SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0002
         (598 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q86PF4 Cluster: CG10126-PB, isoform B; n=7; Endopterygo...   130   3e-29
UniRef50_Q9VG26 Cluster: CG31345-PA; n=2; Sophophora|Rep: CG3134...   119   5e-26
UniRef50_Q09JT7 Cluster: Ca2+ calmodulin dependent protein kinas...   103   4e-21
UniRef50_Q8WWF8 Cluster: Calcyphosin-like protein; n=44; Metazoa...   101   2e-20
UniRef50_Q13938 Cluster: Calcyphosin; n=12; Mammalia|Rep: Calcyp...    94   3e-18
UniRef50_P80363 Cluster: Crustacean calcium-binding protein 23; ...    88   2e-16
UniRef50_UPI00006CF2C6 Cluster: EF hand family protein; n=1; Tet...    84   2e-15
UniRef50_A7STK5 Cluster: Predicted protein; n=1; Nematostella ve...    82   1e-14
UniRef50_A2FWD1 Cluster: EF hand family protein; n=3; Trichomona...    76   7e-13
UniRef50_A2FG26 Cluster: EF hand family protein; n=1; Trichomona...    70   5e-11
UniRef50_A0DZQ3 Cluster: Chromosome undetermined scaffold_70, wh...    60   3e-08
UniRef50_A0DEN6 Cluster: Chromosome undetermined scaffold_48, wh...    58   2e-07
UniRef50_A0CFH1 Cluster: Chromosome undetermined scaffold_175, w...    57   4e-07
UniRef50_Q22X58 Cluster: Protein kinase domain containing protei...    56   5e-07
UniRef50_A0DGM2 Cluster: Chromosome undetermined scaffold_5, who...    51   2e-05
UniRef50_P80364 Cluster: Crustacean calcium-binding protein 23; ...    51   2e-05
UniRef50_Q240R2 Cluster: EF hand family protein; n=1; Tetrahymen...    50   5e-05
UniRef50_Q9S9V0 Cluster: T19J18.7 protein; n=1; Arabidopsis thal...    49   7e-05
UniRef50_UPI0001509EB8 Cluster: EF hand family protein; n=1; Tet...    49   1e-04
UniRef50_A7RUF3 Cluster: Predicted protein; n=1; Nematostella ve...    49   1e-04
UniRef50_A0C6P4 Cluster: Chromosome undetermined scaffold_153, w...    49   1e-04
UniRef50_Q38869 Cluster: Calcium-dependent protein kinase 4; n=9...    48   1e-04
UniRef50_A0E0J1 Cluster: Chromosome undetermined scaffold_71, wh...    48   2e-04
UniRef50_Q0DH47 Cluster: Os05g0491900 protein; n=2; Oryza sativa...    48   2e-04
UniRef50_A7SXE5 Cluster: Predicted protein; n=1; Nematostella ve...    48   2e-04
UniRef50_UPI000049A060 Cluster: calmodulin-like protein; n=1; En...    47   3e-04
UniRef50_Q22H23 Cluster: EF hand family protein; n=1; Tetrahymen...    47   3e-04
UniRef50_A7SW85 Cluster: Predicted protein; n=2; Nematostella ve...    47   3e-04
UniRef50_A0CDT9 Cluster: Chromosome undetermined scaffold_17, wh...    47   3e-04
UniRef50_Q8MYK0 Cluster: Calcium-dependent protein kinase; n=1; ...    47   4e-04
UniRef50_Q9NZT1 Cluster: Calmodulin-like protein 5; n=11; Euther...    47   4e-04
UniRef50_Q9ZSA3 Cluster: T4B21.12 protein; n=1; Arabidopsis thal...    46   5e-04
UniRef50_Q06850 Cluster: Calcium-dependent protein kinase isofor...    46   5e-04
UniRef50_UPI00006CE935 Cluster: EF hand family protein; n=1; Tet...    46   7e-04
UniRef50_A0BRM8 Cluster: Chromosome undetermined scaffold_123, w...    46   7e-04
UniRef50_UPI00015B625F Cluster: PREDICTED: similar to CG18076-PB...    45   0.001
UniRef50_UPI0000E481D4 Cluster: PREDICTED: similar to Calcyphosp...    45   0.001
UniRef50_Q5CUC1 Cluster: Protein with 2x EF hands and 4 transmem...    45   0.001
UniRef50_A0D261 Cluster: Chromosome undetermined scaffold_35, wh...    45   0.001
UniRef50_A0C2U6 Cluster: Chromosome undetermined scaffold_145, w...    45   0.001
UniRef50_A0BYZ7 Cluster: Chromosome undetermined scaffold_138, w...    45   0.001
UniRef50_P05095 Cluster: Alpha-actinin, non-muscular; n=2; Dicty...    45   0.001
UniRef50_Q38871 Cluster: Calmodulin-domain protein kinase CDPK i...    45   0.002
UniRef50_A7QBM6 Cluster: Chromosome chr1 scaffold_75, whole geno...    45   0.002
UniRef50_Q24FR9 Cluster: Protein kinase domain containing protei...    45   0.002
UniRef50_A0BJ86 Cluster: Chromosome undetermined scaffold_11, wh...    45   0.002
UniRef50_P04630 Cluster: Calmodulin-like protein; n=6; Caenorhab...    45   0.002
UniRef50_Q2KN25 Cluster: Calcium-binding protein; n=1; Ambrosia ...    44   0.002
UniRef50_A3C8D9 Cluster: Putative uncharacterized protein; n=3; ...    44   0.002
UniRef50_A7SJS6 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.002
UniRef50_A0CC00 Cluster: Chromosome undetermined scaffold_166, w...    44   0.002
UniRef50_UPI00006CA862 Cluster: metallo-beta-lactamase superfami...    44   0.003
UniRef50_A7PY61 Cluster: Chromosome chr15 scaffold_37, whole gen...    44   0.003
UniRef50_Q23CW2 Cluster: EF hand family protein; n=1; Tetrahymen...    44   0.003
UniRef50_A0E9C3 Cluster: Chromosome undetermined scaffold_84, wh...    44   0.003
UniRef50_Q27YT9 Cluster: Radial spoke protein 7; n=1; Chlamydomo...    44   0.004
UniRef50_A7SIU0 Cluster: Predicted protein; n=2; Nematostella ve...    43   0.005
UniRef50_A7RUF2 Cluster: Predicted protein; n=2; Nematostella ve...    43   0.005
UniRef50_A0E1G4 Cluster: Chromosome undetermined scaffold_73, wh...    43   0.005
UniRef50_Q11083 Cluster: Uncharacterized calcium-binding protein...    43   0.005
UniRef50_Q9S744 Cluster: Calmodulin-like protein 9; n=1; Arabido...    43   0.005
UniRef50_Q8MR19 Cluster: LD39385p; n=4; Diptera|Rep: LD39385p - ...    43   0.006
UniRef50_A1Z9J3 Cluster: CG18076-PH, isoform H; n=12; Drosophila...    43   0.006
UniRef50_A0EHG9 Cluster: Chromosome undetermined scaffold_97, wh...    43   0.006
UniRef50_A0CDD7 Cluster: Chromosome undetermined scaffold_17, wh...    43   0.006
UniRef50_A3IMP0 Cluster: Cyclic nucleotide-binding domain (CNMP-...    42   0.008
UniRef50_P06495 Cluster: Calerythrin; n=3; Actinomycetales|Rep: ...    42   0.008
UniRef50_UPI000150A956 Cluster: Protein kinase domain containing...    42   0.011
UniRef50_A2DPU6 Cluster: EF hand family protein; n=1; Trichomona...    42   0.011
UniRef50_A2DDP0 Cluster: EF hand family protein; n=1; Trichomona...    42   0.011
UniRef50_A0BWN9 Cluster: Chromosome undetermined scaffold_132, w...    42   0.011
UniRef50_Q1EAW9 Cluster: Putative uncharacterized protein; n=1; ...    42   0.011
UniRef50_A1AR61 Cluster: Putative signal transduction protein wi...    42   0.015
UniRef50_Q9U4D6 Cluster: Putative uncharacterized protein; n=1; ...    42   0.015
UniRef50_Q230X5 Cluster: EF hand family protein; n=3; Tetrahymen...    42   0.015
UniRef50_O18058 Cluster: Putative uncharacterized protein cal-4;...    42   0.015
UniRef50_Q26678 Cluster: Flagellar calcium-binding protein TB-44...    42   0.015
UniRef50_A7RQT6 Cluster: Predicted protein; n=1; Nematostella ve...    41   0.019
UniRef50_A2DY15 Cluster: EF hand family protein; n=1; Trichomona...    41   0.019
UniRef50_A2D7G5 Cluster: EF hand family protein; n=1; Trichomona...    41   0.019
UniRef50_A0CZX7 Cluster: Chromosome undetermined scaffold_32, wh...    41   0.019
UniRef50_UPI0000E4A62F Cluster: PREDICTED: similar to calmodulin...    41   0.025
UniRef50_Q4SJD8 Cluster: Chromosome 4 SCAF14575, whole genome sh...    41   0.025
UniRef50_Q89IG0 Cluster: Bll5679 protein; n=5; Bradyrhizobiaceae...    41   0.025
UniRef50_Q014Q8 Cluster: Calcineurin B regulatory subunit; n=4; ...    41   0.025
UniRef50_Q5C1W3 Cluster: SJCHGC08066 protein; n=1; Schistosoma j...    41   0.025
UniRef50_A2FZT8 Cluster: EF hand family protein; n=1; Trichomona...    41   0.025
UniRef50_UPI000150A831 Cluster: EF hand family protein; n=1; Tet...    40   0.034
UniRef50_Q2RQD4 Cluster: Predicted signal transduction protein c...    40   0.034
UniRef50_Q00ZY9 Cluster: Serine/threonine protein phosphatase; n...    40   0.034
UniRef50_Q9NF73 Cluster: EG:BACR7A4.12 protein; n=7; Endopterygo...    40   0.034
UniRef50_Q5DES8 Cluster: SJCHGC04850 protein; n=1; Schistosoma j...    40   0.034
UniRef50_Q235N6 Cluster: Protein kinase domain containing protei...    40   0.034
UniRef50_P34368 Cluster: Uncharacterized calcium-binding protein...    40   0.034
UniRef50_Q1VKV7 Cluster: Putative uncharacterized protein; n=1; ...    40   0.044
UniRef50_A4RZC3 Cluster: Predicted protein; n=2; Ostreococcus|Re...    40   0.044
UniRef50_Q240Z4 Cluster: Protein kinase domain containing protei...    40   0.044
UniRef50_Q236L3 Cluster: EF hand family protein; n=1; Tetrahymen...    40   0.044
UniRef50_A7RUR7 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.044
UniRef50_A7RJ74 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.044
UniRef50_A0D1T5 Cluster: Chromosome undetermined scaffold_34, wh...    40   0.044
UniRef50_A0CKX5 Cluster: Chromosome undetermined scaffold_20, wh...    40   0.044
UniRef50_A0BQR4 Cluster: Chromosome undetermined scaffold_121, w...    40   0.044
UniRef50_Q0KHU5 Cluster: 1-acylglycerophosphocholine O-acyltrans...    40   0.044
UniRef50_Q4SWQ4 Cluster: Chromosome 12 SCAF13545, whole genome s...    40   0.059
UniRef50_A7P1W7 Cluster: Chromosome chr19 scaffold_4, whole geno...    40   0.059
UniRef50_Q581Q7 Cluster: Putative uncharacterized protein; n=2; ...    40   0.059
UniRef50_Q235P0 Cluster: Protein kinase domain containing protei...    40   0.059
UniRef50_A0CNP3 Cluster: Chromosome undetermined scaffold_22, wh...    40   0.059
UniRef50_A0BZC3 Cluster: Chromosome undetermined scaffold_139, w...    40   0.059
UniRef50_P35085 Cluster: Calcium-binding protein; n=3; Eukaryota...    40   0.059
UniRef50_Q4RTY6 Cluster: Chromosome 12 SCAF14996, whole genome s...    39   0.078
UniRef50_A7E3L7 Cluster: Predicted NADPH oxidase-5; n=2; Tetraod...    39   0.078
UniRef50_Q86SC6 Cluster: Notochord specific gene 8 protein; n=1;...    39   0.078
UniRef50_A4VDW8 Cluster: Calcium-dependent protein kinase; n=1; ...    39   0.078
UniRef50_A0BMU8 Cluster: Chromosome undetermined scaffold_117, w...    39   0.078
UniRef50_Q27178 Cluster: Caltractin ICL1C; n=16; Eukaryota|Rep: ...    39   0.078
UniRef50_UPI0000F1F9F5 Cluster: PREDICTED: hypothetical protein;...    39   0.10 
UniRef50_UPI00006CAF3B Cluster: EF hand family protein; n=1; Tet...    39   0.10 
UniRef50_UPI0000585160 Cluster: PREDICTED: similar to GA22070-PA...    39   0.10 
UniRef50_A3B3I3 Cluster: Putative uncharacterized protein; n=1; ...    39   0.10 
UniRef50_A7SXT1 Cluster: Predicted protein; n=2; Nematostella ve...    39   0.10 
UniRef50_A7SF35 Cluster: Predicted protein; n=1; Nematostella ve...    39   0.10 
UniRef50_A0E7Y2 Cluster: Chromosome undetermined scaffold_82, wh...    39   0.10 
UniRef50_A0CW38 Cluster: Chromosome undetermined scaffold_3, who...    39   0.10 
UniRef50_A0C3Q6 Cluster: Chromosome undetermined scaffold_147, w...    39   0.10 
UniRef50_A7EAC5 Cluster: Putative uncharacterized protein; n=1; ...    39   0.10 
UniRef50_P15159 Cluster: Troponin C; n=10; Arthropoda|Rep: Tropo...    39   0.10 
UniRef50_Q07167 Cluster: 16 kDa calcium-binding protein; n=2; Sc...    39   0.10 
UniRef50_P41208 Cluster: Centrin-2; n=113; Eukaryota|Rep: Centri...    39   0.10 
UniRef50_UPI00004990CD Cluster: EF-hand calcium binding protein;...    38   0.14 
UniRef50_Q9ZSA0 Cluster: T4B21.15 protein; n=1; Arabidopsis thal...    38   0.14 
UniRef50_Q9SDM4 Cluster: Calcium-dependent protein kinase; n=2; ...    38   0.14 
UniRef50_Q0JI08 Cluster: Os01g0832300 protein; n=7; Magnoliophyt...    38   0.14 
UniRef50_Q01GB2 Cluster: Ca2+ binding protein, contains EF-hand ...    38   0.14 
UniRef50_Q4QIT3 Cluster: Putative uncharacterized protein; n=3; ...    38   0.14 
UniRef50_Q3I4V9 Cluster: Putative calcium-dependant protein kina...    38   0.14 
UniRef50_Q24DL4 Cluster: Protein kinase domain containing protei...    38   0.14 
UniRef50_A0CNQ2 Cluster: Chromosome undetermined scaffold_22, wh...    38   0.14 
UniRef50_A0C1X6 Cluster: Chromosome undetermined scaffold_143, w...    38   0.14 
UniRef50_Q7S0X6 Cluster: Putative uncharacterized protein NCU069...    38   0.14 
UniRef50_Q59YC3 Cluster: Mitochondrial carrier family and EF han...    38   0.14 
UniRef50_A6RJY2 Cluster: Putative uncharacterized protein; n=2; ...    38   0.14 
UniRef50_P32930 Cluster: Oncomodulin; n=11; Euteleostomi|Rep: On...    38   0.14 
UniRef50_Q9BXU9 Cluster: Calneuron-1; n=31; Euteleostomi|Rep: Ca...    38   0.14 
UniRef50_Q9D6P8 Cluster: Calmodulin-like protein 3; n=640; Eukar...    38   0.14 
UniRef50_UPI0000D66B4F Cluster: PREDICTED: similar to Calcyphosp...    38   0.18 
UniRef50_Q9LUQ0 Cluster: Similarity to; n=18; Magnoliophyta|Rep:...    38   0.18 
UniRef50_Q4QI25 Cluster: Putative uncharacterized protein; n=6; ...    38   0.18 
UniRef50_Q23YC0 Cluster: EF hand family protein; n=1; Tetrahymen...    38   0.18 
UniRef50_Q5THR3 Cluster: DJ-1-binding protein; n=29; Euteleostom...    38   0.18 
UniRef50_Q9NJU9 Cluster: Calcium-dependent protein kinase 3; n=6...    38   0.18 
UniRef50_UPI0000E4A189 Cluster: PREDICTED: similar to dystonin; ...    38   0.24 
UniRef50_UPI0000D9C1D1 Cluster: PREDICTED: similar to Calmodulin...    38   0.24 
UniRef50_Q4RQA7 Cluster: Chromosome 17 SCAF15006, whole genome s...    38   0.24 
UniRef50_Q4KMH6 Cluster: Zgc:110594; n=4; Clupeocephala|Rep: Zgc...    38   0.24 
UniRef50_Q9LRN6 Cluster: Genomic DNA, chromosome 3, P1 clone:MUJ...    38   0.24 
UniRef50_A7PHF4 Cluster: Chromosome chr17 scaffold_16, whole gen...    38   0.24 
UniRef50_A2X9B1 Cluster: Putative uncharacterized protein; n=3; ...    38   0.24 
UniRef50_Q9GN70 Cluster: Troponin C; n=1; Perinereis vancaurica ...    38   0.24 
UniRef50_Q23G85 Cluster: Protein kinase domain containing protei...    38   0.24 
UniRef50_Q20358 Cluster: Putative uncharacterized protein; n=2; ...    38   0.24 
UniRef50_Q0E8F2 Cluster: CG32103-PA, isoform A; n=7; Endopterygo...    38   0.24 
UniRef50_A7SZ62 Cluster: Predicted protein; n=2; Nematostella ve...    38   0.24 
UniRef50_A0BE66 Cluster: Chromosome undetermined scaffold_101, w...    38   0.24 
UniRef50_Q5TBT1 Cluster: Dystonin; n=33; Euteleostomi|Rep: Dysto...    38   0.24 
UniRef50_Q6CGC2 Cluster: Similar to tr|O74435 Schizosaccharomyce...    38   0.24 
UniRef50_P51879 Cluster: Oncomodulin; n=4; Mammalia|Rep: Oncomod...    38   0.24 
UniRef50_Q96PK2 Cluster: Microtubule-actin cross-linking factor ...    38   0.24 
UniRef50_Q9QXZ0 Cluster: Microtubule-actin cross-linking factor ...    38   0.24 
UniRef50_Q9UPN3 Cluster: Microtubule-actin cross-linking factor ...    38   0.24 
UniRef50_P27482 Cluster: Calmodulin-like protein 3; n=476; cellu...    38   0.24 
UniRef50_O94833 Cluster: Bullous pemphigoid antigen 1, isoforms ...    38   0.24 
UniRef50_Q91ZU6 Cluster: Bullous pemphigoid antigen 1, isoforms ...    38   0.24 
UniRef50_UPI00006CFB88 Cluster: Phosphatidylinositol-specific ph...    37   0.31 
UniRef50_UPI00006CBAA5 Cluster: EF hand family protein; n=1; Tet...    37   0.31 
UniRef50_UPI00006CAFC4 Cluster: Protein kinase domain containing...    37   0.31 
UniRef50_UPI00005A0143 Cluster: PREDICTED: similar to Calmodulin...    37   0.31 
UniRef50_UPI000058509B Cluster: PREDICTED: similar to Calmodulin...    37   0.31 
UniRef50_Q9F6V9 Cluster: Calsymin; n=3; Rhizobium|Rep: Calsymin ...    37   0.31 
UniRef50_Q22DL9 Cluster: EF hand family protein; n=1; Tetrahymen...    37   0.31 
UniRef50_A7SEX3 Cluster: Predicted protein; n=1; Nematostella ve...    37   0.31 
UniRef50_A7S3W3 Cluster: Predicted protein; n=1; Nematostella ve...    37   0.31 
UniRef50_Q5AK12 Cluster: Putative uncharacterized protein CNB1; ...    37   0.31 
UniRef50_P25071 Cluster: Calmodulin-related protein 3, touch-ind...    37   0.31 
UniRef50_P25070 Cluster: Calmodulin-related protein 2, touch-ind...    37   0.31 
UniRef50_Q9Y2I6 Cluster: Ninein-like protein; n=10; Eutheria|Rep...    37   0.31 
UniRef50_O15865 Cluster: Calcium-dependent protein kinase 2; n=2...    37   0.31 
UniRef50_UPI000156019D Cluster: PREDICTED: similar to KIAA0980 p...    37   0.41 
UniRef50_UPI0000E49932 Cluster: PREDICTED: similar to LOC553519 ...    37   0.41 
UniRef50_Q4RRW1 Cluster: Chromosome 7 SCAF15001, whole genome sh...    37   0.41 
UniRef50_Q9FPM8 Cluster: JD1; n=4; core eudicotyledons|Rep: JD1 ...    37   0.41 
UniRef50_Q8T378 Cluster: SCBP3 protein; n=3; Lumbricus terrestri...    37   0.41 
UniRef50_Q8IJC7 Cluster: Centrin, putative; n=1; Plasmodium falc...    37   0.41 
UniRef50_Q6A1M7 Cluster: Caltractin; n=1; Euplotes vannus|Rep: C...    37   0.41 
UniRef50_Q4X2G4 Cluster: Centrin, putative; n=3; Plasmodium (Vin...    37   0.41 
UniRef50_Q18136 Cluster: Unidentified vitellogenin-linked transc...    37   0.41 
UniRef50_A7S2Y1 Cluster: Predicted protein; n=1; Nematostella ve...    37   0.41 
UniRef50_A5K9U4 Cluster: Centrin, putative; n=11; Eukaryota|Rep:...    37   0.41 
UniRef50_A2EF97 Cluster: EF hand family protein; n=1; Trichomona...    37   0.41 
UniRef50_Q7S5W4 Cluster: Putative uncharacterized protein NCU098...    37   0.41 
UniRef50_P09226 Cluster: 25 kDa calcium-binding protein (TCBP-25...    37   0.41 
UniRef50_UPI0000F1F4FE Cluster: PREDICTED: similar to phospholip...    36   0.55 
UniRef50_UPI00006CD8F2 Cluster: HELP domain containing protein; ...    36   0.55 
UniRef50_UPI00006A2EFC Cluster: Microtubule-actin cross-linking ...    36   0.55 
UniRef50_A1KBM7 Cluster: Putative calcium binding protein; n=1; ...    36   0.55 
UniRef50_Q6DUX2 Cluster: Regulator of gene silencing; n=4; core ...    36   0.55 
UniRef50_Q4QCJ3 Cluster: Calmodulin-like protein; n=3; Leishmani...    36   0.55 
