caenorhabditis
           briggsae
          Length = 530

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 11/57 (19%)
 Frame = +1

Query: 256 CQFAHGVRELRNL--------QRHP-KYKTELCRTFHSVG--FCPYGPRCHFVHNAE 393
           CQFAHG++ELR +        Q+ P ++KT+LC  F   G   C Y  RC F+H ++
Sbjct: 332 CQFAHGLQELRTVAQNRAKKEQKIPERHKTKLCANFSKSGSEVCLYEQRCQFIHPSD 388



 Score = 36.3 bits (80), Expect = 0.72
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +KT+LC  F     CP GP C F H  +E R
Sbjct: 312 WKTQLCHHFTVGACCPKGPLCQFAHGLQELR 342



 Score = 33.9 bits (74), Expect = 3.9
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 2/29 (6%)
 Frame = +1

Query: 313 KTELCRTFHS--VGFCPYGPRCHFVHNAE 393
           KT+LC  ++    G+CPY  RC F+H A+
Sbjct: 104 KTKLCVNYYKGGSGYCPYEHRCQFIHPAD 132


>UniRef50_A7AN16 Cluster: Zinc finger C-x8-C-x5-C-x3-H type domain
           containing protein; n=1; Babesia bovis|Rep: Zinc finger
           C-x8-C-x5-C-x3-H type domain containing protein -
           Babesia bovis
          Length = 239

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 19/52 (36%), Positives = 28/52 (53%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           C +AH   ELR+      YKT LC+ + + G+C  G  C + H  EE R ++
Sbjct: 73  CPYAHSYAELRHTDGF--YKTYLCKYWQN-GYCKAGNMCRYAHGTEELRNKD 121


>UniRef50_A5K9D0 Cluster: Putative uncharacterized protein; n=3;
           Plasmodium|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 1935

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 20/52 (38%), Positives = 28/52 (53%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           C FAH V+ELR+      YKT LC+ F + G+C     C   H  +E + +E
Sbjct: 444 CNFAHNVQELRSTDEF--YKTTLCKFFLN-GYCKADTNCRHAHGHKELKSKE 492


>UniRef50_Q57VA5 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 566

 Score = 41.5 bits (93), Expect = 0.019
 Identities = 17/35 (48%), Positives = 19/35 (54%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           KYKT LC  F   G C +G RC F H  +E R  E
Sbjct: 14  KYKTSLCTYFMENGECQFGDRCAFAHGEDELRHEE 48


>UniRef50_Q1LXV6 Cluster: Novel protein; n=2; Danio rerio|Rep: Novel
           protein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 991

 Score = 41.1 bits (92), Expect = 0.025
 Identities = 18/48 (37%), Positives = 22/48 (45%)
 Frame = +1

Query: 262 FAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           F+    E    Q + KYKT +CR     G CP G  C F H  EE  +
Sbjct: 395 FSKKSNESPQAQPNSKYKTSMCRDLRQQGGCPRGASCTFAHTQEELEK 442


>UniRef50_Q5BWW8 Cluster: SJCHGC04818 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC04818 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 290

 Score = 41.1 bits (92), Expect = 0.025
 Identities = 17/29 (58%), Positives = 20/29 (68%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           HPK +   CRTF S G+CPYG  CHF H+
Sbjct: 47  HPKVR---CRTFASDGWCPYGYNCHFWHD 72


>UniRef50_Q4FX12 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major strain Friedlin
          Length = 317

 Score = 41.1 bits (92), Expect = 0.025
 Identities = 15/32 (46%), Positives = 21/32 (65%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKT+LC+ + + G CPY  RC F H  +E R
Sbjct: 41  RYKTKLCKNYVARGECPYDVRCMFAHGEDELR 72


>UniRef50_Q4CQE4 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 264

 Score = 41.1 bits (92), Expect = 0.025
 Identities = 16/35 (45%), Positives = 19/35 (54%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           +YKT+ CR +   G CPY  RC F H   E R  E
Sbjct: 48  RYKTKFCRNYVLTGICPYQRRCMFAHGDHELRTPE 82


>UniRef50_Q9HBD1 Cluster: Ring finger and CCCH-type zinc finger
           domain-containing protein 2; n=55; Eumetazoa|Rep: Ring
           finger and CCCH-type zinc finger domain-containing
           protein 2 - Homo sapiens (Human)
          Length = 1191

 Score = 41.1 bits (92), Expect = 0.025
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           Q + KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 406 QPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEK 442


>UniRef50_Q5TC82 Cluster: Roquin; n=30; Tetrapoda|Rep: Roquin - Homo
           sapiens (Human)
          Length = 1133

 Score = 41.1 bits (92), Expect = 0.025
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +H KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 410 QHSKYKTYMCRDMKQRGGCPRGASCTFAHSQEELEK 445


>UniRef50_A0CPE8 Cluster: Chromosome undetermined scaffold_23, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_23,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 134

 Score = 40.7 bits (91), Expect = 0.034
 Identities = 17/43 (39%), Positives = 23/43 (53%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C FAHG  +L +      Y+T+ C+ F  +  C YG RC F H
Sbjct: 45  CYFAHGDEQLLSKDVPKNYRTKECKNFQEI-CCKYGQRCQFSH 86



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           K KTE C+ +     CPY  +C+F H  E+
Sbjct: 24  KLKTEFCKFWIEGKICPYENKCYFAHGDEQ 53


>UniRef50_Q1LV60 Cluster: Novel protein; n=6; Clupeocephala|Rep:
           Novel protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 1078

 Score = 40.3 bits (90), Expect = 0.044
 Identities = 15/36 (41%), Positives = 20/36 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +H KYKT +CR     G CP G  C F H+ +E  +
Sbjct: 410 QHSKYKTYMCRDMKQKGGCPRGASCTFAHSQDELEK 445


>UniRef50_Q61IC6 Cluster: Putative uncharacterized protein CBG10308;
           n=2; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG10308 - Caenorhabditis
           briggsae
          Length = 661

 Score = 40.3 bits (90), Expect = 0.044
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 9/55 (16%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHP-------KYKTELCRTF--HSVGFCPYGPRCHFVHNAE 393
           C+FAHGV ELR+    P        YKT LCR +     G CPY   C ++H ++
Sbjct: 465 CRFAHGVEELRSNGSIPDQQVANKSYKTILCRNYAPGGSGDCPYRLACQYIHPSD 519



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 3/34 (8%)
 Frame = +1

Query: 310 YKTELCRTFHSVG---FCPYGPRCHFVHNAEEAR 402
           YKT LC+  H+ G    CP+G  C F H  EE R
Sbjct: 443 YKTRLCK-LHNSGKSIVCPHGAACRFAHGVEELR 475


>UniRef50_Q4QFG8 Cluster: Putative uncharacterized protein; n=2;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 835

 Score = 40.3 bits (90), Expect = 0.044
 Identities = 15/32 (46%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           KYKT +C  F S   CP+G +C F H  +E R
Sbjct: 14  KYKTSMCTFFRSEEGCPFGEKCAFAHGEDELR 45


>UniRef50_Q9LT81 Cluster: Gb|AAC36178.1; n=1; Arabidopsis
           thaliana|Rep: Gb|AAC36178.1 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 386

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +KT LC  F   G CP+G +CHF H   E
Sbjct: 270 WKTRLCMKFDITGQCPFGDKCHFAHGQAE 298



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVH 384
           + +LCR F     CPYG RC+F+H
Sbjct: 185 RMKLCRKFCFGEECPYGDRCNFIH 208


>UniRef50_Q01MN3 Cluster: H1005F08.11 protein; n=11;
           Magnoliophyta|Rep: H1005F08.11 protein - Oryza sativa
           (Rice)
          Length = 309

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           YKT+LC  F   G C +G RCHF H   E R+
Sbjct: 276 YKTKLCENFVK-GTCTFGDRCHFAHGENEQRK 306



