SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0004
         (598 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B63E8 Cluster: PREDICTED: hypothetical protein;...    36   0.55 

>UniRef50_UPI00015B63E8 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 1379

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%)
 Frame = +2

Query: 236 LFRASERDHXXAANSIMGIXVENIX-PHIHWXPQLIDGILKYGDRV 370
           LF+   RD   AA++++ +    +  PH+ W PQ++D ILK  D++
Sbjct: 437 LFKKESRDRQQAASALVALATTKLFDPHL-WYPQVLDDILKMADKL 481



 Score = 32.3 bits (70), Expect = 8.9
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +2

Query: 239  FRASERDHXXAANSIMGIXVENIXPHIHWXPQLIDGILKYGDRVXT 376
            + +  R     A S + I V ++     W P+L+D  LKYGD + T
Sbjct: 1193 YPSENRGLQSCAISAVAIVVSSLHAPSSWTPELLDACLKYGDLLHT 1238


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 388,072,164
Number of Sequences: 1657284
Number of extensions: 5506507
Number of successful extensions: 20085
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 18261
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20045
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41902926763
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).