UniRef50_O17068 Cluster: Putative uncharacterized protein; n=3; ...    36   0.55 
UniRef50_A0DN99 Cluster: Chromosome undetermined scaffold_57, wh...    36   0.55 
UniRef50_A0BVG6 Cluster: Chromosome undetermined scaffold_13, wh...    36   0.55 
UniRef50_Q2UPN8 Cluster: Predicted protein; n=3; Eurotiomycetida...    36   0.55 
UniRef50_Q09665 Cluster: Troponin C, isoform 2; n=2; Caenorhabdi...    36   0.55 
UniRef50_P54670 Cluster: Calfumirin-1; n=2; Dictyostelium discoi...    36   0.55 
UniRef50_UPI00006CC451 Cluster: Protein kinase domain containing...    36   0.72 
UniRef50_P90802 Cluster: Putative uncharacterized protein; n=5; ...    36   0.72 
UniRef50_O45209 Cluster: Calmodulin-like protein; n=3; Eukaryota...    36   0.72 
UniRef50_A4VE20 Cluster: Centrin; n=3; Eukaryota|Rep: Centrin - ...    36   0.72 
UniRef50_A0DGC5 Cluster: Chromosome undetermined scaffold_5, who...    36   0.72 
UniRef50_P35622 Cluster: Troponin C; n=4; Mollusca|Rep: Troponin...    36   0.72 
UniRef50_P63316 Cluster: Troponin C, slow skeletal and cardiac m...    36   0.72 
UniRef50_P36609 Cluster: Neuronal calcium sensor 2; n=6; Bilater...    36   0.72 
UniRef50_Q8L3R2 Cluster: Calmodulin-like protein 41; n=4; core e...    36   0.72 
UniRef50_UPI00015B4DD0 Cluster: PREDICTED: similar to CG17765-PA...    36   0.96 
UniRef50_UPI00006D004E Cluster: EF hand family protein; n=1; Tet...    36   0.96 
UniRef50_UPI00006CE58E Cluster: EF hand family protein; n=1; Tet...    36   0.96 
UniRef50_Q6W3E0 Cluster: Skin calmodulin-related protein 2; n=2;...    36   0.96 
UniRef50_Q54NH0 Cluster: Putative uncharacterized protein; n=1; ...    36   0.96 
UniRef50_A2FU76 Cluster: EF hand family protein; n=1; Trichomona...    36   0.96 
UniRef50_A0BU82 Cluster: Chromosome undetermined scaffold_129, w...    36   0.96 
UniRef50_Q6C6B6 Cluster: Similar to DEHA0A11253g Debaryomyces ha...    36   0.96 
UniRef50_A4RJY1 Cluster: Calmodulin, putative; n=1; Magnaporthe ...    36   0.96 
UniRef50_A4RF57 Cluster: Putative uncharacterized protein; n=1; ...    36   0.96 
UniRef50_P14202 Cluster: Tegument antigen (I(H)A); n=11; Schisto...    36   0.96 
UniRef50_P04571 Cluster: Sarcoplasmic calcium-binding protein; n...    36   0.96 
UniRef50_O64943 Cluster: Polcalcin Jun o 2; n=2; Cupressaceae|Re...    36   0.96 
UniRef50_O75340 Cluster: Programmed cell death protein 6; n=31; ...    36   0.96 
UniRef50_P30187 Cluster: 22 kDa calmodulin-like calcium-binding ...    36   0.96 
UniRef50_UPI00015B5597 Cluster: PREDICTED: similar to calmodulin...    35   1.3  
UniRef50_UPI0001509F5B Cluster: EF hand family protein; n=1; Tet...    35   1.3  
UniRef50_UPI0000E800D1 Cluster: PREDICTED: similar to cardiac mu...    35   1.3  
UniRef50_UPI00006CD585 Cluster: Protein kinase domain containing...    35   1.3  
UniRef50_Q4RJ45 Cluster: Chromosome 1 SCAF15039, whole genome sh...    35   1.3  
UniRef50_Q8RLY3 Cluster: Calmodulin; n=16; cellular organisms|Re...    35   1.3  
UniRef50_Q1D9Y7 Cluster: EF hand domain protein; n=1; Myxococcus...    35   1.3  
UniRef50_A6DN05 Cluster: Putative uncharacterized protein; n=1; ...    35   1.3  
UniRef50_Q5CTY5 Cluster: Calcium/calmodulin dependent protein ki...    35   1.3  
UniRef50_Q4QG09 Cluster: EF hand-like protein; n=1; Leishmania m...    35   1.3  
UniRef50_Q3SDW4 Cluster: Calmodulin 5-1; n=2; Paramecium tetraur...    35   1.3  
UniRef50_P91328 Cluster: Paralysed arrest at two-fold protein 10...    35   1.3  
UniRef50_A0CT50 Cluster: Chromosome undetermined scaffold_27, wh...    35   1.3  
UniRef50_P15845 Cluster: 20 kDa calcium-binding protein; n=3; Bi...    35   1.3  
UniRef50_P38505 Cluster: Calcium-binding protein; n=3; Entamoeba...    35   1.3  
UniRef50_UPI0000E81621 Cluster: PREDICTED: similar to centrosoma...    35   1.7  
UniRef50_UPI0000E4A701 Cluster: PREDICTED: similar to NADPH oxid...    35   1.7  
UniRef50_UPI0000E4996B Cluster: PREDICTED: similar to Chromosome...    35   1.7  
UniRef50_UPI00006CFA8B Cluster: Protein kinase domain containing...    35   1.7  
UniRef50_Q47NZ2 Cluster: Calcium-binding EF-hand; n=1; Thermobif...    35   1.7  
UniRef50_Q2N8D7 Cluster: Putative uncharacterized protein; n=1; ...    35   1.7  
UniRef50_Q8LKW8 Cluster: Calmodulin-like protein 1; n=4; Medicag...    35   1.7  
UniRef50_Q9U3Z8 Cluster: Actinin-like protein; n=3; Entamoeba hi...    35   1.7  
UniRef50_Q5DBX4 Cluster: SJCHGC01267 protein; n=2; Schistosoma j...    35   1.7  
UniRef50_Q55DH9 Cluster: Putative uncharacterized protein; n=1; ...    35   1.7  
UniRef50_Q23TZ4 Cluster: EF hand family protein; n=1; Tetrahymen...    35   1.7  
UniRef50_A3FQ16 Cluster: Calmodulin-domain protein kinase 1, put...    35   1.7  
UniRef50_A2G550 Cluster: EF hand family protein; n=2; Trichomona...    35   1.7  
UniRef50_A2ERW3 Cluster: EF hand family protein; n=2; Trichomona...    35   1.7  
UniRef50_A2DNC2 Cluster: Centrin, putative; n=5; Eukaryota|Rep: ...    35   1.7  
UniRef50_A0BEK0 Cluster: Chromosome undetermined scaffold_102, w...    35   1.7  
UniRef50_Q873L5 Cluster: Putative uncharacterized protein B18E6....    35   1.7  
UniRef50_Q0UJB8 Cluster: Putative uncharacterized protein; n=1; ...    35   1.7  
UniRef50_Q92736 Cluster: Ryanodine receptor 2; n=40; cellular or...    35   1.7  
UniRef50_O15182 Cluster: Centrin-3; n=24; Eukaryota|Rep: Centrin...    35   1.7  
UniRef50_P48451 Cluster: Calcineurin subunit B isoform 1; n=10; ...    35   1.7  
UniRef50_Q8TD86 Cluster: Calmodulin-like protein 6; n=4; Eutheri...    35   1.7  
UniRef50_UPI0000D55918 Cluster: PREDICTED: similar to CG32699-PA...    34   2.2  
UniRef50_UPI00006CFA89 Cluster: EF hand family protein; n=1; Tet...    34   2.2  
UniRef50_UPI00004999B6 Cluster: EF-hand calcium binding protein;...    34   2.2  
UniRef50_Q4SU80 Cluster: Chromosome 5 SCAF13976, whole genome sh...    34   2.2  
UniRef50_Q4SGE6 Cluster: Chromosome 17 SCAF14597, whole genome s...    34   2.2  
UniRef50_Q9C8Y1 Cluster: Calmodulin-related protein; 72976-72503...    34   2.2  
UniRef50_Q011E6 Cluster: Nuclear pore complex component; n=3; Os...    34   2.2  
UniRef50_Q6DN51 Cluster: NCS-1/frequenin-related protein; n=2; D...    34   2.2  
UniRef50_Q5DA51 Cluster: SJCHGC06047 protein; n=1; Schistosoma j...    34   2.2  
UniRef50_Q564H1 Cluster: Putative calcium binding protein precur...    34   2.2  
UniRef50_Q54KZ5 Cluster: Putative uncharacterized protein; n=1; ...    34   2.2  
UniRef50_Q4QG08 Cluster: Programmed cell death 6 protein-like pr...    34   2.2  
UniRef50_Q4Q2W1 Cluster: Centrin, putative; n=19; Eukaryota|Rep:...    34   2.2  
UniRef50_Q24I95 Cluster: EF hand family protein; n=1; Tetrahymen...    34   2.2  
UniRef50_Q248B0 Cluster: Protein kinase domain containing protei...    34   2.2  
UniRef50_Q23K94 Cluster: EF hand family protein; n=1; Tetrahymen...    34   2.2  
UniRef50_A7SEL4 Cluster: Predicted protein; n=1; Nematostella ve...    34   2.2  
UniRef50_A0E0N7 Cluster: Chromosome undetermined scaffold_72, wh...    34   2.2  
UniRef50_A0DZF8 Cluster: Chromosome undetermined scaffold_70, wh...    34   2.2  
UniRef50_A0BVW8 Cluster: Chromosome undetermined scaffold_130, w...    34   2.2  
UniRef50_A0BUI0 Cluster: Chromosome undetermined scaffold_129, w...    34   2.2  
UniRef50_Q4KWH8 Cluster: Phospholipase C eta 1; n=45; Tetrapoda|...    34   2.2  
UniRef50_Q4PG53 Cluster: Putative uncharacterized protein; n=1; ...    34   2.2  
UniRef50_O14830 Cluster: Serine/threonine-protein phosphatase wi...    34   2.2  
UniRef50_Q9M8U1 Cluster: Calmodulin-like protein 18; n=7; Magnol...    34   2.2  
UniRef50_P42322 Cluster: Calcineurin subunit B; n=3; Eukaryota|R...    34   2.2  
UniRef50_UPI0001552F4D Cluster: PREDICTED: similar to calmodulin...    34   2.9  
UniRef50_UPI00006CFDC6 Cluster: EF hand family protein; n=1; Tet...    34   2.9  
UniRef50_UPI0000E4CFA4 Cluster: UPI0000E4CFA4 related cluster; n...    34   2.9  
UniRef50_Q9L1E1 Cluster: SCO5464 protein; n=3; Streptomyces|Rep:...    34   2.9  
UniRef50_Q747Z4 Cluster: EF hand domain protein; n=1; Geobacter ...    34   2.9  
UniRef50_Q3K8G8 Cluster: Predicted signal transduction protein c...    34   2.9  
UniRef50_Q9LI84 Cluster: Calmodulin-like protein; n=10; Magnolio...    34   2.9  
UniRef50_Q7XQX1 Cluster: OSJNBa0014K14.4 protein; n=12; Magnolio...    34   2.9  
UniRef50_Q7QVX3 Cluster: GLP_160_24117_24659; n=1; Giardia lambl...    34   2.9  
UniRef50_Q675T7 Cluster: 4930403C08Rik protein-like protein; n=1...    34   2.9  
UniRef50_Q60HV5 Cluster: Centrin 1; n=2; Paramecium|Rep: Centrin...    34   2.9  
UniRef50_Q5DBG1 Cluster: SJCHGC00558 protein; n=1; Schistosoma j...    34   2.9  
UniRef50_Q5D9U2 Cluster: SJCHGC01571 protein; n=1; Schistosoma j...    34   2.9  
UniRef50_Q57YA6 Cluster: Putative uncharacterized protein; n=1; ...    34   2.9  
UniRef50_A7T4H4 Cluster: Predicted protein; n=2; Nematostella ve...    34   2.9  
UniRef50_A7SIU1 Cluster: Predicted protein; n=2; Nematostella ve...    34   2.9  
UniRef50_A7RFS3 Cluster: Predicted protein; n=2; Nematostella ve...    34   2.9  
UniRef50_A2DZ78 Cluster: Centrin, putative; n=1; Trichomonas vag...    34   2.9  
UniRef50_A2R899 Cluster: Similarity to hypothetical protein SPAC...    34   2.9  
UniRef50_Q8N7U6 Cluster: EF-hand domain-containing family member...    34   2.9  
UniRef50_Q9M9V8 Cluster: Calcium-dependent protein kinase 10; n=...    34   2.9  
UniRef50_UPI000023E56B Cluster: hypothetical protein FG09391.1; ...    33   3.9  
UniRef50_UPI00006A1BA0 Cluster: DJ-1-binding protein (CAP-bindin...    33   3.9  
UniRef50_Q5CZN4 Cluster: LOC553519 protein; n=3; Danio rerio|Rep...    33   3.9  
UniRef50_Q2SLY2 Cluster: Protein containing EF hand domain; n=1;...    33   3.9  
UniRef50_A4ABH3 Cluster: Calmodulin-like protein; n=1; Congregib...    33   3.9  
UniRef50_A0W4T3 Cluster: Calcium-binding EF-hand; n=1; Geobacter...    33   3.9  
UniRef50_Q9LX27 Cluster: Calmodulin-like protein; n=6; core eudi...    33   3.9  
UniRef50_Q9FIH9 Cluster: Similarity to calmodulin; n=2; Arabidop...    33   3.9  
UniRef50_Q012A2 Cluster: Homology to unknown gene; n=3; Ostreoco...    33   3.9  
UniRef50_A7PVQ5 Cluster: Chromosome chr8 scaffold_34, whole geno...    33   3.9  
UniRef50_A2Y5Z9 Cluster: Putative uncharacterized protein; n=2; ...    33   3.9  
UniRef50_Q9U7P3 Cluster: Calcium/calmodulin-dependent protein ki...    33   3.9  
UniRef50_Q5Y1E3 Cluster: Calcium-dependent protein kinase; n=1; ...    33   3.9  
UniRef50_Q4N591 Cluster: Calcium-dependent protein kinase, putat...    33   3.9  
UniRef50_A0EIR6 Cluster: Chromosome undetermined scaffold_99, wh...    33   3.9  
UniRef50_A0E0N1 Cluster: Chromosome undetermined scaffold_72, wh...    33   3.9  
UniRef50_A1CT20 Cluster: EF hand domain protein; n=5; Trichocoma...    33   3.9  
UniRef50_Q94743 Cluster: Sorcin; n=5; Schistosoma japonicum|Rep:...    33   3.9  
UniRef50_UPI00015B4B31 Cluster: PREDICTED: similar to glucosidas...    33   5.1  
UniRef50_UPI0000E49154 Cluster: PREDICTED: similar to calcyphosi...    33   5.1  
UniRef50_Q6DRB4 Cluster: DKFZp586G0123-like; n=3; Danio rerio|Re...    33   5.1  
UniRef50_Q4KME0 Cluster: Zgc:112232; n=6; Clupeocephala|Rep: Zgc...    33   5.1  
UniRef50_Q7MRA8 Cluster: Putative uncharacterized protein; n=1; ...    33   5.1  
UniRef50_Q2IXI0 Cluster: Calcium-binding EF-hand protein precurs...    33   5.1  
UniRef50_O65644 Cluster: Calcium-dependent serine/threonine prot...    33   5.1  
UniRef50_Q9GSV7 Cluster: URE3-BP sequence specific DNA binding p...    33   5.1  
UniRef50_Q558Z5 Cluster: EF-hand domain-containing protein; n=2;...    33   5.1  
UniRef50_Q4U8S4 Cluster: Putative uncharacterized protein; n=1; ...    33   5.1  
UniRef50_Q24FW1 Cluster: CAF1 family ribonuclease containing pro...    33   5.1  
UniRef50_Q23FR5 Cluster: Protein kinase domain containing protei...    33   5.1  
UniRef50_Q23017 Cluster: Calumenin-like protein; n=3; Caenorhabd...    33   5.1  
UniRef50_A7RRG8 Cluster: Predicted protein; n=1; Nematostella ve...    33   5.1  
UniRef50_A0DL98 Cluster: Chromosome undetermined scaffold_55, wh...    33   5.1  
UniRef50_A0CR43 Cluster: Chromosome undetermined scaffold_25, wh...    33   5.1  
UniRef50_Q5KKK6 Cluster: Mitochondrial inner membrane protein, p...    33   5.1  
UniRef50_Q4X1L2 Cluster: Serine/threonine protein kinase; n=7; E...    33   5.1  
UniRef50_A6RDT7 Cluster: Putative uncharacterized protein; n=1; ...    33   5.1  
UniRef50_O35385 Cluster: Serine/threonine-protein phosphatase wi...    33   5.1  
UniRef50_P37235 Cluster: Hippocalcin-like protein 1; n=143; Fung...    33   5.1  
UniRef50_P54680 Cluster: Fimbrin; n=2; Dictyostelium discoideum|...    33   5.1  
UniRef50_UPI0001556340 Cluster: PREDICTED: similar to golgi auto...    33   6.7  
UniRef50_UPI0000F21775 Cluster: PREDICTED: similar to calcium/ca...    33   6.7  
UniRef50_UPI0000E45FE2 Cluster: PREDICTED: hypothetical protein;...    33   6.7  
UniRef50_UPI0000D8E4DC Cluster: DJ-1-binding protein (CAP-bindin...    33   6.7  
UniRef50_A6YEF9 Cluster: Putative uncharacterized protein; n=1; ...    33   6.7  
UniRef50_A4CWG8 Cluster: Arginase; n=1; Synechococcus sp. WH 780...    33   6.7  
UniRef50_Q9SZ45 Cluster: Putative uncharacterized protein F10N7....    33   6.7  
UniRef50_Q2R1Z5 Cluster: Calmodulin-2/3/5, putative; n=2; Oryza ...    33   6.7  
UniRef50_A7P9I7 Cluster: Chromosome chr3 scaffold_8, whole genom...    33   6.7  
UniRef50_A7P2Z1 Cluster: Chromosome chr1 scaffold_5, whole genom...    33   6.7  
UniRef50_A4S568 Cluster: Predicted protein; n=1; Ostreococcus lu...    33   6.7  
UniRef50_A5PKC6 Cluster: LOC785287 protein; n=6; Laurasiatheria|...    33   6.7  
UniRef50_Q9VMT2 Cluster: CG6514-PA; n=7; Drosophila|Rep: CG6514-...    33   6.7  
UniRef50_Q8IHA0 Cluster: AT23738p; n=4; Drosophila melanogaster|...    33   6.7  
UniRef50_Q7YSU4 Cluster: PC20A; n=2; Plasmodium (Vinckeia)|Rep: ...    33   6.7  
UniRef50_Q5DFV5 Cluster: SJCHGC05612 protein; n=1; Schistosoma j...    33   6.7  
UniRef50_Q4N248 Cluster: Protein kinase, putative; n=2; Theileri...    33   6.7  
UniRef50_Q383Y5 Cluster: Putative uncharacterized protein; n=3; ...    33   6.7  
UniRef50_A7RNB7 Cluster: Predicted protein; n=1; Nematostella ve...    33   6.7  
UniRef50_A7RKN8 Cluster: Predicted protein; n=1; Nematostella ve...    33   6.7  
UniRef50_A4V9Q6 Cluster: Calmodulin-like protein 2; n=1; Fasciol...    33   6.7  
UniRef50_A2DJI5 Cluster: EF hand family protein; n=1; Trichomona...    33   6.7  
UniRef50_A0DXA6 Cluster: Chromosome undetermined scaffold_68, wh...    33   6.7  
UniRef50_A0DIQ6 Cluster: Chromosome undetermined scaffold_52, wh...    33   6.7  
UniRef50_A0D293 Cluster: Chromosome undetermined scaffold_35, wh...    33   6.7  
UniRef50_A0CPP6 Cluster: Chromosome undetermined scaffold_23, wh...    33   6.7  
UniRef50_A6SEA0 Cluster: Putative uncharacterized protein; n=1; ...    33   6.7  
UniRef50_A6RXS9 Cluster: Putative uncharacterized protein; n=2; ...    33   6.7  
UniRef50_A4R444 Cluster: Predicted protein; n=1; Magnaporthe gri...    33   6.7  
UniRef50_P47948 Cluster: Troponin C, isoform 2; n=32; Neoptera|R...    33   6.7  
UniRef50_Q8IZ41 Cluster: RAS and EF-hand domain-containing prote...    33   6.7  
UniRef50_UPI000150A1D4 Cluster: Protein kinase domain containing...    32   8.9  
UniRef50_UPI0000F2C01C Cluster: PREDICTED: similar to viral A-ty...    32   8.9  
UniRef50_UPI0000E476C7 Cluster: PREDICTED: similar to Calmodulin...    32   8.9  
UniRef50_UPI00006D008E Cluster: EF hand family protein; n=1; Tet...    32   8.9  
UniRef50_UPI00006CFCC2 Cluster: EF hand family protein; n=1; Tet...    32   8.9  
UniRef50_Q4S884 Cluster: Chromosome 3 SCAF14707, whole genome sh...    32   8.9  
UniRef50_Q2GB85 Cluster: Calcium-binding EF-hand protein precurs...    32   8.9  
UniRef50_A6G1Y9 Cluster: Putative uncharacterized protein; n=1; ...    32   8.9  
UniRef50_Q9SRE6 Cluster: Putative calmodulin; 4214-3681; n=4; Ar...    32   8.9  
UniRef50_A2YGG7 Cluster: Putative uncharacterized protein; n=2; ...    32   8.9  
UniRef50_Q9VDT8 Cluster: CG4662-PA, isoform A; n=9; Endopterygot...    32   8.9  
UniRef50_Q4F6Z0 Cluster: AmphiCaBP-like protein; n=1; Branchiost...    32   8.9  
UniRef50_Q09IV5 Cluster: Troponin C type IIIa-like protein; n=3;...    32   8.9  
UniRef50_A7E3L8 Cluster: Predicted NADPH oxidase; n=3; Endoptery...    32   8.9  
UniRef50_A2DT12 Cluster: EF hand family protein; n=1; Trichomona...    32   8.9  
UniRef50_A0DX72 Cluster: Chromosome undetermined scaffold_68, wh...    32   8.9  
UniRef50_A0DS75 Cluster: Chromosome undetermined scaffold_61, wh...    32   8.9  
UniRef50_A0DNH6 Cluster: Chromosome undetermined scaffold_58, wh...    32   8.9  
UniRef50_A0CPJ3 Cluster: Chromosome undetermined scaffold_23, wh...    32   8.9  
UniRef50_A0CLM7 Cluster: Chromosome undetermined scaffold_20, wh...    32   8.9  
UniRef50_A0C4D5 Cluster: Chromosome undetermined scaffold_149, w...    32   8.9  
UniRef50_A0BND2 Cluster: Chromosome undetermined scaffold_118, w...    32   8.9  
UniRef50_A1CUP3 Cluster: Calcium sensor (NCS-1), putative; n=17;...    32   8.9  
UniRef50_P82978 Cluster: Calhepatin; n=1; Lepidosiren paradoxa|R...    32   8.9  
UniRef50_Q3SB10 Cluster: Calglandulin; n=12; Amniota|Rep: Calgla...    32   8.9  