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           KT +C  +++   C +G +CHF H   E
Sbjct: 105 KTRMCTKYNTAEGCKFGDKCHFAHGERE 132


>UniRef50_Q57VA6 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 167

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           KY+T LC  +   G CPYG RC F H   +    E
Sbjct: 14  KYRTTLCEHYQRDGQCPYGDRCAFAHGEHQLHTEE 48


>UniRef50_Q4Q5A6 Cluster: Zinc finger protein 2, putative; n=3;
           Leishmania|Rep: Zinc finger protein 2, putative -
           Leishmania major
          Length = 129

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C +    R+ R + R  K KT++C    + G C YG  C F H++EE
Sbjct: 66  CSYRGPQRQRRGIDRS-KAKTKMCMNIENGGTCSYGANCAFAHSSEE 111


>UniRef50_Q6INL5 Cluster: MGC82388 protein; n=2; Xenopus|Rep:
           MGC82388 protein - Xenopus laevis (African clawed frog)
          Length = 714

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G+CP GP C F H
Sbjct: 192 CQYCHSRTEQ---QFHPEIYKSTKCNDMRQTGYCPRGPFCAFAH 232


>UniRef50_A7PET7 Cluster: Chromosome chr11 scaffold_13, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr11 scaffold_13, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 179

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 16/33 (48%), Positives = 20/33 (60%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           KYKT+LC  F + G C +G RCHF H   E  +
Sbjct: 145 KYKTKLCDNF-TKGSCTFGERCHFAHGVGELHK 176


>UniRef50_Q9VV48 Cluster: CG16807-PA; n=2; Sophophora|Rep:
           CG16807-PA - Drosophila melanogaster (Fruit fly)
          Length = 819

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 16/35 (45%), Positives = 19/35 (54%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +PKYK  LCR  +    CP G  C F H+ EE  R
Sbjct: 415 NPKYKISLCRDLNVRRVCPRGSSCTFAHSQEEVER 449


>UniRef50_Q7PDK4 Cluster: ERYTHROCYTE MEMBRANE PROTEIN PFEMP3; n=6;
           Plasmodium (Vinckeia)|Rep: ERYTHROCYTE MEMBRANE PROTEIN
           PFEMP3 - Plasmodium yoelii yoelii
          Length = 1133

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           C+FAH V ELR+      YKT LC+ F + G+C     C   H   E + R
Sbjct: 438 CKFAHHVEELRSTDEF--YKTTLCKFFLN-GYCKADKNCRHAHGQNELKCR 485


>UniRef50_A5K0Z1 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium vivax|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 1293

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C FAHG +EL+    +  YKT +C+ +   GFC  G  C   H   E
Sbjct: 209 CNFAHGEQELK--YTYGVYKTTICKHWKRDGFCSSGINCRHAHGEGE 253


>UniRef50_A0BVB4 Cluster: Chromosome undetermined scaffold_13, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_13,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 245

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 262 FAHGVRELRNLQ-RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +  G+ +L++    + KYKT LCR + +   C  G +C F H  EE R+
Sbjct: 3   YQFGINQLQSTTVPNAKYKTILCRHYQATKQCAIGSKCQFAHGIEEQRQ 51


>UniRef50_Q7PDU0 Cluster: ERYTHROCYTE MEMBRANE PROTEIN PFEMP3; n=6;
           Plasmodium (Vinckeia)|Rep: ERYTHROCYTE MEMBRANE PROTEIN
           PFEMP3 - Plasmodium yoelii yoelii
          Length = 913

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 17/49 (34%), Positives = 25/49 (51%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C +AH   EL++ Q    YK+ +C+   +   C  G  C F HN +E R
Sbjct: 66  CNYAHNQDELKSAQNLFAYKSSMCKFIENKA-CLNGSTCRFAHNIDELR 113


>UniRef50_Q1RL44 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 722

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C F H   E    Q HP+ YK+  C      G+CP GP C F H  +E R
Sbjct: 250 CLFCHTRTEQ---QFHPEIYKSTKCHDMTQTGYCPRGPFCAFAHVEQEIR 296


>UniRef50_Q4PBN5 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 790

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = +1

Query: 319 ELCRTFHSVGFCPYGPRCHFVHNAE 393
           +LCR +H+ GFCP G  C F H+A+
Sbjct: 184 QLCRDYHNKGFCPRGANCKFEHSAD 208


>UniRef50_Q5ACW2 Cluster: Pre-mRNA-splicing factor CWC24; n=1;
           Candida albicans|Rep: Pre-mRNA-splicing factor CWC24 -
           Candida albicans (Yeast)
          Length = 216

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 11/33 (33%), Positives = 23/33 (69%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           ++ ++C+ F  +G+C YG  C F+H  +E+R++
Sbjct: 99  FQPDVCKDFQQIGYCGYGDTCKFLHVRDESRQK 131


>UniRef50_UPI0000498EC5 Cluster: zinc finger protein; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: zinc finger protein -
           Entamoeba histolytica HM-1:IMSS
          Length = 171

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHN 387
           Y+ E+C+ F+  G+C YG  C F+H+
Sbjct: 42  YQPEICKDFYETGYCGYGENCKFIHD 67


>UniRef50_Q93XK1 Cluster: Zinc finger protein; n=1; Pisum
           sativum|Rep: Zinc finger protein - Pisum sativum (Garden
           pea)
          Length = 207

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C    G R     +R   +KT++C  + + G CP+G  CHF H
Sbjct: 154 CNNLEGSRAGSKQERGTYWKTKICLRWKNTGSCPFGNGCHFAH 196


>UniRef50_A7PF03 Cluster: Chromosome chr11 scaffold_13, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr11 scaffold_13, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 320

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVH 384
           +KT+LC  + + G CP+G +CHF H
Sbjct: 211 WKTKLCCKWETTGHCPFGEKCHFAH 235



 Score = 36.3 bits (80), Expect = 0.72
 Identities = 12/25 (48%), Positives = 19/25 (76%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVH 384
           +K +LC+ F++   CPYG RC+F+H
Sbjct: 148 HKMKLCKKFYNGEECPYGDRCNFLH 172


>UniRef50_Q22HK5 Cluster: Zinc finger protein; n=1; Tetrahymena
           thermophila SB210|Rep: Zinc finger protein - Tetrahymena
           thermophila SB210
          Length = 308

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           KYKT +CR F + G C  G  CHF H  +E R
Sbjct: 90  KYKTSICRHFRN-GNCQLGNTCHFAHGQDEMR 120



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 13/70 (18%)
 Frame = +1

Query: 226 RSGGL*IWG*CQFAHGVRELR--------NLQRHPK-----YKTELCRTFHSVGFCPYGP 366
           R+G   +   C FAHG  E+R        N+ + PK     +KT  CR F   GFC    
Sbjct: 100 RNGNCQLGNTCHFAHGQDEMRNVNDPLPNNIPQQPKVVCNNFKTVKCRYFEK-GFCKNQH 158

Query: 367 RCHFVHNAEE 396
            C F H  ++
Sbjct: 159 ACCFAHGDQD 168


>UniRef50_A2FRZ9 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 155

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +1

Query: 286 RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           + L   P+  TE+C+ + + G+C YG  C FVH
Sbjct: 74  QKLSIDPEENTEICKDYFTTGYCTYGHECKFVH 106


>UniRef50_A4IAZ9 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania infantum
          Length = 435

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 15/29 (51%), Positives = 17/29 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           YKT+ CR F   G+CPY  RC F H   E
Sbjct: 138 YKTKRCRHFDQSGWCPYQHRCVFAHGDRE 166


>UniRef50_A4H7Y5 Cluster: Putative uncharacterized protein; n=1;
           Leishmania braziliensis|Rep: Putative uncharacterized
           protein - Leishmania braziliensis
          Length = 803

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           KYKT +C  F     CP+G +C F H  +E R
Sbjct: 14  KYKTSICTFFRREEGCPFGEKCAFAHGEDELR 45


>UniRef50_A0CQE2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_24,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 225

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           KYKT LCR + +   C  G +C F H  EE R
Sbjct: 17  KYKTTLCRHYQATRQCAIGVKCQFAHGQEEMR 48


>UniRef50_UPI0000E4915E Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 723

 Score = 37.9 bits (84), Expect = 0.24
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H      + Q HP+ YK+  C      G+CP GP C F H
Sbjct: 267 CQYCH---TRTDQQFHPEIYKSTKCNDMQQTGYCPRGPFCAFAH 307


>UniRef50_Q247W7 Cluster: Zinc finger protein, putative; n=1;
           Tetrahymena thermophila SB210|Rep: Zinc finger protein,
           putative - Tetrahymena thermophila SB210
          Length = 269

 Score = 37.9 bits (84), Expect = 0.24
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           YKT LC+ +  VG C Y   C+F H   E R
Sbjct: 113 YKTTLCKFYEQVGTCKYDQNCNFAHGDHEKR 143



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +PKYKT LCR + +   C     CHF H +EE R
Sbjct: 50  NPKYKTALCRNYLN-SQCNRNSGCHFAHGSEELR 82



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNAN 262
           YKT LC+ +E+ G CKY  N N
Sbjct: 113 YKTTLCKFYEQVGTCKYDQNCN 134


>UniRef50_Q23Q31 Cluster: Viral A-type inclusion protein repeat
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Viral A-type inclusion protein repeat
           containing protein - Tetrahymena thermophila SB210
          Length = 1823

 Score = 37.9 bits (84), Expect = 0.24
 Identities = 18/49 (36%), Positives = 25/49 (51%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C FAHG+ +LR+      +KT +C  F + G C  G  C + H   E R
Sbjct: 120 CSFAHGLEQLRSTNSF--FKTTICVGF-TKGSCQNGDSCRYAHGESELR 165



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 18/49 (36%), Positives = 24/49 (48%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C +AH   EL+      K  T+LC+ F + G C  G  C F H  E+ R
Sbjct: 85  CVYAHSQEELKEAPNLKK--TKLCQMF-AKGKCNLGNHCSFAHGLEQLR 130


>UniRef50_A5K0K1 Cluster: Putative uncharacterized protein; n=2;
           Plasmodium|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 1005

 Score = 37.9 bits (84), Expect = 0.24
 Identities = 17/52 (32%), Positives = 26/52 (50%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           C+FAH +  L+       YK+ +C +F   G C  G +C F H  E+ +  E
Sbjct: 80  CKFAHDIDTLKPSVHLATYKSTIC-SFWGKGKCFNGNKCRFAHGTEDMKTNE 130


>UniRef50_Q5KEY1 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 619

 Score = 37.9 bits (84), Expect = 0.24
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = +1

Query: 286 RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           R+ +    +KTE+C  + + G C YG  C F H  EE +
Sbjct: 277 RDREAMDAWKTEICAAWEATGRCRYGSSCQFAHGIEELK 315


>UniRef50_Q5D6A7 Cluster: Putative CCCH-type zinc finger
           transcription factor; n=1; Gossypium hirsutum|Rep:
           Putative CCCH-type zinc finger transcription factor -
           Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
          Length = 339

 Score = 37.5 bits (83), Expect = 0.31
 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 1/51 (1%)
 Frame = +1

Query: 247 WG*CQFAH-GVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           W  C FAH G +  R      +Y + +C  F   G CP G  C F H   E
Sbjct: 88  WTDCPFAHPGEKARRRDPTRYQYSSTICSDFRRGGGCPRGDDCEFAHGVFE 138


>UniRef50_A5K2J2 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium vivax|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 965

 Score = 37.5 bits (83), Expect = 0.31
 Identities = 17/49 (34%), Positives = 25/49 (51%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C +AH   EL++ Q    YK+ +C+ F +   C  G  C F H  +E R
Sbjct: 66  CNYAHNQEELKSAQNLFAYKSSMCK-FVANKTCLNGSTCRFAHTIDELR 113


>UniRef50_Q752S4 Cluster: Pre-mRNA-splicing factor CWC24; n=1;
           Eremothecium gossypii|Rep: Pre-mRNA-splicing factor
           CWC24 - Ashbya gossypii (Yeast) (Eremothecium gossypii)
          Length = 250

 Score = 37.5 bits (83), Expect = 0.31
 Identities = 11/31 (35%), Positives = 20/31 (64%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           Y+ ++C+ +   GFC YG  C F+H+ ++ R
Sbjct: 102 YQPDVCKDYRQTGFCGYGDSCKFLHSRDDFR 132


>UniRef50_UPI00006CD8B8 Cluster: ankyrin repeat protein; n=1;
           Tetrahymena thermophila SB210|Rep: ankyrin repeat
           protein - Tetrahymena thermophila SB210
          Length = 681

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +R  + K ++CR F   G C YG  C F HN +E
Sbjct: 176 KRTSQKKLKMCRQFVITGLCRYGQTCQFAHNIQE 209


>UniRef50_A7PC73 Cluster: Chromosome chr2 scaffold_11, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr2 scaffold_11, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 320

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 15/32 (46%), Positives = 21/32 (65%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +KT+LC  F + G CPY   C+F H+ +E RR
Sbjct: 82  FKTKLCCKFRA-GTCPYVTNCNFAHSIQELRR 112



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           YK   C+ F++   CPYG  C F+H+ E+++ RE
Sbjct: 156 YKGRHCKKFYTDEGCPYGDNCTFLHD-EQSKARE 188


>UniRef50_Q8IDB9 Cluster: Putative uncharacterized protein
           PF13_0314; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein PF13_0314 - Plasmodium
           falciparum (isolate 3D7)
          Length = 1005

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 17/49 (34%), Positives = 26/49 (53%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C +AH   EL++ Q    YK+ +C+ F +   C  G  C F H+ +E R
Sbjct: 66  CNYAHNQDELKSAQNLFAYKSSMCK-FVANKRCLNGATCRFAHSVDELR 113


>UniRef50_Q61F69 Cluster: Putative uncharacterized protein CBG11755;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG11755 - Caenorhabditis
           briggsae
          Length = 295

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +R   YKT LC ++   G+CPY   C + H  +E
Sbjct: 98  KRPSDYKTRLCDSYRRSGWCPYNTNCTYAHGDKE 131


>UniRef50_Q1JTE3 Cluster: Putative uncharacterized protein; n=1;
           Toxoplasma gondii RH|Rep: Putative uncharacterized
           protein - Toxoplasma gondii RH
          Length = 1146

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 19/49 (38%), Positives = 22/49 (44%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C +AH  RELR      K  T LC      G CP    C + H+A E R
Sbjct: 350 CVYAHSERELREPPNLEK--TRLCPVLKQTGACPNSDFCAYAHSAVELR 396



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           C +AH   ELR+      +KT++C  ++  G C  GP C   H  EE +R
Sbjct: 386 CAYAHSAVELRHTVT--VFKTKICHMWNK-GKCGAGPACRHAHGLEELKR 432


>UniRef50_A0DH98 Cluster: Chromosome undetermined scaffold_50, whole
           genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_50,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 453

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C F H  ++ +  + + +Y  ELC    S   CPYG  C+  HN  E
Sbjct: 105 CPFYHNAKDRK--RNNTQYSAELCAYIESNQQCPYGDNCNKAHNRVE 149


>UniRef50_A5DV06 Cluster: Pre-mRNA splicing factor CWC24; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Pre-mRNA
           splicing factor CWC24 - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 272

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 11/34 (32%), Positives = 23/34 (67%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           ++ ++C+ F   G+C YG  C F+H  +E+R+++
Sbjct: 126 FQPDVCKDFLQTGYCGYGDTCKFLHVRDESRQKK 159