>UniRef50_Q86PF4 Cluster: CG10126-PB, isoform B; n=7;
           Endopterygota|Rep: CG10126-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 227

 Score =  130 bits (313), Expect = 3e-29
 Identities = 65/117 (55%), Positives = 87/117 (74%), Gaps = 4/117 (3%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           RLLCLSRGA+GILGLGR FR MDDDGSK LN+EEF+ GI++TGL++++ E +++F+ FD 
Sbjct: 48  RLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDE 107

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL----*NKHSRSLTRLVTVQSQLMTLKGVYSV 593
           D SGSI++ EFL+K+RPPM +SR  +     NK  R    ++T+Q     LK VYSV
Sbjct: 108 DGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQD----LKNVYSV 160


>UniRef50_Q9VG26 Cluster: CG31345-PA; n=2; Sophophora|Rep:
           CG31345-PA - Drosophila melanogaster (Fruit fly)
          Length = 213

 Score =  119 bits (287), Expect = 5e-26
 Identities = 60/113 (53%), Positives = 77/113 (68%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           RL C SRGA+GILGL R FR MDDDGSK L+ EEF  G+ + GL+L  SE +E+FS+FDT
Sbjct: 34  RLQCFSRGATGILGLSRSFRVMDDDGSKSLSPEEFKKGVTDIGLDLTDSEIDEMFSRFDT 93

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYSV 593
           D SG+I++ EFL+K+RPPM+ SR  +  K    +      Q  +  LK VYSV
Sbjct: 94  DGSGNINMTEFLVKLRPPMNNSRISIIEKAFDKMDANGDGQITVTDLKNVYSV 146


>UniRef50_Q09JT7 Cluster: Ca2+ calmodulin dependent protein kinase
           EF-Hand protein superfamily; n=2; Arthropoda|Rep: Ca2+
           calmodulin dependent protein kinase EF-Hand protein
           superfamily - Argas monolakensis
          Length = 252

 Score =  103 bits (246), Expect = 4e-21
 Identities = 57/115 (49%), Positives = 73/115 (63%), Gaps = 2/115 (1%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLE--LNKSEAEELFSQF 428
           R LCL RG++GILGL R FRRMDD+GS  L++EEF  G+ +TGL   L   + + LF+QF
Sbjct: 72  RQLCLQRGSTGILGLRRAFRRMDDNGSGDLSREEFRKGLDDTGLGGFLEDGDYDALFAQF 131

Query: 429 DTDSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYSV 593
           D D SG+I LDEF+  +RP MS +R+ L  K    L R    Q      +GVYSV
Sbjct: 132 DADRSGTIKLDEFIRAVRPHMSPARQALVLKAFEKLDRSGDGQVTFEDFRGVYSV 186


>UniRef50_Q8WWF8 Cluster: Calcyphosin-like protein; n=44;
           Metazoa|Rep: Calcyphosin-like protein - Homo sapiens
           (Human)
          Length = 198

 Score =  101 bits (241), Expect = 2e-20
 Identities = 47/112 (41%), Positives = 75/112 (66%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           RL CL+RG++GI GLGR+FR MDDD ++ L+ +EF+ G+ +  + + K E EELF +FD 
Sbjct: 20  RLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDK 79

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           D +G+I  +EFL+ +RPPMS +R+++  +  R L +       +  L+ VY+
Sbjct: 80  DGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYN 131


>UniRef50_Q13938 Cluster: Calcyphosin; n=12; Mammalia|Rep:
           Calcyphosin - Homo sapiens (Human)
          Length = 189

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 49/112 (43%), Positives = 72/112 (64%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R  CLSRGASGI GL R FR++D DGS+ L+ +EF  G+ + GL L+++EAE +  ++D 
Sbjct: 12  RAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDR 71

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           + SG++ L+EFL  +RPPMS++R  +       L R       +  L+GVYS
Sbjct: 72  NGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYS 123


>UniRef50_P80363 Cluster: Crustacean calcium-binding protein 23;
           n=1; Orconectes limosus|Rep: Crustacean calcium-binding
           protein 23 - Orconectes limosus (Spinycheek crayfish)
          Length = 202

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 45/109 (41%), Positives = 65/109 (59%)
 Frame = +3

Query: 264 CLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           CLS+G SG+L LGR+FRR+D D S  L+KEE   G+ + GL+L+  +  +LFS F+ D  
Sbjct: 27  CLSQGYSGLLSLGRLFRRLDKDRSWTLSKEELSRGVGQFGLDLSDGDINKLFSSFEKDGQ 86

Query: 444 GSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
             I+ +EFL  +RP M+E R+K      + L +       L  +KG YS
Sbjct: 87  SGINYEEFLESLRPEMTEPRKKAVEAAFKHLDKTGDGVVGLEDIKGKYS 135


>UniRef50_UPI00006CF2C6 Cluster: EF hand family protein; n=1;
           Tetrahymena thermophila SB210|Rep: EF hand family
           protein - Tetrahymena thermophila SB210
          Length = 1011

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 43/107 (40%), Positives = 67/107 (62%)
 Frame = +3

Query: 270 SRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGS 449
           SRGA+GILG+ R F+  DDD S+ L+ +EF   +K+  +EL++ E +++F  FD +    
Sbjct: 194 SRGATGILGIARQFKIFDDDNSRTLDIQEFTKAVKDFRVELSEQEIQDVFDYFDRNRDNV 253

Query: 450 ISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           I+ DEFL+ IR PMS+SRRKL  +    L +  +    +  +KG Y+
Sbjct: 254 INYDEFLLGIRGPMSQSRRKLVQQAFAILDKDGSGIVDINDIKGTYN 300



 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 36/81 (44%), Positives = 51/81 (62%)
 Frame = +3

Query: 270  SRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGS 449
            SRG  GIL LGR++R +DDDG++ +N  EF    K+  + LN+ +  +LF  FD D SGS
Sbjct: 830  SRGTRGILSLGRLYRIIDDDGNRSINFNEFSKVCKDLRVGLNEQQVAQLFKLFDRDGSGS 889

Query: 450  ISLDEFLIKIRPPMSESRRKL 512
            I  DEF+  +R  M++ R  L
Sbjct: 890  IDYDEFIRAVRGSMNKFRLDL 910



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 33/107 (30%), Positives = 57/107 (53%)
 Frame = +3

Query: 270 SRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGS 449
           +RG SG+LG+ R FR MDD+  K ++  EF   + +  + L   E + LF   D + +G 
Sbjct: 496 TRGTSGLLGIQRQFRIMDDNFDKCISYPEFRKAMNDYKMNLTDEEMQALFQYIDMNGNGV 555

Query: 450 ISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           I +DE +  ++  M++ RR L ++    + +       +  +KGVYS
Sbjct: 556 IEIDELVRNLQGEMNDFRRGLVDQAFNKIDKNKDGTLTVNDIKGVYS 602



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = +2

Query: 509 IVEQAFKKLDKTGDGAITIDDIKGCLLCRF 598
           +V+QAF  LDK G G + I+DIKG    +F
Sbjct: 274 LVQQAFAILDKDGSGIVDINDIKGTYNAKF 303


>UniRef50_A7STK5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 192

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 42/106 (39%), Positives = 62/106 (58%)
 Frame = +3

Query: 273 RGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSI 452
           RG  GI   GR FR  DDDG++ LN +EF  G+++ G +L   E ++LF+QFD D SGS+
Sbjct: 37  RGTCGIKMFGRAFRIFDDDGNRALNIDEFRKGMQDFGTKLTDDEVKQLFAQFDKDGSGSL 96

Query: 453 SLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
             +EFL  +RP MS++R ++  K    +         +  LK VY+
Sbjct: 97  DFEEFLRAVRPSMSKNRVEIIMKAFHKMDTTGDGVITIADLKKVYN 142


>UniRef50_A2FWD1 Cluster: EF hand family protein; n=3; Trichomonas
           vaginalis G3|Rep: EF hand family protein - Trichomonas
           vaginalis G3
          Length = 200

 Score = 75.8 bits (178), Expect = 7e-13
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query: 267 LSRGASGILGLGRIFRRMDDDGSKLLN-KEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           + RGA GI G+GR+FR  DDD +K+++ K E    + + G+ LNK+E  EL    D++ +
Sbjct: 27  VERGAVGIKGIGRLFRIADDDNNKIIDLKNELPKLMNDIGVILNKTELNELIRLLDSNGN 86

Query: 444 GSISLDEFLIKIRPPMSESRRKL*NK 521
           G+I  DEFL ++ PPM+E R K  NK
Sbjct: 87  GTIDYDEFLYQMAPPMNEERIKWCNK 112


>UniRef50_A2FG26 Cluster: EF hand family protein; n=1; Trichomonas
           vaginalis G3|Rep: EF hand family protein - Trichomonas
           vaginalis G3
          Length = 190

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 36/85 (42%), Positives = 54/85 (63%), Gaps = 1/85 (1%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLN-KEEFLYGIKETGLELNKSEAEELFSQFD 431
           R   +SRG++GI GLGR+FR  DD+G + ++ K EF   + + G+ LNK+E  EL    D
Sbjct: 17  RAKIISRGSTGIQGLGRLFRIADDNGDRKIDLKNEFPKLMGDIGVLLNKAEIAELGVLLD 76

Query: 432 TDSSGSISLDEFLIKIRPPMSESRR 506
            +  GSI  DEF+  + PPM+ +R+
Sbjct: 77  RNGDGSIDFDEFVFYLGPPMNAARQ 101


>UniRef50_A0DZQ3 Cluster: Chromosome undetermined scaffold_70, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_70,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 482

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 27/77 (35%), Positives = 46/77 (59%)
 Frame = +3

Query: 273 RGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSI 452
           +GA G+ GL +IF  MD + + ++   +F +G++  GL L++ E + +F  FD + +G I
Sbjct: 312 KGAYGLRGLAKIFLEMDQNNNGVVEYNDFKWGLRNFGLTLSEDETKMIFQTFDKNGNGRI 371

Query: 453 SLDEFLIKIRPPMSESR 503
             +EFL   R  MS+ R
Sbjct: 372 EFNEFLDAFRLQMSDKR 388


>UniRef50_A0DEN6 Cluster: Chromosome undetermined scaffold_48, whole
           genome shotgun sequence; n=4; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_48, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 501

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 26/85 (30%), Positives = 48/85 (56%)
 Frame = +3

Query: 267 LSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSG 446
           + +G   ++ +  IF   D + +  LN++EF + +KE+G  L K+E + LF  FD +   
Sbjct: 333 IKKGQHSVIKMATIFANSDKNKNGTLNRQEFQWAMKESGFLLTKTEYDNLFRYFDKNCDD 392

Query: 447 SISLDEFLIKIRPPMSESRRKL*NK 521
            +S  EF+  +R P+++ R  L N+
Sbjct: 393 EVSFFEFISFLRKPLTQFRADLVNQ 417



 Score = 39.5 bits (88), Expect = 0.059
 Identities = 20/62 (32%), Positives = 34/62 (54%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSE 497
           MD      L+K+EF   + + G+ L   E   ++ ++D++  G+I+  EF+  IR  MSE
Sbjct: 43  MDISNIGYLDKDEFQKFLSKIGVFLTTQELRAVYDKYDSNKDGNIAYAEFVNLIRENMSE 102

Query: 498 SR 503
            R
Sbjct: 103 KR 104


>UniRef50_A0CFH1 Cluster: Chromosome undetermined scaffold_175,
           whole genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_175,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 873

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 30/82 (36%), Positives = 46/82 (56%)
 Frame = +3

Query: 267 LSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSG 446
           +SRGA G + L R+ + +D D   +LN  EF   I++  +E+   E + +F  FD D SG
Sbjct: 389 VSRGARGFISLYRVAKILDADQDGMLNLSEFRRAIRDHKIEVTDPEIDLVFQYFDRDVSG 448

Query: 447 SISLDEFLIKIRPPMSESRRKL 512
            I +  F+  +R  MSE R +L
Sbjct: 449 LIDIWGFMFVLRGEMSEQRIQL 470


>UniRef50_Q22X58 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 643

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 24/55 (43%), Positives = 37/55 (67%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IF+++D D S  L+KEE   G +E  +ELN+ + +++F Q DTD +G I  +EFL
Sbjct: 464 IFKKLDKDNSGTLSKEEIKQGFEEMEVELNQQDLDQIFDQIDTDKNGFIDYNEFL 518



 Score = 35.9 bits (79), Expect = 0.72
 Identities = 19/56 (33%), Positives = 32/56 (57%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L +IF ++D D +  ++  EFL       L  N++  +++F   D D +GSISL+E
Sbjct: 497 LDQIFDQIDTDKNGFIDYNEFLASTISHELISNQNYLKKVFKLIDLDKNGSISLNE 552



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 3/60 (5%)
 Frame = +3

Query: 297 LGRIFRRMDDD--GSKLLNKEEFLYGIKETGLELN-KSEAEELFSQFDTDSSGSISLDEF 467
           L ++F+ +D D  GS  LN+ + + G  +  +    +S  E++FSQ D +S G IS +EF
Sbjct: 533 LKKVFKLIDLDKNGSISLNELKNILGSPDQRVNAAYQSVFEDIFSQIDINSDGEISFEEF 592


>UniRef50_A0DGM2 Cluster: Chromosome undetermined scaffold_5, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_5,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 195