>UniRef50_Q9ZWA1 Cluster: F11M21.28 protein; n=3; Arabidopsis
           thaliana|Rep: F11M21.28 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 393

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 1/51 (1%)
 Frame = +1

Query: 247 WG*CQFAH-GVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           W  C FAH G +  R   R  +Y  E+C  F   G C  G  C F H   E
Sbjct: 101 WTDCPFAHPGEKARRRDPRRFQYSGEVCPEFRRGGDCSRGDDCEFAHGVFE 151


>UniRef50_Q8ILK7 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium falciparum 3D7|Rep: Putative uncharacterized
           protein - Plasmodium falciparum (isolate 3D7)
          Length = 1781

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 17/47 (36%), Positives = 21/47 (44%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C FAHG  EL+       YKT +C+ +   G C  G  C   H   E
Sbjct: 245 CNFAHGEHELK--YTFGVYKTTICKHWKKNGMCSSGIHCRHAHGESE 289


>UniRef50_Q5CYT2 Cluster: 3CCCH domain containing protein; n=2;
           Cryptosporidium|Rep: 3CCCH domain containing protein -
           Cryptosporidium parvum Iowa II
          Length = 591

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 19/51 (37%), Positives = 24/51 (47%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           C FAHG  ELR    +  YKT +CR +     C  G  C   H   E R++
Sbjct: 147 CPFAHGTTELR--VTNDFYKTSVCRYWKMGVKCDAGVLCRHAHGEAELRKK 195



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = +1

Query: 295 QRHPKY-KTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           + H +Y KT+LC  F S G C  G  C F H +E+ R
Sbjct: 87  ESHNQYWKTKLCLMF-SKGACKNGDNCRFAHGSEDLR 122



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 19/49 (38%), Positives = 22/49 (44%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C+FAHG  +LR        KT+LC  F     C  G  C F H   E R
Sbjct: 112 CRFAHGSEDLRTPVN--LKKTKLC-PFWLSSACSIGENCPFAHGTTELR 157


>UniRef50_Q5CN43 Cluster: Asparagine-rich protein; n=2;
           Cryptosporidium|Rep: Asparagine-rich protein -
           Cryptosporidium hominis
          Length = 311

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 17/42 (40%), Positives = 23/42 (54%)
 Frame = +1

Query: 277 RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           R    L R   YKT++C  F++VG C  G  C F H+ +E R
Sbjct: 27  RNSSELVRRQLYKTKMC-AFYNVGKCTRGNLCAFAHSVQELR 67


>UniRef50_A0EHE0 Cluster: Chromosome undetermined scaffold_97, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_97,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 214

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C F H   E   ++     +T+ CR F S+G CP+G  C + H
Sbjct: 87  CSFIH---EPCRIENSASRRTKPCRCFFSMGVCPFGLNCQYAH 126



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           +  + +T+ CR F   G+C Y  +C F+H
Sbjct: 63  KRQQLRTKFCRNFQEKGYCQYKDKCSFIH 91


>UniRef50_A0BE14 Cluster: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 212

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHP-KYKTELCRTFHSVGFCPYGPRCHFVHN 387
           C F H   +  N        KT+ C+ + S GFC +GP+C F+HN
Sbjct: 71  CFFIHTPAKTENYSYSTASTKTKPCKRYFS-GFCCFGPKCQFLHN 114



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVH 384
           K K +LCR +   G C YG +C F+H
Sbjct: 50  KKKKDLCRNYQINGSCKYGDQCFFIH 75


>UniRef50_Q6CSS6 Cluster: Pre-mRNA-splicing factor CWC24; n=1;
           Kluyveromyces lactis|Rep: Pre-mRNA-splicing factor CWC24
           - Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 229

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ F   G+C YG  C F+H+ ++
Sbjct: 111 YQPDICKDFQKTGYCGYGDSCKFLHSRDD 139


>UniRef50_Q4S9W1 Cluster: Chromosome undetermined SCAF14694, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF14694, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 823

 Score = 36.3 bits (80), Expect = 0.72
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G CP GP C F H
Sbjct: 303 CQYCHTRTEQ---QFHPEIYKSTKCNDMQQCGSCPRGPFCAFAH 343


>UniRef50_Q39CY9 Cluster: Iron-sulfur cluster binding protein; n=40;
           Proteobacteria|Rep: Iron-sulfur cluster binding protein
           - Burkholderia sp. (strain 383) (Burkholderia cepacia
           (strain ATCC 17760/ NCIB 9086 / R18194))
          Length = 481

 Score = 36.3 bits (80), Expect = 0.72
 Identities = 28/96 (29%), Positives = 38/96 (39%)
 Frame = -3

Query: 612 AVGRLPDRGSSCGEKRKLWPVLVATSQVESEASMEMRRAWRSRPVAHIRRHRSAR*ERCQ 433
           A   LP   + CG   ++ PV +   Q+      E  R     PVAH  R + A   R +
Sbjct: 360 ATADLPTASTLCGACGEVCPVRIPIPQLLVRLRTEANRK-PDEPVAHPLRGQGANYNRAE 418

Query: 432 *TSWRRWFSASCFLCVMHEMATRSIRTEANRMESAT 325
              WR W  A       H  A R+ R  A R+ + T
Sbjct: 419 DLVWRFWSGA-----FAHPRAYRAFRWTATRLRALT 449


>UniRef50_Q4QFH0 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 215

 Score = 36.3 bits (80), Expect = 0.72
 Identities = 15/30 (50%), Positives = 16/30 (53%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           KYKT LC+ F     CPY  RC F H   E
Sbjct: 14  KYKTSLCQFFCKGEECPYAGRCAFAHGEHE 43


>UniRef50_A7RKQ0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 666

 Score = 36.3 bits (80), Expect = 0.72
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           C + H   E    Q HP+ YK+  C      G+CP GP C F H
Sbjct: 238 CPYCHTRTEQ---QFHPEIYKSTKCNDMQQTGYCPRGPFCAFAH 278


>UniRef50_Q6BYU0 Cluster: Pre-mRNA-splicing factor CWC24; n=2;
           Saccharomycetaceae|Rep: Pre-mRNA-splicing factor CWC24 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 232

 Score = 36.3 bits (80), Expect = 0.72
 Identities = 11/34 (32%), Positives = 22/34 (64%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           ++ ++C+ F   G+C YG  C F+H  +E ++R+
Sbjct: 113 FQPDVCKDFLQTGYCGYGDTCKFLHIRDELKQRK 146


>UniRef50_UPI00006CB748 Cluster: hypothetical protein TTHERM_00348140;
            n=1; Tetrahymena thermophila SB210|Rep: hypothetical
            protein TTHERM_00348140 - Tetrahymena thermophila SB210
          Length = 1997

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 17/41 (41%), Positives = 21/41 (51%)
 Frame = +1

Query: 274  VRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
            +RE R      K KT++C    + G CP G RC F H A E
Sbjct: 1359 LREKRLKVALRKVKTKMCSNILNNGVCPLGKRCRFAHWANE 1399


>UniRef50_Q8VX90 Cluster: Similarity to the EST C99174; n=1; Pinus
           pinaster|Rep: Similarity to the EST C99174 - Pinus
           pinaster (Maritime pine)
          Length = 80

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           YKT LC  F +   C +G +CHF H  +E
Sbjct: 4   YKTRLCSNFGTDTGCRFGDKCHFAHGEKE 32


>UniRef50_A7PMT7 Cluster: Chromosome chr14 scaffold_21, whole genome
           shotgun sequence; n=11; Viridiplantae|Rep: Chromosome
           chr14 scaffold_21, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 713

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           KT +CR F S G C  G +C + H  +E RR
Sbjct: 305 KTGICRYFESPGGCVRGAKCFYAHGEDELRR 335


>UniRef50_A7P7S0 Cluster: Chromosome chr9 scaffold_7, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr9 scaffold_7, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 696

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           K +LCR F     CPYG RC+F+H   E  R
Sbjct: 130 KMKLCRIFSRGEKCPYGERCNFLHEGFEKCR 160


>UniRef50_A5BYY2 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 316

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           K +LCR F     CPYG RC+F+H   E  R
Sbjct: 130 KMKLCRIFSRGEKCPYGERCNFLHEGFEKCR 160


>UniRef50_Q5CXF0 Cluster: 3CCCH domain containing protein; n=3;
           Cryptosporidium|Rep: 3CCCH domain containing protein -
           Cryptosporidium parvum Iowa II
          Length = 337

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 18/51 (35%), Positives = 25/51 (49%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           C++AH  +ELR       +KT LC  +   G C  G  C + H  EE R +
Sbjct: 66  CRYAHSRKELRATS--DLFKTSLC-VYWIKGSCVVGDSCRYAHGIEELRSK 113


>UniRef50_Q4DRR2 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 173

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 14/35 (40%), Positives = 18/35 (51%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           KY+T LC  +     CP+G RC F H   E +  E
Sbjct: 14  KYRTALCEFYLRQEECPFGTRCAFAHGEHELQTEE 48


>UniRef50_Q4CLW6 Cluster: Zinc finger protein 2, putative; n=4;
           Trypanosoma|Rep: Zinc finger protein 2, putative -
           Trypanosoma cruzi
          Length = 180

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = +1

Query: 277 RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           R  R + R  K KT++C      G C +G  C F HN+EE
Sbjct: 65  RVRRGIDR-TKLKTKMCMNIQRGGVCNWGDNCAFAHNSEE 103


>UniRef50_Q22VV7 Cluster: CHY zinc finger family protein; n=1;
           Tetrahymena thermophila SB210|Rep: CHY zinc finger
           family protein - Tetrahymena thermophila SB210
          Length = 953

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 3/36 (8%)
 Frame = +1

Query: 298 RHPKYKT---ELCRTFHSVGFCPYGPRCHFVHNAEE 396
           RH K K    +LC+ F   G C Y  +CHFVH A E
Sbjct: 179 RHGKVKVGLEKLCKLFLDQGKCKYDKKCHFVHMAME 214


>UniRef50_Q9C0B0 Cluster: RING finger protein unkempt homolog; n=21;
           Euteleostomi|Rep: RING finger protein unkempt homolog -
           Homo sapiens (Human)
          Length = 810

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G CP GP C F H
Sbjct: 278 CQYCHTRTEQ---QFHPEIYKSTKCNDMQQSGSCPRGPFCAFAH 318


>UniRef50_UPI00006CBF26 Cluster: hypothetical protein
           TTHERM_00310170; n=2; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00310170 - Tetrahymena
           thermophila SB210
          Length = 645

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%)
 Frame = +1

Query: 256 CQFAHGVRELRN----LQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C+FAH + ELRN     +  PKYK   C+  +        P+C + H+ +E R
Sbjct: 58  CKFAHDINELRNEDYKYESDPKYKEYQCKNLNCT-----RPKCKYYHDIKEKR 105


>UniRef50_Q802W8 Cluster: Unkempt homolog; n=4; Danio rerio|Rep:
           Unkempt homolog - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 737

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G CP GP C F H
Sbjct: 294 CQYCHTRTEQ---QFHPEIYKSTKCNDIQQSGNCPRGPFCAFAH 334


>UniRef50_Q7RIY4 Cluster: Zinc finger C-x8-C-x5-C-x3-H type,
           putative; n=3; Plasmodium (Vinckeia)|Rep: Zinc finger
           C-x8-C-x5-C-x3-H type, putative - Plasmodium yoelii
           yoelii
          Length = 959

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/52 (30%), Positives = 24/52 (46%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           C+FAH    L+       YK+ +C +F   G C  G +C F H   + +  E
Sbjct: 80  CKFAHDTETLKPSVHLATYKSTIC-SFWGKGKCFNGNKCRFAHGTNDIKANE 130


>UniRef50_A0C8C5 Cluster: Chromosome undetermined scaffold_158,
           whole genome shotgun sequence; n=3; cellular
           organisms|Rep: Chromosome undetermined scaffold_158,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 252

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 15/47 (31%), Positives = 22/47 (46%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C F H  ++ + +    +Y  ELC+       CPYG  C+  HN  E
Sbjct: 105 CPFFHNPKDRKRIG--VEYSAELCQYVDKNSICPYGDNCNRAHNRVE 149



 Score = 33.5 bits (73), Expect = 5.1
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTF-HSVGFCPYGPRCHFVHN 387
           C  AH    +  L R   YKT+ C  + H++  C YG  C F H+
Sbjct: 141 CNRAHN--RVEQLYRVDNYKTKFCSFYPHNIHQCDYGKFCSFAHS 183


>UniRef50_A0AR22 Cluster: UOS5/S1 protein; n=5; Plasmodium
           (Vinckeia)|Rep: UOS5/S1 protein - Plasmodium berghei
          Length = 389

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 18/49 (36%), Positives = 22/49 (44%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C +AHG+  L+       YKT LC  F     C    +C F H  EE R
Sbjct: 66  CAYAHGIENLQPSTNLSTYKTNLC-YFWKKKKCMNQWKCRFAHGIEEIR 113


>UniRef50_A2Q179 Cluster: Zinc finger, CCCH-type; n=1; Medicago
           truncatula|Rep: Zinc finger, CCCH-type - Medicago
           truncatula (Barrel medic)
          Length = 101

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 17/43 (39%), Positives = 21/43 (48%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C +AHG  +LR     P+    LCR F     C YG  C F+H
Sbjct: 34  CNYAHGYHDLRTATG-PR----LCRMFMHTRHCSYGNNCRFLH 71



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = +1

Query: 280 ELRNLQRHPKYKTELCRTFHSVGFCP-YGPRCHFVHNAEEAR 402
           E    Q H + KT+LCR F   G CP   P+C++ H   + R
Sbjct: 4   EAETSQTHMRIKTQLCRRFMQ-GTCPLVAPQCNYAHGYHDLR 44


>UniRef50_Q8I5U7 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium falciparum 3D7|Rep: Putative uncharacterized
           protein - Plasmodium falciparum (isolate 3D7)
          Length = 1000

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 16/52 (30%), Positives = 25/52 (48%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           C FAH +  L+       YK+ +C +F   G C  G +C F H  E+ +  +
Sbjct: 80  CTFAHDIDTLKPSVHLATYKSTIC-SFWGKGKCFNGNKCRFAHGNEDIKMND 130


>UniRef50_Q23GD6 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 272

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 14/30 (46%), Positives = 15/30 (50%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           KYKT LC+ F   G CP    C F H   E
Sbjct: 14  KYKTALCKHFSQTGNCPKKNECAFAHGEHE 43


>UniRef50_Q234F6 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 737

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           Q+  +YKT  CR F S G C  G +C+F H+ +E R
Sbjct: 280 QQQFRYKTHKCRHFLS-GNCTMGEKCNFAHSDKELR 314


>UniRef50_Q1RLF3 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 977

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 19/75 (25%), Positives = 40/75 (53%), Gaps = 2/75 (2%)
 Frame = +1

Query: 169 GSSATSHKSLQDRALPTV*RSGGL*IWG*CQFAHGVRELRNLQRH--PKYKTELCRTFHS 342
           G ++++H + ++R +    R G       C F+H     R+ + +  PK   ELC+ +++
Sbjct: 209 GVTSSAHSNNEERPVCKFFREGHCTKGDKCGFSHHKASHRSRREYSKPKKVMELCQ-YYA 267

Query: 343 VGFCPYGPRCHFVHN 387
            G C +G  C+++H+
Sbjct: 268 SGVCVHGDNCNYMHD 282


>UniRef50_A0CKZ8 Cluster: Chromosome undetermined scaffold_20, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_20,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 569