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +3

Query: 267 LSRGASGILGLGRIFRRMDD-DGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           L +  + I  LG+ FR  +  D +  ++K+EFL G+K+ G+ L K + + L +  D +  
Sbjct: 20  LGKSQTTIRTLGKTFRGFESFDQNNKIDKDEFLIGLKQNGVVLTKFQTDFLLNYLDRNRD 79

Query: 444 GSISLDEFLIKIRPPMSESR 503
           GSI + EF   IR   +E+R
Sbjct: 80  GSIDIAEFFYLIRGSPNENR 99


>UniRef50_P80364 Cluster: Crustacean calcium-binding protein 23;
           n=1; Homarus americanus|Rep: Crustacean calcium-binding
           protein 23 - Homarus americanus (American lobster)
          Length = 137

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/61 (40%), Positives = 39/61 (63%)
 Frame = +3

Query: 249 ETRLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQF 428
           E +  CLS+G SG+L LG++FR    D S  L+KEE   G+ + GL+ + ++  +LFS F
Sbjct: 6   EKKSHCLSQGLSGLLSLGKLFR----DSSWTLSKEELSRGVSQFGLDFSDADVNKLFSDF 61

Query: 429 D 431
           +
Sbjct: 62  E 62



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 17/23 (73%), Positives = 20/23 (86%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIKG 580
           VE AFK LDKTGDG +T++DIKG
Sbjct: 67  VEAAFKHLDKTGDGVVTVEDIKG 89


>UniRef50_Q240R2 Cluster: EF hand family protein; n=1; Tetrahymena
           thermophila SB210|Rep: EF hand family protein -
           Tetrahymena thermophila SB210
          Length = 964

 Score = 49.6 bits (113), Expect = 5e-05
 Identities = 29/84 (34%), Positives = 43/84 (51%)
 Frame = +3

Query: 270 SRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGS 449
           S+G  G L L R  +  D D    LN  EF   I    +E+ ++E   +F+ FD   +G 
Sbjct: 498 SKGPRGFLTLERQLKTTDVDNDGRLNLVEFKKSISNFKIEVTETEVTIIFNLFDPQETGQ 557

Query: 450 ISLDEFLIKIRPPMSESRRKL*NK 521
           ISL EFL  ++  M++ R  L N+
Sbjct: 558 ISLFEFLNSLKGQMNQFRFNLVNE 581



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/80 (26%), Positives = 46/80 (57%)
 Frame = +3

Query: 273 RGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSI 452
           +GASG+L    + + +D+ G K +N  +    + +  ++ + +  E++F   D  + GSI
Sbjct: 153 KGASGLLSFALMLKVLDNTGRKTININQLESALSDFKIQEDPAVIEKVFYYLDKHNYGSI 212

Query: 453 SLDEFLIKIRPPMSESRRKL 512
           + ++FL K++ P++  R+ L
Sbjct: 213 NYEDFLNKLKVPLNPFRKSL 232


>UniRef50_Q9S9V0 Cluster: T19J18.7 protein; n=1; Arabidopsis
           thaliana|Rep: T19J18.7 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 453

 Score = 49.2 bits (112), Expect = 7e-05
 Identities = 23/61 (37%), Positives = 34/61 (55%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I GL  +F  +D D S  +  EE   G+   G  L+K+E E+L    D D +G+I +DEF
Sbjct: 303 IKGLKTLFTNIDTDKSGTITLEELKTGLTRLGSNLSKTEVEQLMEAADVDGNGTIDIDEF 362

Query: 468 L 470
           +
Sbjct: 363 I 363



 Score = 36.3 bits (80), Expect = 0.55
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D D    + KEE    +KE G+  ++   +++ ++ DTD+ G I+ +EF   +R  
Sbjct: 382 FQHFDKDNDGHITKEELEMAMKEHGVG-DEVSIKQIITEVDTDNDGKINFEEFRTMMRSG 440

Query: 489 MS-ESRRKL 512
            S + +R+L
Sbjct: 441 SSLQPQREL 449


>UniRef50_UPI0001509EB8 Cluster: EF hand family protein; n=1;
           Tetrahymena thermophila SB210|Rep: EF hand family
           protein - Tetrahymena thermophila SB210
          Length = 472

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/84 (28%), Positives = 44/84 (52%)
 Frame = +3

Query: 270 SRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGS 449
           +RG   + GL  IFR MD   +  L  ++F +G++  G++    E + L   +D + +G 
Sbjct: 301 ARGFFSLRGLDFIFRDMDQQKTGQLEYDDFRWGLRNFGIQSTPEEVKLLMEAYDKNLNGY 360

Query: 450 ISLDEFLIKIRPPMSESRRKL*NK 521
           +   EF+  +R  +S+ R  L +K
Sbjct: 361 VDYQEFISSLRGSLSDRRSDLVSK 384


>UniRef50_A7RUF3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 158

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/67 (35%), Positives = 36/67 (53%)
 Frame = +3

Query: 270 SRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGS 449
           S G      L   FR+ D DGS  ++ EE  Y +  +G +L++ EA EL   FD +  G 
Sbjct: 88  SSGQDFEANLREAFRKFDRDGSGYISPEELRYVVCHSGEKLSEDEARELIDMFDKNKDGQ 147

Query: 450 ISLDEFL 470
           +S +EF+
Sbjct: 148 LSWEEFV 154



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 18/66 (27%), Positives = 34/66 (51%)
 Frame = +3

Query: 273 RGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSI 452
           +G +    + R F+R D D S  +  E+F    K+ G + +  + + + S+FD D+   I
Sbjct: 14  KGEADRKSMKRAFKRADSDASGKIQGEQFCLAAKDAGFDTSTEDLQRVLSKFDKDTDSEI 73

Query: 453 SLDEFL 470
           +  EF+
Sbjct: 74  NFGEFV 79


>UniRef50_A0C6P4 Cluster: Chromosome undetermined scaffold_153, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_153, whole genome
            shotgun sequence - Paramecium tetraurelia
          Length = 2776

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/66 (34%), Positives = 40/66 (60%)
 Frame = +3

Query: 297  LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
            L R FR++ +  +++L+KE+     +  G+++   E E+LF + D D SGSI +DEF+  
Sbjct: 2252 LRREFRQVCNPTTRMLSKEQVSQVFQNMGVQIKNEELEDLFIEIDEDKSGSIDIDEFIYF 2311

Query: 477  IRPPMS 494
            I+   S
Sbjct: 2312 IQKNQS 2317



 Score = 39.5 bits (88), Expect = 0.059
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +3

Query: 249  ETRLLCLSRGAS-GILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQ 425
            E  LL L++  S G     ++F   D +G+ +L+++EF   I +    +   + + LF  
Sbjct: 1076 EQLLLGLNQTISAGKNATAQLFYNYDQNGNDVLDRQEFNKLIHDIDPSIKNKQIDNLFLL 1135

Query: 426  FDTDSSGSISLDEFLIKI 479
             D++  GSIS+ EF  K+
Sbjct: 1136 LDSNGDGSISISEFKAKV 1153



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 17/59 (28%), Positives = 34/59 (57%)
 Frame = +3

Query: 303  RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
            ++FR+ D + +  L   EF   +++    +++   E LF +FD ++  +I+L+EF  KI
Sbjct: 890  QLFRKYDANRNTKLEMREFQEFLQQLVGNVDQKILETLFHKFDANNDNTINLNEFKQKI 948


>UniRef50_Q38869 Cluster: Calcium-dependent protein kinase 4; n=90;
           Streptophyta|Rep: Calcium-dependent protein kinase 4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 501

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 24/59 (40%), Positives = 33/59 (55%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           GL  +F+ +D D S  +  EE   G+K  G EL +SE + L    D D+SG+I   EFL
Sbjct: 330 GLKELFKMIDTDNSGTITFEELKAGLKRVGSELMESEIKSLMDAADIDNSGTIDYGEFL 388


>UniRef50_A0E0J1 Cluster: Chromosome undetermined scaffold_71, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_71,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 2787

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/58 (37%), Positives = 36/58 (62%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L + ++F  +D DGS  L+  E   G+K   + LN+ +   +F+ FD+D SGS+SL+E
Sbjct: 826 LTVEKMFELIDTDGSGSLSPAELKQGLKSLKIILNQKDLNNMFAIFDSDKSGSVSLEE 883


>UniRef50_Q0DH47 Cluster: Os05g0491900 protein; n=2; Oryza
           sativa|Rep: Os05g0491900 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 547

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 23/69 (33%), Positives = 38/69 (55%)
 Frame = +3

Query: 264 CLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           CLS     I GL  +F+ MD D S  +  +E   G+ + G +L ++E ++L    D D +
Sbjct: 390 CLSE--EEIRGLKEMFKSMDSDNSGTITVDELRKGLAKKGTKLTEAEVQQLMEAADADGN 447

Query: 444 GSISLDEFL 470
           G+I  +EF+
Sbjct: 448 GTIDYEEFI 456



 Score = 37.1 bits (82), Expect = 0.31
 Identities = 20/67 (29%), Positives = 35/67 (52%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D D S  +  EE    ++E GL ++  E +++ S+ D D+ G I+  EF+  +R  
Sbjct: 475 FQYFDKDNSGYITIEELEQALREKGL-MDGREIKDIISEVDADNDGRINYTEFVAMMRKG 533

Query: 489 MSESRRK 509
             E+  K
Sbjct: 534 DPEANPK 540


>UniRef50_A7SXE5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 401

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 18/52 (34%), Positives = 34/52 (65%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           FR++D D SK + + EF+ G+K+TG+ + + + ++L +  D D+ G+I   E
Sbjct: 349 FRQLDKDNSKKITRAEFMAGVKKTGIPMTRRQLKKLVNILDVDNDGNIDYSE 400


>UniRef50_UPI000049A060 Cluster: calmodulin-like protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: calmodulin-like
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 155

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/55 (38%), Positives = 31/55 (56%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           FR +D + S  +NK+E    +K+TG+ L K E + L    D D  G IS  EF++
Sbjct: 96  FRLVDSNNSGKVNKKELTAFLKKTGVHLKKGEIDALMDSIDEDGDGKISFQEFML 150


>UniRef50_Q22H23 Cluster: EF hand family protein; n=1; Tetrahymena
            thermophila SB210|Rep: EF hand family protein -
            Tetrahymena thermophila SB210
          Length = 3608

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 22/57 (38%), Positives = 33/57 (57%)
 Frame = +3

Query: 297  LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
            + + F  MD +G  L+ K EF+  +      LNK E   LF + D ++SG+IS+DEF
Sbjct: 1042 ISQAFSNMDINGDGLITKNEFIEMMPVINSSLNKEELNYLFERLDLNNSGNISIDEF 1098



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = +3

Query: 297  LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
            L + F+++D   ++ LN  +        G++L  SE   LF + D D S ++ +DE +
Sbjct: 3120 LKKEFKKVDLQNTRSLNIGQLGQVFSNMGVQLKPSELSALFVEIDVDGSRTVDIDELI 3177


>UniRef50_A7SW85 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 357

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 23/56 (41%), Positives = 34/56 (60%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           R FR +D DGS L N  +F   +K   ++LN+ E   ++S +D D +G IS +EFL
Sbjct: 297 RAFRAIDKDGSGLCNPLDFRQMLKRFKIDLNEEEFFHVYSFYDKDMTGKISYNEFL 352


>UniRef50_A0CDT9 Cluster: Chromosome undetermined scaffold_17, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_17,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 489

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSE--AEELFSQFDTDSSGSISLDEFL-IKI 479
           F+ +D DG   +N+E+ ++G+KE+ L+  + E   + +  Q D + +GSI  + FL I I
Sbjct: 358 FQSLDKDGDGKINREDLIFGLKESKLDETEIEKQIDRIMEQCDFNKTGSIEYNAFLSIMI 417

Query: 480 RPPMSESRRKL 512
           R  +SE   KL
Sbjct: 418 RQELSEKTHKL 428


>UniRef50_Q8MYK0 Cluster: Calcium-dependent protein kinase; n=1;
           Toxoplasma gondii|Rep: Calcium-dependent protein kinase
           - Toxoplasma gondii
          Length = 594

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           RIF+R+D   ++ +N  EFL    +T + LN+    E F +FD D+SG ISL+
Sbjct: 471 RIFQRIDQTRAEEINYSEFLAATLQTRIALNQQLIREAFERFDVDNSGHISLE 523


>UniRef50_Q9NZT1 Cluster: Calmodulin-like protein 5; n=11;
           Eutheria|Rep: Calmodulin-like protein 5 - Homo sapiens
           (Human)
          Length = 146

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 21/60 (35%), Positives = 34/60 (56%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + F  +D DG+  +N +E    +K TG  L++++  +L S+ D+D  G IS  EFL   R
Sbjct: 15  KAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAR 74



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 17/70 (24%), Positives = 30/70 (42%)
 Frame = +3

Query: 258 LLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTD 437
           L    +  +G+  L   FR  D DG   +  +E    +   G  L + E + +  + D D
Sbjct: 70  LTAARKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVD 129

Query: 438 SSGSISLDEF 467
             G ++ +EF
Sbjct: 130 QDGRVNYEEF 139


>UniRef50_Q9ZSA3 Cluster: T4B21.12 protein; n=1; Arabidopsis
           thaliana|Rep: T4B21.12 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 575

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 28/90 (31%), Positives = 50/90 (55%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L + F+  D DGS  + KEE    +KE G+  +++ A++L S+FD ++ G I  +EF   
Sbjct: 411 LYKAFQYFDKDGSGHITKEEVEIAMKEHGMG-DEANAKDLISEFDKNNDGKIDYEEFCTM 469

Query: 477 IRPPMSESRRKL*NKHSRSLTRLVTVQSQL 566
           +R  + + + KL  +   +L  L T  ++L
Sbjct: 470 MRNGILQPQGKLLKRLYMNLEELKTGLTRL 499


>UniRef50_Q06850 Cluster: Calcium-dependent protein kinase isoform
           AK1; n=37; Viridiplantae|Rep: Calcium-dependent protein
           kinase isoform AK1 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 610

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 25/72 (34%), Positives = 36/72 (50%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R++  S     I GL  +F  +D D S  +  EE   G+K  G  L +SE  +L    D 
Sbjct: 442 RVIAESLSEEEIAGLKEMFNMIDADKSGQITFEELKAGLKRVGANLKESEILDLMQAADV 501

Query: 435 DSSGSISLDEFL 470
           D+SG+I   EF+
Sbjct: 502 DNSGTIDYKEFI 513


>UniRef50_UPI00006CE935 Cluster: EF hand family protein; n=1;
           Tetrahymena thermophila SB210|Rep: EF hand family
           protein - Tetrahymena thermophila SB210
          Length = 498

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 21/54 (38%), Positives = 34/54 (62%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           IF++MD+D S  +++EEF++   E     NK+   + F Q D D SG ++L+EF
Sbjct: 379 IFQKMDEDNSGEVSQEEFIHAFAEQFSIKNKNMILQSFKQLDQDGSGIVNLEEF 432



 Score = 36.7 bits (81), Expect = 0.41
 Identities = 14/50 (28%), Positives = 29/50 (58%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISL 458
           F+++D DGS ++N EEF Y ++   L L +   E++    + ++ G + +
Sbjct: 416 FKQLDQDGSGIVNLEEFTYLLQNGNLPLGEVSVEQILGFINDNNQGKVCM 465


>UniRef50_A0BRM8 Cluster: Chromosome undetermined scaffold_123,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_123,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 463

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 25/61 (40%), Positives = 36/61 (59%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I  L ++F+ +D DG+  L+ EEF  G KE      K++  + F   DTDSSGSI  +EF
Sbjct: 328 IAELSKLFQSLDKDGNGQLSFEEFKNGFKE-----KKNDLLQYFEAIDTDSSGSIDYNEF 382

Query: 468 L 470
           +
Sbjct: 383 I 383


>UniRef50_UPI00015B625F Cluster: PREDICTED: similar to CG18076-PB;
            n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
            CG18076-PB - Nasonia vitripennis
          Length = 5350

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 21/66 (31%), Positives = 34/66 (51%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            +FR+MD +   L+ +E+F+ GI  T  + ++ E   +   FD    G I   EF+  +RP
Sbjct: 4985 LFRKMDKNNDGLIPREDFIQGILNTKFDTSRLEMGAVADLFDRHGEGLIDWKEFIAALRP 5044

Query: 486  PMSESR 503
               E R
Sbjct: 5045 DWEERR 5050


>UniRef50_UPI0000E481D4 Cluster: PREDICTED: similar to
           Calcyphosphine 2 isoform 3; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to Calcyphosphine 2
           isoform 3 - Strongylocentrotus purpuratus
          Length = 785

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 23/79 (29%), Positives = 42/79 (53%)
 Frame = +3

Query: 270 SRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGS 449
           SR +  + GLG+ F+++D  G   L+K+E    +K   ++L+K   ++L+   D +  G+
Sbjct: 551 SRASRTLTGLGKHFKKLDKSGDGTLDKDELQEALKTYHIKLDKKLFDQLWLIIDQNGDGA 610

Query: 450 ISLDEFLIKIRPPMSESRR 506
           I   EF       M+E R+
Sbjct: 611 IDYSEFCRAFIGEMNEFRK 629


>UniRef50_Q5CUC1 Cluster: Protein with 2x EF hands and 4
           transmembrane regions; n=2; Cryptosporidium|Rep: Protein
           with 2x EF hands and 4 transmembrane regions -
           Cryptosporidium parvum Iowa II
          Length = 398

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETG--LELNKSEAEELFSQFDTDSSGSISLDEF 467
           R F  +D+DG+  +N++E   G+K       ++KSE E +F   D DS   IS+++F
Sbjct: 328 RFFNALDEDGNGQINQDELFNGLKSLNFPFSISKSEIEIIFDHLDKDSDNMISIEDF 384


>UniRef50_A0D261 Cluster: Chromosome undetermined scaffold_35, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_35,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 545

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 3/92 (3%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF--- 467
           L +IF+++D  G + LN +EF   I+      N  + + +F +FD D +G +  +EF   
Sbjct: 315 LTQIFQKVDTSGDQQLNLDEFKCFIQYLDNSFNDDDVKYIFDEFDKDGNGYVDFEEFKQY 374

Query: 468 LIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQ 563
           L    P  ++ +R L  KH   L  L  +  Q
Sbjct: 375 LYPSPPKKAKLQRSLQKKHMIILQELSNLIQQ 406



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 2/57 (3%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGL--ELNKSEAEELFSQFDTDSSGSISLDEF 467
           ++FR+ D   +  L+K+E    +K+  L  +L   + E + S FD +  G I  +EF
Sbjct: 413 QLFRKYDTSNNNALDKQELFALLKKIDLNNQLQLEDIETIISVFDENDDGEIQFEEF 469


>UniRef50_A0C2U6 Cluster: Chromosome undetermined scaffold_145,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_145,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 191

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 25/56 (44%), Positives = 34/56 (60%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F R D DGSK + K E +   K    +LN    EELF   DTD+SG+IS +E+L
Sbjct: 19  KLFARFDVDGSKSIEKSETIKYWKSNFAKLN---TEELFKSVDTDNSGTISEEEWL 71


>UniRef50_A0BYZ7 Cluster: Chromosome undetermined scaffold_138,
           whole genome shotgun sequence; n=6; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_138,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 564

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 25/56 (44%), Positives = 34/56 (60%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F R D DGSK + K E +   K    +LN    EELF   DTD+SG+IS +E+L
Sbjct: 19  KLFARFDVDGSKSIEKSETIKYWKSNFAKLN---TEELFKSVDTDNSGTISEEEWL 71


>UniRef50_P05095 Cluster: Alpha-actinin, non-muscular; n=2;
           Dictyostelium discoideum|Rep: Alpha-actinin,
           non-muscular - Dictyostelium discoideum (Slime mold)
          Length = 861

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 20/54 (37%), Positives = 31/54 (57%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D D    LN+ EF   +K  G EL + +  ++ S+ DTD +G+IS +EF+
Sbjct: 738 FSHFDKDNDNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFI 791