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           QR   YKT+ C  FHS   C  G  C+F+H++
Sbjct: 486 QRLRAYKTKHCHNFHSPIGCTRGDNCNFIHDS 517


>UniRef50_A5DFN2 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 245

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           ++ ++C+ F   G+C YG  C F+H  +E R +
Sbjct: 130 FQPDVCKDFLQTGYCGYGDTCKFLHIRDELRAK 162


>UniRef50_Q6CB23 Cluster: Pre-mRNA-splicing factor CWC24; n=1;
           Yarrowia lipolytica|Rep: Pre-mRNA-splicing factor CWC24
           - Yarrowia lipolytica (Candida lipolytica)
          Length = 256

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC YG  C F+H  E+
Sbjct: 132 YQPDVCKDYKLTGFCGYGDSCKFLHMRED 160


>UniRef50_A3HNF3 Cluster: Bacteriophage Lambda NinG family protein;
           n=3; Proteobacteria|Rep: Bacteriophage Lambda NinG
           family protein - Pseudomonas putida (strain GB-1)
          Length = 201

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 34/120 (28%), Positives = 56/120 (46%), Gaps = 5/120 (4%)
 Frame = +2

Query: 293 FSVILNTRRSC-VALSIRLAS-VLMDRVAISCITQRKQDAENHRRQEVHWHRSHRADLWR 466
           FS  + T++ C +A +  +A    + ++A   IT++K++    RR+++   R H A+   
Sbjct: 21  FSPTMTTQKVCSIACAKAMAKDPKLQKIAAKAITKQKREDLQERREKLKTRREHMAEAQT 80

Query: 467 RI*ATGRDRHARR--ISIDASLSTCDVATSTGHSFRFSPHELPRSGRRPTARF*P-TFHR 637
              A  R+R A    IS D+S S  D+ T +    R+        G  P  RF P   HR
Sbjct: 81  AFNAYIRERDAGLPCISCDSSPSDHDLITGS----RWDAGHYRSVGACPELRFEPLNVHR 136


>UniRef50_Q6YYB7 Cluster: Auxin transport protein-like protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Auxin
           transport protein-like protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 200

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 2/83 (2%)
 Frame = +2

Query: 245 YGDNAN-LLTASANYAIFSVILNTRRSCVALSIRLASVLMDRVAISCITQRKQDAENHR- 418
           YG+ A  L+ A   + +   +L  R++ + + +  AS   +  + S +T   +     R 
Sbjct: 117 YGEWAQQLVVAIVWFTLLLFVLEVRKAAIGMYVDGASSSDESSSSSTMTPASRGRRGQRW 176

Query: 419 RQEVHWHRSHRADLWRRI*ATGR 487
           R+ +H HR HR +  R+  A GR
Sbjct: 177 RRHIHGHRRHRGERRRQAVAVGR 199


>UniRef50_Q00XZ6 Cluster: Zinc finger; n=1; Ostreococcus tauri|Rep:
           Zinc finger - Ostreococcus tauri
          Length = 521

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHN 387
           YK ++C+ +   GFC +G  C F+H+
Sbjct: 191 YKPDICKDYKQTGFCGWGDACKFLHD 216


>UniRef50_A7PBS2 Cluster: Chromosome chr16 scaffold_10, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr16 scaffold_10, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 238

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 1/51 (1%)
 Frame = +1

Query: 247 WG*CQFAH-GVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           W  C FAH G +  R   R   Y    C  F +   CP G  C F H   E
Sbjct: 64  WTECPFAHRGEKAKRRDPRKVNYAAISCPDFRNGAECPRGEACEFAHGVFE 114


>UniRef50_Q4E4I1 Cluster: Putative uncharacterized protein; n=2;
            Trypanosoma cruzi|Rep: Putative uncharacterized protein -
            Trypanosoma cruzi
          Length = 1036

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +1

Query: 298  RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
            RHP+  T++   F S G C YG  C + H  + A R
Sbjct: 1000 RHPEGGTQMVCRFFSKGTCKYGEHCQYFHPPKNASR 1035


>UniRef50_A7SCD8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 208

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVH 384
           K  LCR F + G+C YG +C FVH
Sbjct: 14  KPTLCRYFSANGYCFYGDQCQFVH 37


>UniRef50_A0D1W1 Cluster: Chromosome undetermined scaffold_34, whole
           genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_34,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 263

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           YKT +CR F  +G C  G +C F H  +E R
Sbjct: 69  YKTSICRHFE-LGNCSIGEKCQFAHGQKELR 98


>UniRef50_Q96RZ1 Cluster: Unkempt-like protein; n=1; Homo
           sapiens|Rep: Unkempt-like protein - Homo sapiens (Human)
          Length = 756

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 12/27 (44%), Positives = 14/27 (51%)
 Frame = +1

Query: 304 PKYKTELCRTFHSVGFCPYGPRCHFVH 384
           P YK+  C      G+CP GP C F H
Sbjct: 471 PIYKSTKCNDMRQTGYCPRGPFCAFAH 497


>UniRef50_Q5KCP1 Cluster: Expressed protein; n=2; Filobasidiella
           neoformans|Rep: Expressed protein - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 912

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 14/27 (51%), Positives = 18/27 (66%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHN 387
           KYKT  C+ F + G CPYG  C F+H+
Sbjct: 382 KYKTVPCKDF-AEGHCPYGDYCSFLHD 407


>UniRef50_A1DBF2 Cluster: CCCH zinc finger protein; n=8;
           Eurotiomycetidae|Rep: CCCH zinc finger protein -
           Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 452

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHN 387
           K + ELC+ F S G C  GP C F+H+
Sbjct: 251 KKRNELCKRFTSTGACYKGPSCLFIHD 277


>UniRef50_Q5KB05 Cluster: Pre-mRNA-splicing factor CWC24; n=1;
           Filobasidiella neoformans|Rep: Pre-mRNA-splicing factor
           CWC24 - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 329

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHN 387
           Y+ ++C+ +   GFC YG  C F+H+
Sbjct: 178 YQPDVCKDYKETGFCGYGDSCKFLHD 203


>UniRef50_UPI000049839F Cluster: zinc finger protein; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: zinc finger protein -
           Entamoeba histolytica HM-1:IMSS
          Length = 178

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           +H      +C  F+ +GFCPYG +C FVH
Sbjct: 110 KHGHVPKLMCPLFY-LGFCPYGKKCKFVH 137


>UniRef50_Q4SJD9 Cluster: Chromosome 4 SCAF14575, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 4
           SCAF14575, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 176

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +1

Query: 325 CRTFHSVGFCPYGPRCHFVHNAEE 396
           CR F   G C YGP C F H +E+
Sbjct: 57  CRKFLQKGICDYGPNCRFSHMSEQ 80


>UniRef50_Q7XXI8 Cluster: OSJNBa0094O15.14 protein; n=3; Oryza
           sativa (japonica cultivar-group)|Rep: OSJNBa0094O15.14
           protein - Oryza sativa subsp. japonica (Rice)
          Length = 865

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 5/42 (11%)
 Frame = +1

Query: 298 RHPKYKTELCRTFH-----SVGFCPYGPRCHFVHNAEEARRR 408
           +HP +KT LC  F      S   C +G  C + H+ EE R R
Sbjct: 48  QHPMWKTSLCSFFRRRAASSADGCSHGDSCRYAHSEEELRPR 89


>UniRef50_Q3E8A4 Cluster: Uncharacterized protein At5g56900.1; n=9;
           Magnoliophyta|Rep: Uncharacterized protein At5g56900.1 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 404

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 14/25 (56%), Positives = 15/25 (60%)
 Frame = +1

Query: 319 ELCRTFHSVGFCPYGPRCHFVHNAE 393
           +LC  F   G CP G  CHF HNAE
Sbjct: 115 KLCFKFVCSGSCPRGEDCHFQHNAE 139


>UniRef50_A3A5V9 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 353

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = +1

Query: 277 RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           R    L     Y+ ++C+ +   G+C YG  C F+H+
Sbjct: 178 RRTSRLSARFDYQPDICKDYKETGYCGYGDSCKFMHD 214