>UniRef50_Q38871 Cluster: Calmodulin-domain protein kinase CDPK
           isoform 5; n=88; Viridiplantae|Rep: Calmodulin-domain
           protein kinase CDPK isoform 5 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 556

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           +++  S     I GL  +F+ MD D S  +  +E   G+++ G  L  +E  +L    D 
Sbjct: 389 KVIAESLSEEEIAGLREMFQAMDTDNSGAITFDELKAGLRKYGSTLKDTEIHDLMDAADV 448

Query: 435 DSSGSISLDEFL 470
           D+SG+I   EF+
Sbjct: 449 DNSGTIDYSEFI 460


>UniRef50_A7QBM6 Cluster: Chromosome chr1 scaffold_75, whole genome
           shotgun sequence; n=5; Vitis vinifera|Rep: Chromosome
           chr1 scaffold_75, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 269

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           RIF+R D+DG   L+  E    +   G EL   EA+E+    D+D  G + L+EF+
Sbjct: 138 RIFKRFDEDGDGKLSPSELRSCVGTIGEELLMEEAQEVVESMDSDGDGLVGLEEFV 193



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           RIF+R D+DG   L+  E    +   G E    EA+E+    D+D  G + L+EF+
Sbjct: 9   RIFKRFDEDGDGKLSPSELRCCLGTIGEEQPMEEAQEVVESMDSDGDGLLGLEEFV 64



 Score = 35.5 bits (78), Expect = 0.96
 Identities = 20/66 (30%), Positives = 33/66 (50%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           +   MD DG  LL  EEF+  ++  G E    +  E F  ++ + SG I+  + L ++  
Sbjct: 46  VVESMDSDGDGLLGLEEFVGWMEREGEERKMEDLREAFRMYEMEGSGCITA-KSLKRMLS 104

Query: 486 PMSESR 503
            + ESR
Sbjct: 105 RLGESR 110



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 19/66 (28%), Positives = 33/66 (50%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           +   MD DG  L+  EEF+  ++  G +    E  E F  ++ + SG I+  + L ++  
Sbjct: 175 VVESMDSDGDGLVGLEEFVGCMEREGEKRKMEELREAFRMYEMEGSGCIT-PKSLKRMLS 233

Query: 486 PMSESR 503
            + ESR
Sbjct: 234 RLGESR 239


>UniRef50_Q24FR9 Cluster: Protein kinase domain containing protein;
           n=10; Oligohymenophorea|Rep: Protein kinase domain
           containing protein - Tetrahymena thermophila SB210
          Length = 497

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/63 (38%), Positives = 35/63 (55%)
 Frame = +3

Query: 282 SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           S I  LGR+FR++D +G  +L  +E   G+  T  E +  E +++    DTD SG I   
Sbjct: 365 SEISDLGRLFRQLDKNGDGVLTIDEIKEGLSGT-TEKSYDEIKKVIESIDTDGSGKIDYT 423

Query: 462 EFL 470
           EFL
Sbjct: 424 EFL 426



 Score = 32.3 bits (70), Expect = 8.9
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = +2

Query: 524 FKKLDKTGDGAITIDDIK 577
           F++LDK GDG +TID+IK
Sbjct: 374 FRQLDKNGDGVLTIDEIK 391


>UniRef50_A0BJ86 Cluster: Chromosome undetermined scaffold_11, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_11,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 543

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 4/86 (4%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF----LI 473
           IF + D D    L+ EEF + IKE   ++ + + + +F +FDT++  +I++DEF    ++
Sbjct: 391 IFAKYDKDQMGDLDYEEFSFMIKEIAKDIKEDDIQAIFDKFDTNNDRTINIDEFREQLIV 450

Query: 474 KIRPPMSESRRKL*NKHSRSLTRLVT 551
           K      + +  L     + L R+VT
Sbjct: 451 KQDTQRFQIKENLIQNFIKDLRRIVT 476


>UniRef50_P04630 Cluster: Calmodulin-like protein; n=6;
           Caenorhabditis|Rep: Calmodulin-like protein -
           Caenorhabditis elegans
          Length = 161

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/54 (31%), Positives = 31/54 (57%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG+ ++  +EF Y +   G++ ++ E +E+  + D D  G I  +EF+
Sbjct: 102 FRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDVDGDGEIDYEEFV 155


>UniRef50_Q2KN25 Cluster: Calcium-binding protein; n=1; Ambrosia
           artemisiifolia|Rep: Calcium-binding protein - Ambrosia
           artemisiifolia (Short ragweed)
          Length = 160

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           +IF R D +G   ++++E    +K  G + +  E + + ++ D D  G ISLDEF++
Sbjct: 20  KIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISLDEFIL 76


>UniRef50_A3C8D9 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 487

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 23/69 (33%), Positives = 36/69 (52%)
 Frame = +3

Query: 264 CLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           CLS     I GL  +F+ +D D S  +  EE   G+ + G + + +E E+L    D D +
Sbjct: 346 CLSE--EEIKGLKEMFKNIDKDNSGTITLEELKNGLAKQGTKFSDNEIEQLMEAADADGN 403

Query: 444 GSISLDEFL 470
           G I  +EF+
Sbjct: 404 GIIDYEEFV 412


>UniRef50_A7SJS6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 681

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 2/76 (2%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F + D D S  +++EEF  G+KETGL + K + + L    D ++ G I   E L      
Sbjct: 587 FNQFDKDHSGGISREEFSKGLKETGLVMTKRQLDRLMEYIDINNDGEIEYSELLRGREMT 646

Query: 489 MSESR--RKL*NKHSR 530
           + E R  RK+  ++ R
Sbjct: 647 IQELREERKIEERNKR 662


>UniRef50_A0CC00 Cluster: Chromosome undetermined scaffold_166, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_166, whole genome
            shotgun sequence - Paramecium tetraurelia
          Length = 2733

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 22/66 (33%), Positives = 38/66 (57%)
 Frame = +3

Query: 297  LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
            L R FR++ +  +++L+KE+     +  G+ +   E  +LF + D D SGSI +DEF+  
Sbjct: 2211 LRREFRQVCNPTTRMLSKEQVSQVFQNMGVLIKNEELTDLFVEIDEDKSGSIDIDEFIYF 2270

Query: 477  IRPPMS 494
            I+   S
Sbjct: 2271 IQKNQS 2276



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 20/66 (30%), Positives = 34/66 (51%)
 Frame = +3

Query: 282  SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
            SG +    +F   D +G+ +L+K+EF   I++          + LF   D++  GSIS+ 
Sbjct: 1072 SGKVATASLFYNYDQNGNDVLDKQEFYKLIRDIDPMSRNKPVDNLFLLLDSNQDGSISIS 1131

Query: 462  EFLIKI 479
            EF  K+
Sbjct: 1132 EFKSKV 1137



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 17/83 (20%), Positives = 44/83 (53%)
 Frame = +3

Query: 327  DGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSESRR 506
            + +  +++ +F     +    L+ ++ EEL+   D +SSG IS++EF +  +   +E + 
Sbjct: 2057 NSNSTIDRVQFTKKALDAQFGLSATQCEELYDYLDANSSGHISINEFRLVFQSKQTEQQI 2116

Query: 507  KL*NKHSRSLTRLVTVQSQLMTL 575
            K   K + ++ +   ++ +++ L
Sbjct: 2117 K---KQADNIVQSQDIEQEILDL 2136


>UniRef50_UPI00006CA862 Cluster: metallo-beta-lactamase superfamily
            protein; n=1; Tetrahymena thermophila SB210|Rep:
            metallo-beta-lactamase superfamily protein - Tetrahymena
            thermophila SB210
          Length = 1496

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/65 (29%), Positives = 40/65 (61%)
 Frame = +3

Query: 291  LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
            L L  I++  D   S+ + K++F   IKE G+ +N++E ++ F +FD ++ G++   +F+
Sbjct: 1425 LKLEDIYKMFDPQNSQNVQKQDFFQWIKENGVYVNENEFKKFFQRFDRNNIGAMHQIDFI 1484

Query: 471  IKIRP 485
             ++ P
Sbjct: 1485 NELTP 1489


>UniRef50_A7PY61 Cluster: Chromosome chr15 scaffold_37, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr15 scaffold_37, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 540

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/53 (35%), Positives = 31/53 (58%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           F   D DG   ++++E    I+    +LN+ E +E+F+ FDTD  G +S D+F
Sbjct: 466 FAECDSDGDLYISEQELGDSIRPVIPDLNEDEIQEMFNLFDTDKDGRVSKDDF 518


>UniRef50_Q23CW2 Cluster: EF hand family protein; n=1; Tetrahymena
            thermophila SB210|Rep: EF hand family protein -
            Tetrahymena thermophila SB210
          Length = 6110

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 20/60 (33%), Positives = 35/60 (58%)
 Frame = +3

Query: 291  LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
            + L R F   D+DG  +++++EF+ G+K+  L L+  E ++L    D D +  IS  EF+
Sbjct: 2982 MSLHRAFNLFDEDGDGVISQQEFVIGMKQLNLGLSIFEIKKLMKIIDIDGNEQISKQEFI 3041



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IFR +D D    ++KEEF    K+  +++ +   +E + +FD +    +S +EFL
Sbjct: 375 IFRMLDSDNDSYISKEEFKLAFKKANIKVEEQILDEAYFRFDFNKDDKVSFNEFL 429


>UniRef50_A0E9C3 Cluster: Chromosome undetermined scaffold_84, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_84,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 420

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/53 (39%), Positives = 29/53 (54%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           F   D DGS  ++KEE     K  GL+ N  + E++ S  DT+  G IS +EF
Sbjct: 12  FNVFDKDGSGFIDKEEIKDLAKNVGLDWNDHKLEKIISALDTNGDGKISFEEF 64


>UniRef50_Q27YT9 Cluster: Radial spoke protein 7; n=1; Chlamydomonas
           reinhardtii|Rep: Radial spoke protein 7 - Chlamydomonas
           reinhardtii
          Length = 500

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 19/56 (33%), Positives = 30/56 (53%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F++ D DGS  LN+ EF   +K   L L   +   + S  D D  G +S +EF+
Sbjct: 204 KVFKKADADGSGQLNRHEFKEALKAAELGLTPKDINLILSHIDVDRDGLVSYEEFI 259


>UniRef50_A7SIU0 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 496

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FRR+D D S  ++  EF+ G++++ + L   E E++    D D  G I   EF+
Sbjct: 419 LFRRLDKDQSMQVSVREFVEGLRKSDVGLTAFEVEKIIESLDVDDDGEIDYSEFV 473


>UniRef50_A7RUF2 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 161

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = +3

Query: 273 RGASGIL-GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGS 449
           RGA  +   L + FR  D +G   ++ EE    +   G  L + EAEEL    D D  G 
Sbjct: 67  RGAEKLEENLRQAFRVFDRNGDGYISAEELRVAVTTLGDALTQDEAEELIGMLDQDGDGK 126

Query: 450 ISLDEFLIKIRPPMSESRRKL*NKHSRS 533
           +  +EF++  +  + E  + L ++   S
Sbjct: 127 LGYEEFVVIAKKSLKECIKALEHRGGES 154


>UniRef50_A0E1G4 Cluster: Chromosome undetermined scaffold_73, whole
           genome shotgun sequence; n=4; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_73, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 195

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 18/24 (75%), Positives = 21/24 (87%)
 Frame = +2

Query: 509 IVEQAFKKLDKTGDGAITIDDIKG 580
           IV+QAF+K DKTGDG IT DD+KG
Sbjct: 103 IVDQAFRKFDKTGDGYITADDLKG 126


>UniRef50_Q11083 Cluster: Uncharacterized calcium-binding protein
           B0563.7; n=2; Caenorhabditis|Rep: Uncharacterized
           calcium-binding protein B0563.7 - Caenorhabditis elegans
          Length = 229

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 18/55 (32%), Positives = 28/55 (50%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           ++F   D DGS  +  EE    +   GL  NK+E + +  + D D +G I  +EF
Sbjct: 55  QLFNMFDTDGSGAIGNEELKQAMISIGLHANKAEIDNVIKEVDADGNGEIDFEEF 109


>UniRef50_Q9S744 Cluster: Calmodulin-like protein 9; n=1;
           Arabidopsis thaliana|Rep: Calmodulin-like protein 9 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 151

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FR  D DG  L+++ E   G+K+ G+++   EAE +  + D D  G +S  EF
Sbjct: 89  VFRVFDRDGDGLISQLELGEGMKDMGMKITAEEAEHMVREADLDGDGFLSFHEF 142


>UniRef50_Q8MR19 Cluster: LD39385p; n=4; Diptera|Rep: LD39385p -
           Drosophila melanogaster (Fruit fly)
          Length = 1140

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 19/66 (28%), Positives = 35/66 (53%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           +FR+MD D + ++ ++ F+ GI  T  + +  E + +   FD +  G I   EF+  +RP
Sbjct: 736 LFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRP 795

Query: 486 PMSESR 503
              E +
Sbjct: 796 DWQERK 801


>UniRef50_A1Z9J3 Cluster: CG18076-PH, isoform H; n=12; Drosophila
            melanogaster|Rep: CG18076-PH, isoform H - Drosophila
            melanogaster (Fruit fly)
          Length = 8805

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 19/66 (28%), Positives = 35/66 (53%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            +FR+MD D + ++ ++ F+ GI  T  + +  E + +   FD +  G I   EF+  +RP
Sbjct: 8379 LFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRP 8438

Query: 486  PMSESR 503
               E +
Sbjct: 8439 DWQERK 8444


>UniRef50_A0EHG9 Cluster: Chromosome undetermined scaffold_97, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_97,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 539

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L L ++FR  D      LN +EF   IK+    L + E EE+F +FD ++   I+  EF
Sbjct: 381 LNLDQLFRSFDQQSDGKLNPQEFTQFIKQIAPGLKQDEIEEVFKKFDKNNDKEITFAEF 439



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +F + D D S  L++ EF   + +    L + +  ++F   D +    ISLDEF
Sbjct: 296 LFEKYDTDRSLQLDRNEFYLFVLQLDPRLTRDQTTQIFKVMDRNGDELISLDEF 349


>UniRef50_A0CDD7 Cluster: Chromosome undetermined scaffold_17, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_17,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 543

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L + +IF+R D  G   +++EEF   +K    +++++EA  +F  FD +    IS +EF
Sbjct: 481 LDISKIFQRFDKSGDGAIDQEEFFQLLKAIDGKISRNEAASVFHVFDKNHDDQISFEEF 539



 Score = 33.9 bits (74), Expect = 2.9
 Identities = 17/59 (28%), Positives = 33/59 (55%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + + +IF + D +    L+ +EF   IK     +   E + +F++FD D++G++S  EF
Sbjct: 387 MNITQIFNKYDKNHQGDLDYQEFYNLIKVIVPGIKDYEIQLMFTKFDRDNNGAVSFPEF 445


>UniRef50_A3IMP0 Cluster: Cyclic nucleotide-binding domain (CNMP-BD)
           protein; n=2; Chroococcales|Rep: Cyclic
           nucleotide-binding domain (CNMP-BD) protein - Cyanothece
           sp. CCY 0110
          Length = 815

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 21/58 (36%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           G+   FRR D D S  +N EE    +++  + L+ S+ EE+    D +S  SIS +EF
Sbjct: 744 GMLERFRRFDVDNSGFINLEELRLCLRDIDISLSDSQIEEMLKLADKNSDNSISYEEF 801


>UniRef50_P06495 Cluster: Calerythrin; n=3; Actinomycetales|Rep:
           Calerythrin - Saccharopolyspora erythraea (Streptomyces
           erythraeus)
          Length = 177

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 21/54 (38%), Positives = 33/54 (61%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           D +    +N +EF   +  T L ++K+EA E F+Q DT+ +G +SLDE L  +R
Sbjct: 113 DKNADGQINADEFAAWL--TALGMSKAEAAEAFNQVDTNGNGELSLDELLTAVR 164


>UniRef50_UPI000150A956 Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 471

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 20/61 (32%), Positives = 36/61 (59%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I+ LG+ F+++D +G  +L+ EE   G+K    +  +S+  E+  + DTD +G I   EF
Sbjct: 330 IIDLGKQFKQLDKNGDGVLSIEEITEGMK--NFDGKQSQLLEIIKEIDTDKNGQIEYSEF 387

Query: 468 L 470
           +
Sbjct: 388 I 388



 Score = 32.7 bits (71), Expect = 6.7
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           I + +D D +  +   EF+    +  L + + +  + F   D D SGSIS DE
Sbjct: 370 IIKEIDTDKNGQIEYSEFIAASMDKQLYMKQEKLYQAFKALDIDGSGSISKDE 422


>UniRef50_A2DPU6 Cluster: EF hand family protein; n=1; Trichomonas
           vaginalis G3|Rep: EF hand family protein - Trichomonas
           vaginalis G3
          Length = 144

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 23/72 (31%), Positives = 38/72 (52%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L  +F + DDD +  L+  EF   + E G E +  +  EL++ FD D +G ++ DEF+  
Sbjct: 11  LRELFDKYDDDKNGGLDINEFKNFLTEAGEEFDDEDLNELYAVFDHDHNGLLAFDEFVDY 70

Query: 477 IRPPMSESRRKL 512
           +    S   R+L
Sbjct: 71  VGCIESGDERRL 82


>UniRef50_A2DDP0 Cluster: EF hand family protein; n=1; Trichomonas
           vaginalis G3|Rep: EF hand family protein - Trichomonas
           vaginalis G3
          Length = 154

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/59 (32%), Positives = 33/59 (55%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           +F ++D D S  +   E     K  G+ +   +AE + +QFD D +G++ LDEF+  +R
Sbjct: 89  VFDKIDADSSGNIGVSEIKTMFKSFGIPITWDQAEVILNQFDEDQNGTLELDEFVNFVR 147


>UniRef50_A0BWN9 Cluster: Chromosome undetermined scaffold_132,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_132,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1133

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + L ++F + D  G   L+ +E    + E   +L++ E E +F++ D DSS SI L+EF
Sbjct: 314 IDLEKVFIKYDKSGDNSLDMKELTLLLHEIDPKLDREEIEYIFNKIDLDSSNSIELNEF 372


>UniRef50_Q1EAW9 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 469

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/57 (33%), Positives = 33/57 (57%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L ++F  +D D    ++KEE        GL + KS+ ++ FS+ DT++ G IS +E+
Sbjct: 77  LWQLFETVDRDHDGHVDKEELQSAFARAGLTVRKSKLDQFFSEMDTNNDGVISFEEW 133


>UniRef50_A1AR61 Cluster: Putative signal transduction protein with
           EFhand domain; n=1; Pelobacter propionicus DSM 2379|Rep:
           Putative signal transduction protein with EFhand domain
           - Pelobacter propionicus (strain DSM 2379)
          Length = 273

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 22/65 (33%), Positives = 39/65 (60%), Gaps = 3/65 (4%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF---LIK 476
           +F+++D D S  +++ E L  + E   E N   +EE F+Q+D+D +G++S DE    L  
Sbjct: 16  LFKKVDSDASNDVSRSE-LQTLSEMIAESNLDASEESFAQYDSDGNGTLSEDELNAVLDS 74

Query: 477 IRPPM 491
            +PP+
Sbjct: 75  TKPPL 79


>UniRef50_Q9U4D6 Cluster: Putative uncharacterized protein; n=1;
           Sterkiella nova|Rep: Putative uncharacterized protein -
           Oxytricha nova
          Length = 543

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + ++F+  D DGS  +++ E      E G  L+ +E EE     DT+    IS DEF
Sbjct: 132 IAKVFKTFDKDGSGFIDRNELGQVAAELGRPLDAAELEECIQDLDTNKDNQISQDEF 188


>UniRef50_Q230X5 Cluster: EF hand family protein; n=3; Tetrahymena
           thermophila SB210|Rep: EF hand family protein -
           Tetrahymena thermophila SB210
          Length = 117

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 21/55 (38%), Positives = 35/55 (63%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +F+++D DGS  ++K+E +   K    ++N    EELF   D D++G+IS DE+L
Sbjct: 22  VFKKIDTDGSGTIDKDETIKFWKSNFAKVN---TEELFKAVDLDNNGTISQDEWL 73


>UniRef50_O18058 Cluster: Putative uncharacterized protein cal-4;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein cal-4 - Caenorhabditis elegans
          Length = 182

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 18/66 (27%), Positives = 34/66 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D DG+  +  +EF + +   G   ++ E +E+  + D D    I LDEF+  + P 
Sbjct: 101 FKVFDKDGNGYITAQEFKHFMTTMGERFSEEEVDEIIREVDKDGDEQIDLDEFVNMVAPI 160

Query: 489 MSESRR 506
           +S+  +
Sbjct: 161 VSDGTK 166



 Score = 36.3 bits (80), Expect = 0.55
 Identities = 17/68 (25%), Positives = 34/68 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D DG+  +N +E    ++  GL   + E   + +++D D +G I   EF   ++  
Sbjct: 29  FKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFGEFCKMMKEM 88

Query: 489 MSESRRKL 512
             E+ ++L
Sbjct: 89  NKETDQEL 96


>UniRef50_Q26678 Cluster: Flagellar calcium-binding protein TB-44A;
           n=28; Trypanosomatidae|Rep: Flagellar calcium-binding
           protein TB-44A - Trypanosoma brucei brucei
          Length = 407

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 3/63 (4%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGI---KETGLELNKSEAEELFSQFDTDSSGSISL 458
           I  L  +F  MD DGS LL  +EF   +   KE G+++  ++A  +F++ DT+ SG ++ 
Sbjct: 132 IFELTVMFDTMDKDGSLLLELQEFKEALPKWKEWGVDI--TDATTVFNEIDTNGSGVVTF 189

Query: 459 DEF 467
           DEF
Sbjct: 190 DEF 192



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 3/63 (4%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIK---ETGLELNKSEAEELFSQFDTDSSGSISL 458
           I  L  +F  MD DGS LL  +EF   +K   E G+++  ++A  +F++ DT+ SG ++ 
Sbjct: 321 IFELTVMFDTMDKDGSLLLELQEFKEALKKWKEWGVDI--TDATTVFNEIDTNGSGVVTF 378

Query: 459 DEF 467
           DEF
Sbjct: 379 DEF 381


>UniRef50_A7RQT6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 179

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 31/98 (31%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +3

Query: 264 CLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           CL  G +  + L  +FR +D      LN  +F +    +  +L+KSE   +F   D D S
Sbjct: 18  CLLSGKNARIIL-ELFRLLDVHDEMALNDIQF-WSFMRSATDLSKSEIYTVFDMLDVDCS 75

Query: 444 GSISLDEF--LIKIRPPMSESRRK-L*NKHSRSLTRLV 548
           GSI  DEF  L  I   + +   K   ++HSR++  L+
Sbjct: 76  GSIDFDEFYLLFCILIAVKDKEEKHFIHRHSRTVFDLL 113


>UniRef50_A2DY15 Cluster: EF hand family protein; n=1; Trichomonas
           vaginalis G3|Rep: EF hand family protein - Trichomonas
           vaginalis G3
          Length = 161

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 21/56 (37%), Positives = 33/56 (58%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F+R +  G   L+  + +  +KETGLE    E  E+F  FDTD +G IS  +F+
Sbjct: 97  KMFQRTEKAGYIYLDDLKTI--VKETGLEYTDEECREMFDAFDTDGTGRISEAQFI 150


>UniRef50_A2D7G5 Cluster: EF hand family protein; n=1; Trichomonas
           vaginalis G3|Rep: EF hand family protein - Trichomonas
           vaginalis G3
          Length = 159

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 21/55 (38%), Positives = 30/55 (54%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           R F   D D   L++ E+     KE G +L + E E + S+FD D  G I++DEF
Sbjct: 94  RAFALFDTDHDGLIDIEDLKKVSKELGDDLPEEELEIMISKFDKDKDGKINIDEF 148


>UniRef50_A0CZX7 Cluster: Chromosome undetermined scaffold_32, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_32,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 506

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELN-KSEAEELFSQFDTDSSGSISLDEFLIKI 479
           F  +D +    +N EE +   K  G E + K E +++F + DTD SG I   EFLI +
Sbjct: 376 FNEIDANKDGKVNMEEMMVAYKSLGSEDDAKDEVKQMFEKLDTDGSGDIDFYEFLIAV 433


>UniRef50_UPI0000E4A62F Cluster: PREDICTED: similar to calmodulin;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to calmodulin - Strongylocentrotus purpuratus
          Length = 283

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 18/57 (31%), Positives = 30/57 (52%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           FR+ D DG+  +   E    +K  G+ L   E  ++F + D +  G ++ +EFL KI
Sbjct: 188 FRKFDKDGNGFIGAAELKTVMKSFGVPLTDKEVAKIFKEADKNGDGKVNYEEFLRKI 244


>UniRef50_Q4SJD8 Cluster: Chromosome 4 SCAF14575, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 4
           SCAF14575, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 249

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 17/64 (26%), Positives = 33/64 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D DG+  ++K+E    ++  G   N+ E E +  + D D  G +  +EF+  + P 
Sbjct: 6   FKVFDRDGNGFISKQELGMAMRSLGYMPNEVELEVIIQRLDIDGDGQVGFEEFVTLLGPK 65

Query: 489 MSES 500
           +S +
Sbjct: 66  LSSA 69


>UniRef50_Q89IG0 Cluster: Bll5679 protein; n=5;
           Bradyrhizobiaceae|Rep: Bll5679 protein - Bradyrhizobium
           japonicum
          Length = 260

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 19/53 (35%), Positives = 34/53 (64%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           +F ++D DG   + K EF   +   G  L  ++A+++FS+ D++S GS++LDE
Sbjct: 109 LFSQIDADGDGKITKSEFEKALGAGGTNL--AQADDVFSKLDSNSDGSVNLDE 159


>UniRef50_Q014Q8 Cluster: Calcineurin B regulatory subunit; n=4;
            Ostreococcus|Rep: Calcineurin B regulatory subunit -
            Ostreococcus tauri
          Length = 1711

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 22/73 (30%), Positives = 36/73 (49%)
 Frame = +3

Query: 303  RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
            R+F   D D + L++ +EF+ GI   G +   ++ +  FS +D D SG I   E    IR
Sbjct: 1593 RLFSMFDTDRTGLIDVKEFIVGISNVGNDARDNKIQFAFSVYDLDGSGFIDASELRKIIR 1652

Query: 483  PPMSESRRKL*NK 521
                 S +++  K
Sbjct: 1653 ATNMSSDKQIERK 1665



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 17/55 (30%), Positives = 25/55 (45%)
 Frame = +3

Query: 303  RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
            R FR  D D +  +   E  + +   G +    E +E+    DTD  G IS +EF
Sbjct: 1382 RAFREFDLDRNGYVGAAEIAHVLASMGEKATDDEIDEMILMADTDGDGQISYEEF 1436



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSE-AEELFSQFDTDSSGSISLDEFLIKIRP 485
            F   D DGS  ++  EF+       L ++++   E LFS FDTD +G I + EF++ I  
Sbjct: 1563 FLESDKDGSGRVDVNEFV-----RMLHVDRTPYVERLFSMFDTDRTGLIDVKEFIVGISN 1617

Query: 486  PMSESR 503
              +++R
Sbjct: 1618 VGNDAR 1623



 Score = 32.3 bits (70), Expect = 8.9
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 3/56 (5%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKS---EAEELFSQFDTDSSGSISLDEF 467
            F   D DGS  ++  E    I+ T +  +K    + E L  Q DTD  G+IS +EF
Sbjct: 1631 FSVYDLDGSGFIDASELRKIIRATNMSSDKQIERKVEWLMRQCDTDGDGNISYEEF 1686


>UniRef50_Q5C1W3 Cluster: SJCHGC08066 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08066 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 223

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 18/63 (28%), Positives = 36/63 (57%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L LG++F ++D D +  ++KEE    I ++ + L+   ++  F ++D D  G ++  E+ 
Sbjct: 111 LQLGKLFHKIDVDNNAKIDKEELKNWIIQSFISLDLEASKPRFKEYDADGDGQLAWSEYT 170

Query: 471 IKI 479
            KI
Sbjct: 171 NKI 173


>UniRef50_A2FZT8 Cluster: EF hand family protein; n=1; Trichomonas
           vaginalis G3|Rep: EF hand family protein - Trichomonas
           vaginalis G3
          Length = 148

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +  ++D +   +L+ +EFL  + +  L   K EA E+F+  DTD SGSI+ +E L
Sbjct: 51  LMSKVDKNHDNVLSLDEFLEAMSQMALSKEK-EAREVFNTIDTDKSGSITKEELL 104



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 15/55 (27%), Positives = 28/55 (50%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +F  +D D S  + KEE L  ++    E++  + + +F ++D      I+  EFL
Sbjct: 86  VFNTIDTDKSGSITKEELLKFMEIVNQEVSLPDVDCIFDKYDVSQDDKINFSEFL 140


>UniRef50_UPI000150A831 Cluster: EF hand family protein; n=1;
           Tetrahymena thermophila SB210|Rep: EF hand family
           protein - Tetrahymena thermophila SB210
          Length = 1129

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 21/59 (35%), Positives = 32/59 (54%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + L  +F + D   +  LN  EF   ++     LN  E E  F++FDTD SG+I+ +EF
Sbjct: 213 INLYDLFNKYDSSRNANLNLHEFGQLLRRMEPNLNNYEIELAFNKFDTDRSGTITFNEF 271



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 19/59 (32%), Positives = 30/59 (50%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + L  +F + D      LN  EF   +K+    ++ SE    F++FD + +GSIS  EF
Sbjct: 112 IDLAELFCKFDRQADAALNPYEFGELLKKIDPTISASEIYIAFNKFDENKTGSISFGEF 170


>UniRef50_Q2RQD4 Cluster: Predicted signal transduction protein
           containing EFhand domain; n=1; Rhodospirillum rubrum
           ATCC 11170|Rep: Predicted signal transduction protein
           containing EFhand domain - Rhodospirillum rubrum (strain
           ATCC 11170 / NCIB 8255)
          Length = 270

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 21/54 (38%), Positives = 30/54 (55%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           ++F++ D D S  ++ EE     +      N    E+LF Q DTDSSG ISL+E
Sbjct: 21  QLFQKTDTDSSGGVSLEELTAKGQTLPTGKNSQSTEDLFKQVDTDSSGEISLEE 74


>UniRef50_Q00ZY9 Cluster: Serine/threonine protein phosphatase; n=2;
           Ostreococcus|Rep: Serine/threonine protein phosphatase -
           Ostreococcus tauri
          Length = 749

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 7/85 (8%)
 Frame = +3

Query: 267 LSRGASGILGLGR----IFRRMDDDGSKLLNKEEFLYGIKET--GLE-LNKSEAEELFSQ 425
           +SR  S +L  G      F+ MD D S  +++ EF   ++ +   L  L++++   ++S 
Sbjct: 540 VSRITSAVLESGEDLVSAFKSMDIDNSGTISQSEFTMAVRASIPSLAILSEAQLVAVWSA 599

Query: 426 FDTDSSGSISLDEFLIKIRPPMSES 500
           FD D SGS+ LDEF   +   MS +
Sbjct: 600 FDADQSGSVDLDEFKAMLSNSMSSN 624


>UniRef50_Q9NF73 Cluster: EG:BACR7A4.12 protein; n=7;
           Endopterygota|Rep: EG:BACR7A4.12 protein - Drosophila
           melanogaster (Fruit fly)
          Length = 426

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 2/77 (2%)
 Frame = +3

Query: 246 GET--RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELF 419
           GET  +  C+S+G   +      FR  D DG   + KEE    ++  G      E +E+ 
Sbjct: 236 GETLHKRRCISKGQ--MREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEML 293

Query: 420 SQFDTDSSGSISLDEFL 470
            + D D  G++S +EF+
Sbjct: 294 QEIDVDGDGNVSFEEFV 310


>UniRef50_Q5DES8 Cluster: SJCHGC04850 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC04850 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 139

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 20/53 (37%), Positives = 31/53 (58%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           FR+MD DG+  L++ E    +K +G E  +S  +E    FD D  G I+L+E+
Sbjct: 9   FRKMDKDGNGTLSRREIRQCMKSSGFE--ESFIKEFIETFDLDGDGVITLEEY 59


>UniRef50_Q235N6 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 541

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 2/56 (3%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKE--TGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F+++D +G  +L KEE     K+  +  EL++   EE+F Q D D++G I+  EF+
Sbjct: 382 FKQLDLNGDGILTKEELKTAYKQIYSKKELSQINLEEIFDQIDLDNNGVINFTEFI 437


>UniRef50_P34368 Cluster: Uncharacterized calcium-binding protein
           C50C3.5; n=2; Caenorhabditis|Rep: Uncharacterized
           calcium-binding protein C50C3.5 - Caenorhabditis elegans
          Length = 202

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           +IF+ MDDDGS  ++  E    + E G++++    + +    D    G I  +EFL  +
Sbjct: 54  KIFQLMDDDGSGTISSSEVAKMLNELGIDVSPKVVQAVMRSSDVSGDGQIDFEEFLAAV 112


>UniRef50_Q1VKV7 Cluster: Putative uncharacterized protein; n=1;
           Psychroflexus torquis ATCC 700755|Rep: Putative
           uncharacterized protein - Psychroflexus torquis ATCC
           700755
          Length = 427

 Score = 39.9 bits (89), Expect = 0.044
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +3

Query: 300 GRIFRRMDDDGSKLLNKEEFLYGIKETGLE-LNKSEAEELFSQFDTDSSGSISLDEFL 470
           G  F+++DD+    +N+ E    +     E +N+ E E L + FD+D   SI L EF+
Sbjct: 112 GGFFKKLDDNADGKINRNELAKALNNHANEDVNEEEIERLMAMFDSDDDDSIDLLEFI 169


>UniRef50_A4RZC3 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 522

 Score = 39.9 bits (89), Expect = 0.044
 Identities = 20/57 (35%), Positives = 31/57 (54%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  IF+ +D DG+  ++ EEF+          +K+  +  F  FDTD  GSI+ +EF
Sbjct: 417 LEEIFKVVDLDGTGEIHWEEFIVATLARSKRESKAAIQRAFDYFDTDHDGSITAEEF 473



 Score = 39.5 bits (88), Expect = 0.059
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = +3

Query: 279 ASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISL 458
           A  I GL  +F+ +D D S  ++ +E   G+K    +   +E EE+F   D D +G I  
Sbjct: 376 AEEIAGLSVMFKELDKDKSGTVSIDELREGLKLQSSDA-AAELEEIFKVVDLDGTGEIHW 434

Query: 459 DEFLI 473
           +EF++
Sbjct: 435 EEFIV 439


>UniRef50_Q240Z4 Cluster: Protein kinase domain containing protein;
           n=4; Eukaryota|Rep: Protein kinase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 550

 Score = 39.9 bits (89), Expect = 0.044
 Identities = 21/59 (35%), Positives = 28/59 (47%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L L  IF   D D    L+K+EF   I+     L   E ++ F +FD D    +S DEF
Sbjct: 391 LNLKEIFSNFDKDKLGTLDKQEFEKLIRVVAPALKDHEIQKCFEKFDKDKDNQVSFDEF 449



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 18/59 (30%), Positives = 28/59 (47%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L +  IF + D D    L+++EF   I      +   E++ +F   DT +   ISL EF
Sbjct: 301 LNVNHIFDKFDKDKGGSLDEQEFFQFIVSIDPRITSFESKAIFRVVDTSNDKKISLQEF 359


>UniRef50_Q236L3 Cluster: EF hand family protein; n=1; Tetrahymena
           thermophila SB210|Rep: EF hand family protein -
           Tetrahymena thermophila SB210
          Length = 846

 Score = 39.9 bits (89), Expect = 0.044
 Identities = 19/56 (33%), Positives = 31/56 (55%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +IF   DD+ +  ++ +     IK  G+ +N  EA  L +  D D SG +SL+EF+
Sbjct: 184 KIFNAWDDNCTGAIDPKNAFDMIKSMGININFDEARVLIASADIDKSGDLSLNEFM 239


>UniRef50_A7RUR7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 930

 Score = 39.9 bits (89), Expect = 0.044
 Identities = 24/79 (30%), Positives = 40/79 (50%)
 Frame = +3

Query: 285 GILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           GILG GR+F   D + + +++  EFL G+       N  +++  F  F+ D S  +S  E
Sbjct: 73  GILG-GRLFTSFDKNQNGVIDLNEFLEGMSMCLEGSNDDKSQIAFDMFNLDGSDGVSAGE 131

Query: 465 FLIKIRPPMSESRRKL*NK 521
             I I+  +S + R +  K
Sbjct: 132 MYIAIKSVLSATTRTVNGK 150


>UniRef50_A7RJ74 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 134

 Score = 39.9 bits (89), Expect = 0.044
 Identities = 22/54 (40%), Positives = 29/54 (53%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +F + D DGS  L K E +  +K   L L+  +AE      D D SGS+S DEF
Sbjct: 4   LFTKYDKDGSGRLQKTEMMELLK-VDLGLDDKQAETFLLLVDKDGSGSVSFDEF 56



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 19/54 (35%), Positives = 30/54 (55%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +F++ D D S  +++EEF   + ETG   NK   ++   + D D +G IS  EF
Sbjct: 84  MFKKYDKDASGSIDREEFKQLMHETG---NKVNIDKALKKLDKDGNGQISFTEF 134


>UniRef50_A0D1T5 Cluster: Chromosome undetermined scaffold_34, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_34,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 788

 Score = 39.9 bits (89), Expect = 0.044
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGL-ELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           +F  +D DG+  L+K E     K   L  +++ E  ELF +FD +  G IS+ EFL  ++
Sbjct: 520 LFNDIDLDGNGYLSKVELKNIFKNKILVPVDEFELNELFMEFDKNRDGHISISEFLQIVK 579

Query: 483 PPMSESR 503
           P + + +
Sbjct: 580 PALDQDK 586



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLE-LNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F   D D +  +NK E      +  ++ L+K + E +F   D D  GSI + EF+
Sbjct: 728 QLFAAFDKDSNGKINKAELEEVFSKMRIKNLDKDDVELIFKALDRDEDGSIDVKEFI 784


>UniRef50_A0CKX5 Cluster: Chromosome undetermined scaffold_20, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_20,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 540

 Score = 39.9 bits (89), Expect = 0.044
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSE--AEELFSQFDTDSSGSISLDEFL 470
           +IF+ +D +G  LL+++E L G+    ++  +S+   +E+  + DTD SG +   EFL
Sbjct: 406 QIFKSLDKNGDGLLSQQEILQGMINVKMDKIESKLMVKEIMEKIDTDHSGRVDFTEFL 463


>UniRef50_A0BQR4 Cluster: Chromosome undetermined scaffold_121,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_121,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 861

 Score = 39.9 bits (89), Expect = 0.044
 Identities = 21/63 (33%), Positives = 35/63 (55%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L L  +++++D + + LL+ +EF   I     ++ K +   +F Q D D S SIS DEF 
Sbjct: 297 LDLQDVYQKIDANHNGLLDFDEFTTFISMIDKKVTKEDCYYIFQQIDKDGSNSISFDEFK 356

Query: 471 IKI 479
           + I
Sbjct: 357 LWI 359


>UniRef50_Q0KHU5 Cluster: 1-acylglycerophosphocholine
           O-acyltransferase 1; n=5; Eumetazoa|Rep:
           1-acylglycerophosphocholine O-acyltransferase 1 -
           Drosophila melanogaster (Fruit fly)
          Length = 533