>UniRef50_A2XPJ7 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 747

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 5/42 (11%)
 Frame = +1

Query: 298 RHPKYKTELCRTFH-----SVGFCPYGPRCHFVHNAEEARRR 408
           +HP +KT LC  F      S   C +G  C + H+ EE R R
Sbjct: 48  QHPMWKTSLCSFFRRRAASSADGCSHGDSCRYAHSEEELRPR 89


>UniRef50_A2WL87 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 702

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           YKT +C TF + G C +   C F H  EE R
Sbjct: 57  YKTRVCETFVTSGRCMFEDGCTFAHGDEELR 87


>UniRef50_Q8IJV8 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium falciparum 3D7|Rep: Putative uncharacterized
           protein - Plasmodium falciparum (isolate 3D7)
          Length = 372

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 18/49 (36%), Positives = 22/49 (44%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C++AH V  L+       YKT LC  F     C    +C F H  EE R
Sbjct: 70  CKYAHKVENLQPTTDMSTYKTSLC-YFWKRKKCMNEEKCRFAHGIEEIR 117


>UniRef50_Q381D1 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 510

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           + P Y   LC++F +   C +G RC F+H+
Sbjct: 123 KEPSYALYLCKSFSTNASCAHGDRCDFIHS 152


>UniRef50_A2QMD3 Cluster: Similarity to hypothetical protein
           CAC28841.2 - Neurospora crassa; n=1; Aspergillus
           niger|Rep: Similarity to hypothetical protein CAC28841.2
           - Neurospora crassa - Aspergillus niger
          Length = 554

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 19/45 (42%), Positives = 23/45 (51%)
 Frame = +2

Query: 485 RDRHARRISIDASLSTCDVATSTGHSFRFSPHELPRSGRRPTARF 619
           R   ARRI  D + + C   TSTG S  +  H LPR+    T RF
Sbjct: 26  RTCRARRIKCDETPNQCKNCTSTGRSCTYDIHRLPRAANN-TYRF 69


>UniRef50_Q6FXX1 Cluster: Pre-mRNA-splicing factor CWC24; n=1;
           Candida glabrata|Rep: Pre-mRNA-splicing factor CWC24 -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 226

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 9/29 (31%), Positives = 19/29 (65%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           ++ ++C+ F   G+C YG  C F+H+ ++
Sbjct: 108 FQPDVCKDFKQTGYCGYGDSCKFLHSRDD 136


>UniRef50_UPI00015B6140 Cluster: PREDICTED: similar to
           ENSANGP00000021479; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000021479 - Nasonia
           vitripennis
          Length = 367

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 204 YQPDICKDYKETGFCGFGDSCKFLHDRSD 232


>UniRef50_Q9FNG6 Cluster: Similarity to zinc finger protein; n=4;
           Magnoliophyta|Rep: Similarity to zinc finger protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 378

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 9/26 (34%), Positives = 17/26 (65%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHN 387
           Y+ ++C+ +   G+C YG  C F+H+
Sbjct: 236 YQPDICKDYKETGYCGYGDSCKFLHD 261


>UniRef50_Q84SL2 Cluster: CCCH-type zinc finger protein-like
           protein; n=3; Oryza sativa|Rep: CCCH-type zinc finger
           protein-like protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 657

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 2/53 (3%)
 Frame = +1

Query: 247 WG*CQFAHGVRELRNL--QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEA 399
           W  C F H     R    ++HP Y    C  F   G CP G  C F H   E+
Sbjct: 253 WTECPFVHPGENARRRDPRKHP-YTAVPCPNFRRPGGCPSGDSCEFSHGVFES 304


>UniRef50_Q8IZP6 Cluster: RING finger protein 113B; n=17;
           Mammalia|Rep: RING finger protein 113B - Homo sapiens
           (Human)
          Length = 322

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 191 YQPDICKDYKETGFCGFGDSCKFLHDRSD 219


>UniRef50_O15541 Cluster: RING finger protein 113A; n=32;
           Eumetazoa|Rep: RING finger protein 113A - Homo sapiens
           (Human)
          Length = 343

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 197 YQPDICKDYKETGFCGFGDSCKFLHDRSD 225


>UniRef50_Q06053 Cluster: tRNA-dihydrouridine synthase 3; n=6;
           Saccharomycetales|Rep: tRNA-dihydrouridine synthase 3 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 609

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 3/45 (6%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTEL---CRTFHSVGFCPYGPRCHFV 381
           C+F H +    + ++ P+ ++ +   C  F+S+GFCP G +C F+
Sbjct: 115 CRFVHDINLYLSTKK-PEVESNIFPSCPVFNSLGFCPMGFKCRFL 158


>UniRef50_Q9P6R8 Cluster: Pre-mRNA-splicing factor cwc24; n=1;
           Schizosaccharomyces pombe|Rep: Pre-mRNA-splicing factor
           cwc24 - Schizosaccharomyces pombe (Fission yeast)
          Length = 533

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 10/29 (34%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C YG  C F+H  E+
Sbjct: 185 YQPDVCKDYKLTGYCGYGDTCKFLHMRED 213


>UniRef50_Q6BTT1 Cluster: mRNA 3'-end-processing protein YTH1; n=8;
           Saccharomycetales|Rep: mRNA 3'-end-processing protein
           YTH1 - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 223

 Score = 27.1 bits (57), Expect(2) = 4.7
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = +1

Query: 304 PKYKTELCRTFHSVGFCPYGPRC 372
           P+ K   C ++   GFCP GP+C
Sbjct: 121 PQLKIPPCSSYEK-GFCPDGPKC 142



 Score = 25.4 bits (53), Expect(2) = 4.7
 Identities = 9/18 (50%), Positives = 10/18 (55%)
 Frame = +1

Query: 346 GFCPYGPRCHFVHNAEEA 399
           GFCP G  C + H   EA
Sbjct: 158 GFCPKGAECDYTHPRFEA 175


>UniRef50_Q5CWX9 Cluster: Yir323cp/Cwc24 p family; CCCH+ringfinger
           domains; n=3; Cryptosporidium|Rep: Yir323cp/Cwc24 p
           family; CCCH+ringfinger domains - Cryptosporidium parvum
           Iowa II
          Length = 311

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ F   G+C +G  C F+H+  +
Sbjct: 152 YQHDICKDFKETGYCGFGDTCKFLHDRSD 180


>UniRef50_Q4UDF1 Cluster: Zinc finger-like regulatory protein,
           putative; n=2; Theileria|Rep: Zinc finger-like
           regulatory protein, putative - Theileria annulata
          Length = 708

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C FAHG +ELR+      ++T +C  +   G C  G  C   H  EE
Sbjct: 633 CNFAHGKKELRS--TIGVWRTTICHHW-KTGVCRVGKDCRHAHGEEE 676


>UniRef50_Q4Q6T1 Cluster: Zinc finger-domain protein, putative; n=3;
           Leishmania|Rep: Zinc finger-domain protein, putative -
           Leishmania major
          Length = 266

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           KYKT +CR +   G C +   C F H  EE R
Sbjct: 60  KYKTTICRNWEQTGTCAF-RGCTFAHGVEELR 90


>UniRef50_A5K7A7 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium vivax|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 502

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 17/49 (34%), Positives = 23/49 (46%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           C++AH + +L+       YKT LC  F     C    +C F H  EE R
Sbjct: 78  CKYAHKIEKLQPSTDLATYKTTLC-YFWKKKKCMNQDKCRFAHGIEEIR 125


>UniRef50_Q96GM8 Cluster: Target of EGR1 protein 1; n=17;
           Euteleostomi|Rep: Target of EGR1 protein 1 - Homo
           sapiens (Human)
          Length = 510