 Score = 39.9 bits (89), Expect = 0.044
 Identities = 19/63 (30%), Positives = 36/63 (57%)
 Frame = +3

Query: 282 SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           S +L   R    +  + S+ +++E F+  ++  G +LN+ +A+ LF   DTD+ G +S D
Sbjct: 439 SDLLTFLRALIHLYSESSQQIDRESFVRLMRHAGGKLNEQKAQALFYALDTDNLGYVSFD 498

Query: 462 EFL 470
            F+
Sbjct: 499 SFV 501


>UniRef50_Q4SWQ4 Cluster: Chromosome 12 SCAF13545, whole genome
           shotgun sequence; n=5; Tetraodontidae|Rep: Chromosome 12
           SCAF13545, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 774

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 21/58 (36%), Positives = 33/58 (56%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  +F   D D S  + K EFL    E  L+++  EAE +F++ D D  G+++L EF+
Sbjct: 123 LRSLFHAYDVDHSGQIEKNEFLTICAE--LQVSTDEAERIFNRLDVDQDGTVTLMEFI 178



 Score = 37.9 bits (84), Expect = 0.18
 Identities = 20/58 (34%), Positives = 32/58 (55%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  +F   D D S  + K EFL   +E  L++   EA  +F + D D  G+++L+EF+
Sbjct: 14  LSLLFHAYDVDSSGRIEKNEFLTLCQE--LQILPREAAGIFERLDVDRDGTVTLEEFI 69


>UniRef50_A7P1W7 Cluster: Chromosome chr19 scaffold_4, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr19 scaffold_4, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 671

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 31/96 (32%), Positives = 47/96 (48%), Gaps = 5/96 (5%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNK---EEFLYGIKETGLEL-NKSEAE-ELFSQ 425
           L    GA  I  +  +F   D DG   ++    +E L GI+     L NK +A  ++  Q
Sbjct: 243 LLTDEGAPNISVIRGLFEETDLDGDDYISPAEIKELLLGIRFRKPHLINKEDAVLDVLGQ 302

Query: 426 FDTDSSGSISLDEFLIKIRPPMSESRRKL*NKHSRS 533
           FD D  G+I+ DEF+  I   + E+++ L   H RS
Sbjct: 303 FDIDGDGTITKDEFIAGISKWLDETKKGL---HDRS 335


>UniRef50_Q581Q7 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma|Rep: Putative uncharacterized protein -
           Trypanosoma brucei
          Length = 422

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 RLLCL-SRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFD 431
           RLLC  + GA+GI  L R      D G + + K +F+  ++E+G+ L+  + E +    D
Sbjct: 23  RLLCNGASGANGIRKLSRGCGIAVDSGGQSMEKAKFVEALEESGVSLDSEDIEAIVHVLD 82

Query: 432 TDSSGSISLDEFLIKIR 482
               G +   +F+  +R
Sbjct: 83  RSGDGVLDPTDFIAALR 99


>UniRef50_Q235P0 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 505

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNK-SEAEELFSQFDTDSSGSISLDEFLI 473
           L + F   D DG+  L K+E +        + +K S+ ++++SQFDT+    IS DEF +
Sbjct: 437 LQKAFEVFDSDGNNYLTKDELMDIFDSKFKQSDKESQIKQIYSQFDTNGDEQISFDEFKL 496

Query: 474 KIR 482
            ++
Sbjct: 497 MMK 499



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 16/62 (25%), Positives = 32/62 (51%)
 Frame = +3

Query: 285 GILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           G   + +IF  +D DG+  +N  EF+    +    +  S+ ++ F  FD+D +  ++ DE
Sbjct: 397 GDYDIDKIFTNVDLDGNGKINYSEFITACIQHENSMIDSKLQKAFEVFDSDGNNYLTKDE 456

Query: 465 FL 470
            +
Sbjct: 457 LM 458


>UniRef50_A0CNP3 Cluster: Chromosome undetermined scaffold_22, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_22,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 278

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 20/64 (31%), Positives = 36/64 (56%)
 Frame = +3

Query: 279 ASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISL 458
           A G   +  +F+  D + SK L+  EF++ +K+  L+ NK+    ++   D ++SGSI  
Sbjct: 210 AGGKKFIVNVFQEFDTNKSKDLSISEFIFLLKKLELDWNKAAINRVYRIMDQNNSGSIEE 269

Query: 459 DEFL 470
            EF+
Sbjct: 270 QEFI 273


>UniRef50_A0BZC3 Cluster: Chromosome undetermined scaffold_139,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_139,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 566

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 19/60 (31%), Positives = 36/60 (60%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + +  +F ++D +    +N ++F Y + +   +LNK +  +LF+ FD D +G ISL EF+
Sbjct: 503 VSVSTLFSQVDKERKGYINFKDFEYLLSKLD-KLNKCDIWDLFNLFDEDGNGQISLKEFM 561



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 17/55 (30%), Positives = 33/55 (60%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           L ++F ++D D +  L+ +EF + IK+   +L++    E+F  +D D+ G I L+
Sbjct: 418 LRQLFEQLDQDKNGYLDVKEFEFLIKKIAPKLSQENIVEIFKNYDQDNDGKIRLE 472


>UniRef50_P35085 Cluster: Calcium-binding protein; n=3;
           Eukaryota|Rep: Calcium-binding protein - Dictyostelium
           discoideum (Slime mold)
          Length = 467

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 22/54 (40%), Positives = 30/54 (55%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D + S  L+K+EF   IK  G   +K + + LF   D D SGS+S  EF+
Sbjct: 408 FRIHDSNCSGTLSKKEFKKLIKHLGYYFSKGQTKMLFHSIDRDYSGSLSEREFV 461


>UniRef50_Q4RTY6 Cluster: Chromosome 12 SCAF14996, whole genome
           shotgun sequence; n=12; Euteleostomi|Rep: Chromosome 12
           SCAF14996, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 179

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 16/62 (25%), Positives = 32/62 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D DG+  ++K+E    ++  G   N+ E E +  + D D  G +  +EF+  + P 
Sbjct: 6   FKVFDRDGNGFISKQELGMAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPK 65

Query: 489 MS 494
           ++
Sbjct: 66  LT 67


>UniRef50_A7E3L7 Cluster: Predicted NADPH oxidase-5; n=2;
           Tetraodontidae|Rep: Predicted NADPH oxidase-5 - Fugu
           rubripes (Japanese pufferfish) (Takifugu rubripes)
          Length = 857

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 31/89 (34%), Positives = 44/89 (49%), Gaps = 3/89 (3%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEEL---FSQFDTDSSGSISLDEFLI 473
           R F   D DGS  ++ +E L   K   L ++ SE ++L   F  +D D SGSI  DE  I
Sbjct: 5   RFFALFDSDGSSSISLDELL---KALDLLIHGSETDKLRFLFQVYDVDGSGSIDPDELRI 61

Query: 474 KIRPPMSESRRKL*NKHSRSLTRLVTVQS 560
            ++  + ES   L  +    LT LV  +S
Sbjct: 62  VLKSCLRESAISLPEEKLDDLT-LVLFES 89


>UniRef50_Q86SC6 Cluster: Notochord specific gene 8 protein; n=1;
           Ciona intestinalis|Rep: Notochord specific gene 8
           protein - Ciona intestinalis (Transparent sea squirt)
          Length = 136

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 15/56 (26%), Positives = 30/56 (53%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           R+F+  D D    L + E    +++ G +L+  + +++  Q DTD  G ++  EF+
Sbjct: 23  RVFQSYDVDNGGTLQRRELRNLLRQCGAKLSSKQCDDIIDQLDTDGDGEMNFAEFM 78


>UniRef50_A4VDW8 Cluster: Calcium-dependent protein kinase; n=1;
           Tetrahymena thermophila SB210|Rep: Calcium-dependent
           protein kinase - Tetrahymena thermophila SB210
          Length = 562

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSE-AEELFSQFDTDSSGSISLDEFL 470
           L  +F  +D +    L+KEE   G K    E+   + +E++FS+ D D++GSI  +EFL
Sbjct: 334 LSDLFIHLDTNKDGKLSKEEIFNGYKNLYGEVEARQISEKIFSEVDVDNNGSIDYNEFL 392


>UniRef50_A0BMU8 Cluster: Chromosome undetermined scaffold_117,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_117,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 422

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 19/53 (35%), Positives = 26/53 (49%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           F   D DGS  ++KEE        GL+ N  +  ++    DT+  G IS DEF
Sbjct: 12  FNIFDKDGSGSIDKEEIKELALNVGLQWNDQKLNKIIQALDTNGDGKISFDEF 64


>UniRef50_Q27178 Cluster: Caltractin ICL1C; n=16; Eukaryota|Rep:
           Caltractin ICL1C - Paramecium tetraurelia
          Length = 183

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 21/74 (28%), Positives = 33/74 (44%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +L +   F   D DG++ ++ +E    +   G E       ++ S  DTD SG I   EF
Sbjct: 41  VLEIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQIDFAEF 100

Query: 468 LIKIRPPMSESRRK 509
           L  +   +SE   K
Sbjct: 101 LKLMTARISERDSK 114


>UniRef50_UPI0000F1F9F5 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 760

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 4/66 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETG----LELNKSEAEELFSQFDTDSSGSISLDE 464
           L  IFR +D D S L++ E+F   +K       +E++     EL    DT++ GSI +DE
Sbjct: 651 LETIFRIVDTDNSGLISFEDFRQTLKLLSAYLKMEISDEVINELVVSMDTNNDGSIDIDE 710

Query: 465 FLIKIR 482
           F+   R
Sbjct: 711 FMEAFR 716


>UniRef50_UPI00006CAF3B Cluster: EF hand family protein; n=1;
           Tetrahymena thermophila SB210|Rep: EF hand family
           protein - Tetrahymena thermophila SB210
          Length = 1220

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + L  ++    D  +K L   +++  +K  G + + S  EE F  FD D SG+IS +EF
Sbjct: 457 MSLRHLYDSFSDPQTKELKIGQYIKMMKHIGFKYSDSIVEETFDFFDADKSGAISYEEF 515



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 17/60 (28%), Positives = 34/60 (56%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  G++F   D++ ++ +N +EF   +    + L+  E+ E F+ FD +  G ++ DEF+
Sbjct: 636 LTYGQLFSFFDENQNETINYQEFCQLLDVIQVRLSTEESIEAFATFDINQDGDVTQDEFI 695


>UniRef50_UPI0000585160 Cluster: PREDICTED: similar to GA22070-PA;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to GA22070-PA - Strongylocentrotus purpuratus
          Length = 208

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 22/60 (36%), Positives = 37/60 (61%), Gaps = 6/60 (10%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKET---GLEL---NKSEAEELFSQFDTDSSGSISLDEF 467
           +F++MD D +K ++K+E    ++ET   GLE    +K   + +F Q D D +G+IS +EF
Sbjct: 141 LFKKMDFDENKEISKDEIRRYMEETSIGGLEKFEDHKGAIDHMFKQMDKDKNGAISHEEF 200


>UniRef50_A3B3I3 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 162

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 18/66 (27%), Positives = 31/66 (46%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           R+FR+ D +G   +++ E     +  G  +   E   +  + D+D  G ISL EF     
Sbjct: 58  RVFRKFDANGDGRISRAELAALFRSVGHAVTDDEVARMMQEADSDGDGYISLGEFAAISA 117

Query: 483 PPMSES 500
           PP  ++
Sbjct: 118 PPPGDA 123


>UniRef50_A7SXT1 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 410

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSIS 455
           F  +D D S  L  +EF+ G+KETG+++N  E   L    D +  G I+
Sbjct: 360 FNTLDKDKSMSLTIKEFVDGLKETGIDMNYVELFNLIETLDKNKDGEIN 408


>UniRef50_A7SF35 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1586

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 22/68 (32%), Positives = 35/68 (51%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            IFRRMD D    L +E+F+ G+  T     + E E + S+F  + +G I   EF+  ++ 
Sbjct: 1214 IFRRMDHDRDGKLTREQFITGVLNTSFPTERWEMEIVASKF--ERNGLIDYKEFMNALKD 1271

Query: 486  PMSESRRK 509
              S  + K
Sbjct: 1272 KPSPEKPK 1279


>UniRef50_A0E7Y2 Cluster: Chromosome undetermined scaffold_82, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_82,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 434

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           LN+EEF   +   GL  +K+ AE+LF  FD DSSG++   E ++
Sbjct: 208 LNREEFQGLLISFGLGADKNLAEKLFYVFDEDSSGTVDYKELIV 251


>UniRef50_A0CW38 Cluster: Chromosome undetermined scaffold_3, whole
           genome shotgun sequence; n=5; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_3, whole genome shotgun
           sequence - Paramecium tetraurelia
          Length = 490

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 19/56 (33%), Positives = 26/56 (46%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L  I R +D DG+  +N  EFL    E  L + + +  + F   D D SG I   E
Sbjct: 387 LANIIRSIDTDGNGTINYTEFLAATMEKSLYMKEEKLYQAFKMLDLDGSGKIDKQE 442



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGL-ELNKSEAEELFSQFDTDSSGSISLDE 464
           I  LG++F+++D +G  +L  +E   G+  TG+ +  + +   +    DTD +G+I+  E
Sbjct: 349 ITDLGKLFKQLDKNGDGVLTIDELREGL--TGVTDSQQKDLANIIRSIDTDGNGTINYTE 406

Query: 465 FL 470
           FL
Sbjct: 407 FL 408


>UniRef50_A0C3Q6 Cluster: Chromosome undetermined scaffold_147,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_147,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 499

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 18/57 (31%), Positives = 32/57 (56%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +  IF+++D+D S  ++  +F+    + G  L+    +  F  FD D +G ISLD+F
Sbjct: 403 VNHIFQQVDNDNSGFIDYAQFVIAAIDRGQLLSTRNLQTTFLIFDKDKNGLISLDDF 459


>UniRef50_A7EAC5 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 602

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 16/54 (29%), Positives = 32/54 (59%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +F+ +D D    L+K+E     K+ GL ++K + +  F++ D ++ G I+ DE+
Sbjct: 89  LFQGIDKDHDNRLDKDELQVAFKKAGLTISKPKLDLFFTEVDMNNDGYITFDEW 142


>UniRef50_P15159 Cluster: Troponin C; n=10; Arthropoda|Rep: Troponin
           C - Tachypleus tridentatus (Japanese horseshoe crab)
          Length = 153

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D  G   +N  +    ++    +L + E +E+ ++ DTD SG++  DEF+
Sbjct: 91  LREAFRLYDKQGQGFINVSDLRDILRALDDKLTEDELDEMIAEIDTDGSGTVDFDEFM 148


>UniRef50_Q07167 Cluster: 16 kDa calcium-binding protein; n=2;
           Schistosoma|Rep: 16 kDa calcium-binding protein -
           Schistosoma mansoni (Blood fluke)
          Length = 143

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR- 482
           +F  +D D +  L +EE    +KE G+  N   A+++  + D +S G ISL+E+L  +R 
Sbjct: 10  VFHAIDKDKNGFLTREEIAQCLKEVGVCPNV--ADKIIKETDMNSDGKISLEEYLNALRK 67

Query: 483 -PP 488
            PP
Sbjct: 68  LPP 70


>UniRef50_P41208 Cluster: Centrin-2; n=113; Eukaryota|Rep: Centrin-2
           - Homo sapiens (Human)
          Length = 172

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG+  ++ +E    ++  G E  K E +++ S+ D + +G ++  +FL  +   
Sbjct: 37  FDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQK 96

Query: 489 MSESRRK 509
           MSE   K
Sbjct: 97  MSEKDTK 103


>UniRef50_UPI00004990CD Cluster: EF-hand calcium binding protein;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: EF-hand
           calcium binding protein - Entamoeba histolytica
           HM-1:IMSS
          Length = 145

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 16/55 (29%), Positives = 31/55 (56%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +F+R D +G  +L+K+E    ++     +   +  E F  +DTD +GS+  DE++
Sbjct: 82  LFKRCDVNGDGVLDKKEVFDILQSIDPNITIQDINETFDIYDTDKNGSLDFDEYM 136


>UniRef50_Q9ZSA0 Cluster: T4B21.15 protein; n=1; Arabidopsis
           thaliana|Rep: T4B21.15 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 584

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 22/92 (23%), Positives = 50/92 (54%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + F+ +D D +  + ++E    +KE G+  +++  +E+ S+ DTD+ G I+ +EF   +R
Sbjct: 476 KAFQHLDKDKNGHITRDELESAMKEYGMG-DEASIKEVISEVDTDNDGKINFEEFRAMMR 534

Query: 483 PPMSESRRKL*NKHSRSLTRLVTVQSQLMTLK 578
              ++ +     KH     ++V +  Q +T++
Sbjct: 535 CGTTQPK----GKHKTMFRKMVYI-FQCLTMR 561


>UniRef50_Q9SDM4 Cluster: Calcium-dependent protein kinase; n=2;
           Chlamydomonadales|Rep: Calcium-dependent protein kinase
           - Dunaliella tertiolecta
          Length = 595

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I G+  +F  +D D S  +  +EF   + + G  + + E E++  + D D  G+I  +EF
Sbjct: 458 ISGMREMFMDIDKDKSGNITIDEFAAALHKKGQIVTEKEIEKIMKEADVDGDGTIDYEEF 517

Query: 468 L 470
           L
Sbjct: 518 L 518



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +I +  D DG   ++ EEFL      G    +   +  F  FD D +G IS +E +
Sbjct: 499 KIMKEADVDGDGTIDYEEFLAATINLGKLQREENLKTAFEHFDLDGNGEISHNELV 554



 Score = 32.7 bits (71), Expect = 6.7
 Identities = 15/58 (25%), Positives = 30/58 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           F   D DG+  ++  E +  + + G+  N +  +++  + D D +G I  +EF I +R
Sbjct: 537 FEHFDLDGNGEISHNELVQCLSKLGI--NDAHVKDIIKEVDADGNGQIDYNEFCIMMR 592


>UniRef50_Q0JI08 Cluster: Os01g0832300 protein; n=7;
           Magnoliophyta|Rep: Os01g0832300 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 576

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 20/72 (27%), Positives = 35/72 (48%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R++     A  +  +  +F+ MD D   +++ EE   GI + G  L +SE + L    DT
Sbjct: 394 RVIADHLSAEEVEDIKEMFKAMDTDNDGIVSYEELKSGIAKFGSHLAESEVQMLIEAVDT 453

Query: 435 DSSGSISLDEFL 470
           +   ++   EFL
Sbjct: 454 NGKDALDYGEFL 465



 Score = 36.7 bits (81), Expect = 0.41
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L R F   D DG+  +  EE    + + G   +     ++  + DTD  G IS DEF+  
Sbjct: 480 LRRAFLFFDKDGNGYIEPEELREALVDDGAGDSMEVVNDILQEVDTDKDGKISYDEFVAM 539

Query: 477 IR 482
           ++
Sbjct: 540 MK 541


>UniRef50_Q01GB2 Cluster: Ca2+ binding protein, contains EF-hand
           motifs; n=2; Ostreococcus|Rep: Ca2+ binding protein,
           contains EF-hand motifs - Ostreococcus tauri
          Length = 458

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 17/59 (28%), Positives = 34/59 (57%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           +FR  D DG+ + +  E+L+    T L  ++  +  +F ++D D SG + +DEF + ++
Sbjct: 207 LFRLFDTDGNGIFDFAEYLFF--NTLLNTDRQSSLSVFQKYDADGSGELDVDEFTMMMK 263


>UniRef50_Q4QIT3 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 345

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 23/62 (37%), Positives = 35/62 (56%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L R+F  MD +G   ++  EF + +    L  +  E E LFS   TD+SG++SL+EF   
Sbjct: 69  LQRLFESMDANGDGYISFPEFRFLMSL--LTSDPHEVEALFSIVSTDNSGTLSLEEFANV 126