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAE 393
           H  + T +C  F + G+CP GP+C   H+ +
Sbjct: 292 HRPHPTSICDNFSAYGWCPLGPQCPQSHDID 322


>UniRef50_UPI0000E46DA0 Cluster: PREDICTED: hypothetical protein
           isoform 1; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: hypothetical protein isoform 1 -
           Strongylocentrotus purpuratus
          Length = 1307

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +1

Query: 319 ELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           ++C+ +   G+C YG RC F H ++EA   E
Sbjct: 600 QVCKFYARSGWCSYGYRCRFSHVSKEAASNE 630


>UniRef50_UPI000051ACE9 Cluster: PREDICTED: similar to Roquin (RING
           finger and C3H zinc finger protein 1) isoform 2; n=1;
           Apis mellifera|Rep: PREDICTED: similar to Roquin (RING
           finger and C3H zinc finger protein 1) isoform 2 - Apis
           mellifera
          Length = 882

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = +1

Query: 304 PKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           PKYK  +CR     G CP    C F H+  E
Sbjct: 414 PKYKVSMCRDLALRGSCPRSTNCTFAHSDME 444


>UniRef50_Q9VZ55 Cluster: CG1582-PA; n=5; Diptera|Rep: CG1582-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 1288

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 11/20 (55%), Positives = 12/20 (60%)
 Frame = +1

Query: 325 CRTFHSVGFCPYGPRCHFVH 384
           CR F   G C YGP+C F H
Sbjct: 251 CRNFDRDGTCKYGPKCRFAH 270


>UniRef50_Q245H9 Cluster: Zinc finger protein; n=1; Tetrahymena
           thermophila SB210|Rep: Zinc finger protein - Tetrahymena
           thermophila SB210
          Length = 451

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 9/26 (34%), Positives = 16/26 (61%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHN 387
           Y   LC+ +H  G+C +G  C ++H+
Sbjct: 167 YDPSLCKDYHDTGYCVFGDSCLYLHD 192


>UniRef50_A7APX4 Cluster: Zinc finger C-x8-C-x5-C-x3-H type domain
           containing protein; n=1; Babesia bovis|Rep: Zinc finger
           C-x8-C-x5-C-x3-H type domain containing protein -
           Babesia bovis
          Length = 439

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           C FAHG +EL+       +KT LC  + + G C  G  C   H  EE
Sbjct: 313 CNFAHGKKELKGTV--GVWKTTLCHHWKN-GTCRIGIDCRHAHGEEE 356


>UniRef50_O17917 Cluster: Putative RING finger protein 113 homolog;
           n=2; Caenorhabditis|Rep: Putative RING finger protein
           113 homolog - Caenorhabditis elegans
          Length = 384

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +  ++C+ +   GFC +G  C FVH+  +
Sbjct: 176 FAPDICKDYKETGFCTFGDSCKFVHDRSD 204


>UniRef50_P53769 Cluster: Pre-mRNA-splicing factor CWC24; n=3;
           Saccharomycetaceae|Rep: Pre-mRNA-splicing factor CWC24 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 259

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 8/29 (27%), Positives = 19/29 (65%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           ++ ++C+ +   G+C YG  C F+H+ ++
Sbjct: 139 FQPDVCKDYKQTGYCGYGDSCKFLHSRDD 167


>UniRef50_UPI00004983E6 Cluster: hypothetical protein 134.t00005;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 134.t00005 - Entamoeba histolytica HM-1:IMSS
          Length = 222

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 11/57 (19%)
 Frame = +1

Query: 250 G*CQFAHGVRELRN---LQRHPK--------YKTELCRTFHSVGFCPYGPRCHFVHN 387
           G C F+H V  L N    Q++ K        Y+T+ C+ F   G C  G  C+F H+
Sbjct: 154 GSCTFSHDVSSLNNHSFCQQNSKQFVSVDKLYRTKPCKYFFETGVCRKGEHCNFSHD 210


>UniRef50_Q0P4U9 Cluster: Smad-interacting and CPSF-like protein;
           n=3; Xenopus tropicalis|Rep: Smad-interacting and
           CPSF-like protein - Xenopus tropicalis (Western clawed
           frog) (Silurana tropicalis)
          Length = 827

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +H K K E C  ++  G C  G  C F+H+ E+
Sbjct: 605 KHKKEKKEYCMYYNRFGKCNRGQNCPFIHDPEK 637


>UniRef50_A4RUZ0 Cluster: Predicted protein; n=3; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 212

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKT-ELCRTFHSVGFCPYGPRCHFVHNAEEA 399
           C+F+H      +       +T E C+   + G C +G RC + H A +A
Sbjct: 32  CRFSHDADASASASARASTETRERCKFVDAPGGCTFGDRCKYAHGASDA 80


>UniRef50_Q9VXP3 Cluster: CG8470-PA; n=2; Sophophora|Rep: CG8470-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 557

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
 Frame = +3

Query: 147 SNAPPVNRLL-RHQPQVATRPSSADRLKKRGFVNMGIMPICSRRPR 281
           +NAP + R +   QP VA+  S+ +  ++R F+N     + S RPR
Sbjct: 442 ANAPSIQRSIGEQQPYVASDVSAYENAEQRDFINKTFKYLASNRPR 487


>UniRef50_Q4QJI4 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 364

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           YKT LC+ F + G C  G +C+F H   E R+
Sbjct: 209 YKTRLCKGF-AEGHCNRGNQCNFAHGVGELRQ 239


>UniRef50_Q4DT82 Cluster: Zinc finger protein ZFP1; n=6;
           Trypanosoma|Rep: Zinc finger protein ZFP1 - Trypanosoma
           cruzi
          Length = 183

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           + K++T +CR +     CP+G RC F H
Sbjct: 103 YSKFRTRVCRNYSMGITCPFGERCAFSH 130


>UniRef50_A0ANM4 Cluster: CG4973 protein; n=12; Sophophora|Rep:
           CG4973 protein - Drosophila melanogaster (Fruit fly)
          Length = 357

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223


>UniRef50_A1DB46 Cluster: CCCH zinc finger protein; n=5;
           Trichocomaceae|Rep: CCCH zinc finger protein -
           Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 693

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           K ++CR F   G C +G +CHF+H   E
Sbjct: 586 KKKVCRHFARNGRCLHGEKCHFLHELPE 613


>UniRef50_Q5FVR7 Cluster: Cleavage and polyadenylation specificity
           factor subunit 4; n=25; Amniota|Rep: Cleavage and
           polyadenylation specificity factor subunit 4 - Rattus
           norvegicus (Rat)
          Length = 243

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 292 LQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           L RH   +  +C  +  VGFCP GP C F+H
Sbjct: 137 LCRHRHTRRVICVNY-LVGFCPEGPSCKFMH 166


>UniRef50_Q8BQZ5 Cluster: Cleavage and polyadenylation specificity
           factor subunit 4; n=6; Theria|Rep: Cleavage and
           polyadenylation specificity factor subunit 4 - Mus
           musculus (Mouse)
          Length = 211

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 292 LQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           L RH   +  +C  +  VGFCP GP C F+H
Sbjct: 105 LCRHRHTRRVICVNY-LVGFCPEGPSCKFMH 134


>UniRef50_O95639 Cluster: Cleavage and polyadenylation specificity
           factor subunit 4; n=13; Euteleostomi|Rep: Cleavage and
           polyadenylation specificity factor subunit 4 - Homo
           sapiens (Human)
          Length = 269

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 292 LQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           L RH   +  +C  +  VGFCP GP C F+H
Sbjct: 137 LCRHRHTRRVICVNY-LVGFCPEGPSCKFMH 166


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 675,870,190
Number of Sequences: 1657284
Number of extensions: 13329400
Number of successful extensions: 51801
Number of sequences better than 10.0: 234
Number of HSP's better than 10.0 without gapping: 47653
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51660
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55371905986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).