Query: 477 IR 482
           +R
Sbjct: 127 LR 128


>UniRef50_Q3I4V9 Cluster: Putative calcium-dependant protein kinase;
           n=1; Moneuplotes crassus|Rep: Putative calcium-dependant
           protein kinase - Euplotes crassus
          Length = 510

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 16/61 (26%), Positives = 34/61 (55%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I+ L  IF+ +D + +  ++ +E    +KE G+++  S+  ++    D + +G I+  EF
Sbjct: 365 IIELKEIFKEIDINCTGTISVDELKQSLKEAGIKMKTSQVRKIVQNLDYEENGEINYSEF 424

Query: 468 L 470
           L
Sbjct: 425 L 425


>UniRef50_Q24DL4 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 861

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 19/59 (32%), Positives = 32/59 (54%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + L  +F++ D      L  +EF   +K     L++SE E +F++FD D   +IS +EF
Sbjct: 468 IDLEDLFKKYDFSHDSKLEMKEFSKLMKSIDNTLDRSEIEYIFNKFDDDKDNTISFEEF 526


>UniRef50_A0CNQ2 Cluster: Chromosome undetermined scaffold_22, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_22,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 816

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +IF   D+D +  ++ +     I+  G+ +N  EA  L +  D D S  + LDEFL
Sbjct: 188 KIFNLWDEDSNGAVSVKNLYNMIQRLGININIDEARVLLASADMDGSSDLGLDEFL 243


>UniRef50_A0C1X6 Cluster: Chromosome undetermined scaffold_143,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_143,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 489

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 18/58 (31%), Positives = 29/58 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           F+R+D D S  ++K E +       + +   + EEL  Q D +  G I   EF+I +R
Sbjct: 423 FKRIDQDNSGRISKNELMDIFHTDTISIKDLDIEELIKQADINKDGEIDYQEFMILLR 480



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 6/67 (8%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLE------LNKSEAEELFSQFDTDSSGS 449
           +  L ++F  +D DG+ +++ EE + G+  TG +      ++K+   +LF   D D SG 
Sbjct: 340 VTSLRQLFVSLDKDGNGMISLEEMIEGL--TGFKNMKHKNMDKNFVTQLFKAMDIDQSGY 397

Query: 450 ISLDEFL 470
           +   EF+
Sbjct: 398 VDYSEFI 404


>UniRef50_Q7S0X6 Cluster: Putative uncharacterized protein
           NCU06948.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU06948.1 - Neurospora crassa
          Length = 263

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +F   D D +  +  EE    ++E GL  +K+E E+L ++ DT+  G I+ +EFL
Sbjct: 19  VFDIFDKDHTGDITAEELGVVMRELGLNPSKAELEDLVNEADTNKDGVINFEEFL 73


>UniRef50_Q59YC3 Cluster: Mitochondrial carrier family and EF hand
           protein; n=4; Saccharomycetales|Rep: Mitochondrial
           carrier family and EF hand protein - Candida albicans
           (Yeast)
          Length = 572

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 4/71 (5%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEA--EELFSQFDTDSSGSISLDEF--LIK 476
           F ++D D    LNK +F+  +KE+ L +  S A  + LF Q D++  G I+ DEF   + 
Sbjct: 119 FNQLDQDNDGRLNKSDFIRYLKES-LHVKPSVANIDLLFKQLDSNEDGYINYDEFREFLL 177

Query: 477 IRPPMSESRRK 509
           + P +  SR K
Sbjct: 178 LVPRLQGSRIK 188


>UniRef50_A6RJY2 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 951

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 20/60 (33%), Positives = 34/60 (56%)
 Frame = +3

Query: 396 KSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTL 575
           K EAEE+F   D D +G ISLDE ++K+   +   R+ + N   R + + + V  Q++ +
Sbjct: 420 KMEAEEIFEALDNDGNGDISLDEMIMKV-VDIGRERKSIGNS-MRDVGQAIGVLDQVLLI 477


>UniRef50_P32930 Cluster: Oncomodulin; n=11; Euteleostomi|Rep:
           Oncomodulin - Homo sapiens (Human)
          Length = 109

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEE---FLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FR +D+D S  L++EE   FL   +    EL +SE + L +  D D  G I  +EF
Sbjct: 47  VFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEF 103


>UniRef50_Q9BXU9 Cluster: Calneuron-1; n=31; Euteleostomi|Rep:
           Calneuron-1 - Homo sapiens (Human)
          Length = 219

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 17/64 (26%), Positives = 32/64 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           FR +D DG+  ++K+E    ++  G   ++ E   +  + D D  G +  DEF+  + P 
Sbjct: 45  FRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPK 104

Query: 489 MSES 500
           +  S
Sbjct: 105 LVSS 108


>UniRef50_Q9D6P8 Cluster: Calmodulin-like protein 3; n=640;
           Eukaryota|Rep: Calmodulin-like protein 3 - Mus musculus
           (Mouse)
          Length = 149

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 16/54 (29%), Positives = 30/54 (55%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG+  ++  E  + + + G +L+  E +E+    DTD  G ++ +EF+
Sbjct: 90  FRVFDKDGNGFVSAAELRHVMTKLGEKLSDEEVDEMIQAADTDGDGQVNYEEFV 143


>UniRef50_UPI0000D66B4F Cluster: PREDICTED: similar to
           Calcyphosphine 2; n=2; Mus musculus|Rep: PREDICTED:
           similar to Calcyphosphine 2 - Mus musculus
          Length = 630

 Score = 37.9 bits (84), Expect = 0.18
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = +3

Query: 273 RGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEE--LFSQFDTDSSG 446
           +GA  + GLGR F+ +D +G+ LL K +F   +K   LE+ + + E   L  Q    +  
Sbjct: 433 KGARILTGLGRYFQGLDKEGNGLLEKADFPKALKTFHLEVCEQDFESSWLTLQGYGHNEN 492

Query: 447 SISLDEFLIKIRPPMSESRRKL*NK 521
            +   EF   I   M+E R+    K
Sbjct: 493 KVDCGEFKCAIFGEMNEYRKSFVRK 517


>UniRef50_Q9LUQ0 Cluster: Similarity to; n=18; Magnoliophyta|Rep:
           Similarity to - Arabidopsis thaliana (Mouse-ear cress)
          Length = 456

 Score = 37.9 bits (84), Expect = 0.18
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           R+F  +D +G  +++ EE +  ++E G      +AEE+    D++S GS+S DEF
Sbjct: 350 RVFCLLDKNGDGMISIEELMEVMEELGAP--GEDAEEMMQLLDSNSDGSLSSDEF 402


>UniRef50_Q4QI25 Cluster: Putative uncharacterized protein; n=6;
           Trypanosomatidae|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 582

 Score = 37.9 bits (84), Expect = 0.18
 Identities = 15/54 (27%), Positives = 30/54 (55%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +F   D+ G+++++ ++F  G    GL+ + +  E+LF + D +    IS  EF
Sbjct: 181 VFSEFDNKGTRMIDVDDFKQGFHNMGLDFSSATVEDLFERADLNHDHRISYAEF 234


>UniRef50_Q23YC0 Cluster: EF hand family protein; n=1; Tetrahymena
           thermophila SB210|Rep: EF hand family protein -
           Tetrahymena thermophila SB210
          Length = 743

 Score = 37.9 bits (84), Expect = 0.18
 Identities = 17/60 (28%), Positives = 29/60 (48%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           +F+  D +G   L   +F   +    ++ N  E   +FS+ +TD  G +S DEF    +P
Sbjct: 566 LFKAFDSEGQSYLRFSKFCELLSSINIKFNDQEIGMIFSRIETDKDGFLSKDEFNEVFKP 625


>UniRef50_Q5THR3 Cluster: DJ-1-binding protein; n=29;
            Euteleostomi|Rep: DJ-1-binding protein - Homo sapiens
            (Human)
          Length = 1501

 Score = 37.9 bits (84), Expect = 0.18
 Identities = 17/61 (27%), Positives = 34/61 (55%)
 Frame = +3

Query: 297  LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
            L + F   D++G+ +L + +    +    + L   E E+L++++DT+  G I+  EFL K
Sbjct: 852  LSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQK 911

Query: 477  I 479
            +
Sbjct: 912  L 912


>UniRef50_Q9NJU9 Cluster: Calcium-dependent protein kinase 3; n=6;
           Plasmodium|Rep: Calcium-dependent protein kinase 3 -
           Plasmodium falciparum (isolate 3D7)
          Length = 562

 Score = 37.9 bits (84), Expect = 0.18
 Identities = 19/54 (35%), Positives = 30/54 (55%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F  +D+DG   + KE+   G+++ GL+L     + L  Q D+D SG I   EF+
Sbjct: 427 FLVLDEDGKGYITKEQLKKGLEKDGLKL-PYNFDLLLDQIDSDGSGKIDYTEFI 479


>UniRef50_UPI0000E4A189 Cluster: PREDICTED: similar to dystonin; n=2;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            dystonin - Strongylocentrotus purpuratus
          Length = 3054

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
            FR++D D    L + EF  GI  +    N+ E   +  +FD D  G I   EF+  + P 
Sbjct: 2701 FRKLDLDRDGKLTRMEFSDGIINSKFPTNQLEMNAVADKFDRDDDGYIDYKEFIAALWPE 2760

Query: 489  MSESR 503
             S  +
Sbjct: 2761 KSSGK 2765


>UniRef50_UPI0000D9C1D1 Cluster: PREDICTED: similar to
           Calmodulin-like protein 3 (Calmodulin-related protein
           NB-1) (CaM-like protein) (CLP); n=1; Macaca mulatta|Rep:
           PREDICTED: similar to Calmodulin-like protein 3
           (Calmodulin-related protein NB-1) (CaM-like protein)
           (CLP) - Macaca mulatta
          Length = 175

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG+  ++  E  + +   G +L+  E +E+    DTD  G ++ +EF+
Sbjct: 116 FRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFV 169


>UniRef50_Q4RQA7 Cluster: Chromosome 17 SCAF15006, whole genome
            shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
            Chromosome 17 SCAF15006, whole genome shotgun sequence -
            Tetraodon nigroviridis (Green puffer)
          Length = 6846

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 6515 FRRIDKDQDGKVTRQEFIEGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 6573


>UniRef50_Q4KMH6 Cluster: Zgc:110594; n=4; Clupeocephala|Rep:
           Zgc:110594 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 322

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 18/57 (31%), Positives = 31/57 (54%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  I +++D +  K L  EE    I+    +    +AEE F +FD+++ G +S DE+
Sbjct: 75  LVEIVKKIDTNSDKYLTPEEITVWIQRVYRKYALDDAEERFPEFDSNNDGLVSWDEY 131



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +3

Query: 327 DGSKLLNKEEFLYGIKETGLE-LNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           DGS  LN  EFL     + ++ +     E++ S++D D  G ISL EF+  +R
Sbjct: 173 DGSAGLNLTEFLAFTHPSEVDHMTDFAIEDVLSEYDLDKDGFISLSEFIGDLR 225


>UniRef50_Q9LRN6 Cluster: Genomic DNA, chromosome 3, P1 clone:MUJ8;
           n=2; core eudicotyledons|Rep: Genomic DNA, chromosome 3,
           P1 clone:MUJ8 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 229

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = +3

Query: 285 GILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           G+  +  +F   D+D +  ++ EE    ++E  L L+  E + L+S  D D S  I  +E
Sbjct: 54  GLRNIRSVFESYDNDTNGTIDIEELKKCLEELKLSLSDEEVKGLYSWCDVDGSKGIQFNE 113

Query: 465 FLI 473
           F++
Sbjct: 114 FIV 116


>UniRef50_A7PHF4 Cluster: Chromosome chr17 scaffold_16, whole genome
           shotgun sequence; n=13; core eudicotyledons|Rep:
           Chromosome chr17 scaffold_16, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 143

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F + D+D    L+  E    +   G EL   EAE +  Q D+D  G +SL++F+
Sbjct: 9   QVFNQFDEDHDGKLSPSELTRCVGLIGGELPLKEAEAVVQQLDSDGDGLLSLEDFI 64


>UniRef50_A2X9B1 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 174

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 3/64 (4%)
 Frame = +3

Query: 285 GILGLGRIFRRMDDDGSKLLNKEEFLYGIKET---GLELNKSEAEELFSQFDTDSSGSIS 455
           G+  L   F   D+DG+ ++  EE    ++     G++L   +  E+ +  D+D  G IS
Sbjct: 103 GLDALRAAFDEYDEDGNGVITAEELRRALRRLNLDGMDLTAEQCAEIVAAVDSDGDGVIS 162

Query: 456 LDEF 467
            DEF
Sbjct: 163 FDEF 166


>UniRef50_Q9GN70 Cluster: Troponin C; n=1; Perinereis vancaurica
           tetradentata|Rep: Troponin C - Perinereis vancaurica
           tetradentata (Sandworm)
          Length = 152

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 17/57 (29%), Positives = 30/57 (52%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  IFR +D +    +N  E  + +K  G +  + + +++ +  DTD SG +  DEF
Sbjct: 90  LKEIFRVLDKEKKGEVNVNELRWILKNLGDDFTEEDIDDMINDVDTDGSGWVDYDEF 146


>UniRef50_Q23G85 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 744

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSE--AEELFSQFDTDSSGSISLDEFLI 473
           F  +D DG   L+KEE + G +    +  +++   E +F + D D SG +S  EFL+
Sbjct: 396 FIELDKDGDGQLSKEELIEGYERLIGDKQQAQKIVEYVFKEIDYDGSGKVSFQEFLV 452



 Score = 32.7 bits (71), Expect = 6.7
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           +F+ +D DGS  ++ +EFL         + K    + F   D D +G I+ DE
Sbjct: 433 VFKEIDYDGSGKVSFQEFLVATASKEQIITKENLYKAFDLIDEDRNGQITKDE 485


>UniRef50_Q20358 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 159

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 19/66 (28%), Positives = 34/66 (51%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L L   F  +D D    L++ E    ++   +E  + E + +F + DTD +G IS +EF+
Sbjct: 22  LQLSETFDLLDVDKDGRLSRNEIAALLRTINVEPTRVELDFIFGEMDTDKTGKISKEEFV 81

Query: 471 IKIRPP 488
             ++ P
Sbjct: 82  NYMKSP 87


>UniRef50_Q0E8F2 Cluster: CG32103-PA, isoform A; n=7;
           Endopterygota|Rep: CG32103-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 583

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 21/62 (33%), Positives = 32/62 (51%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L RIF ++D DG   ++  +    + E G  L+   AE+   Q D D SG++   EFL  
Sbjct: 117 LERIFNKLDRDGDGRIDIHDLSAALHEFG--LSSVYAEKFLQQSDKDQSGNVGFAEFLHY 174

Query: 477 IR 482
           +R
Sbjct: 175 VR 176


>UniRef50_A7SZ62 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 550

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 16/54 (29%), Positives = 26/54 (48%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +F + D D S  + ++EF  G+K  G+ ++  +   L    D D  G I   EF
Sbjct: 484 LFNQFDKDNSLSVTRDEFYTGLKGIGVPMSDKDLTMLIDLLDEDGDGEIDFSEF 537


>UniRef50_A0BE66 Cluster: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 208

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 16/50 (32%), Positives = 30/50 (60%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +D DGS L++ EEFL     +G   ++   E+L+ +FD+   G ++ ++F
Sbjct: 111 LDQDGSSLIDFEEFLNIFGFSGTIEDEQVLEKLYQEFDSSGQGKVAYEDF 160



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 18/61 (29%), Positives = 26/61 (42%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +L +   F   DDD S  ++  E    I   G+E +  E   +    D D S  I  +EF
Sbjct: 65  VLKIKECFDIFDDDKSGSISPNEMKNAIIALGMEQSAEEIVNMIQDLDQDGSSLIDFEEF 124

Query: 468 L 470
           L
Sbjct: 125 L 125


>UniRef50_Q5TBT1 Cluster: Dystonin; n=33; Euteleostomi|Rep: Dystonin -
            Homo sapiens (Human)
          Length = 5457

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 5093 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 5151


>UniRef50_Q6CGC2 Cluster: Similar to tr|O74435 Schizosaccharomyces
           pombe EF-hand calcium-binding protein; n=1; Yarrowia
           lipolytica|Rep: Similar to tr|O74435 Schizosaccharomyces
           pombe EF-hand calcium-binding protein - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 196

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 15/56 (26%), Positives = 31/56 (55%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           R F+  D+D + ++  +      +E    +++SE + +  +FD D  G I+L+EF+
Sbjct: 135 RAFQLFDEDNTGIITIKNLRKVARELNENIDESELQAMIEEFDLDQDGGINLEEFI 190


>UniRef50_P51879 Cluster: Oncomodulin; n=4; Mammalia|Rep:
           Oncomodulin - Mus musculus (Mouse)
          Length = 109

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEE---FLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           IF+ +D+D S  L+++E   FL   +    EL +SE + L    D D  G I  DEF
Sbjct: 47  IFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEF 103


>UniRef50_Q96PK2 Cluster: Microtubule-actin cross-linking factor 1,
            isoform 4; n=26; Fungi/Metazoa group|Rep:
            Microtubule-actin cross-linking factor 1, isoform 4 -
            Homo sapiens (Human)
          Length = 5938

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5594 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5652


>UniRef50_Q9QXZ0 Cluster: Microtubule-actin cross-linking factor 1;
            n=38; cellular organisms|Rep: Microtubule-actin
            cross-linking factor 1 - Mus musculus (Mouse)
          Length = 5327

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 4983 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5041


>UniRef50_Q9UPN3 Cluster: Microtubule-actin cross-linking factor 1,
            isoforms 1/2/3/5; n=44; Amniota|Rep: Microtubule-actin
            cross-linking factor 1, isoforms 1/2/3/5 - Homo sapiens
            (Human)
          Length = 5430

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5092 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5150


>UniRef50_P27482 Cluster: Calmodulin-like protein 3; n=476; cellular
           organisms|Rep: Calmodulin-like protein 3 - Homo sapiens
           (Human)
          Length = 149

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG+  ++  E  + +   G +L+  E +E+    DTD  G ++ +EF+
Sbjct: 90  FRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFV 143


>UniRef50_O94833 Cluster: Bullous pemphigoid antigen 1, isoforms
            6/9/10; n=42; Euteleostomi|Rep: Bullous pemphigoid
            antigen 1, isoforms 6/9/10 - Homo sapiens (Human)
          Length = 5171

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 4794 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 4852


>UniRef50_Q91ZU6 Cluster: Bullous pemphigoid antigen 1, isoforms
            1/2/3/4; n=16; cellular organisms|Rep: Bullous pemphigoid
            antigen 1, isoforms 1/2/3/4 - Mus musculus (Mouse)
          Length = 7389

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 7024 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 7082


>UniRef50_UPI00006CFB88 Cluster: Phosphatidylinositol-specific
           phospholipase C, X domain containing protein; n=1;
           Tetrahymena thermophila SB210|Rep:
           Phosphatidylinositol-specific phospholipase C, X domain
           containing protein - Tetrahymena thermophila SB210
          Length = 989

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 25/93 (26%), Positives = 48/93 (51%), Gaps = 2/93 (2%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           +F   D DG+K L+ EE    ++E  + +NK   ++LF  +D + +  I   EF+  IR 
Sbjct: 149 LFISADKDGNKQLDLEEVKKLLQELHVSVNKKYLKQLFQTYDYNQNNQIDQGEFINIIRD 208

Query: 486 -PMSESRRKL*NKHSRSLTRLVTV-QSQLMTLK 578
               +    +  ++ +S  + V++ Q  LMT++
Sbjct: 209 ISKKDELLTIFKQYCQSYNQQVSLDQEGLMTIE 241


>UniRef50_UPI00006CBAA5 Cluster: EF hand family protein; n=1;
           Tetrahymena thermophila SB210|Rep: EF hand family
           protein - Tetrahymena thermophila SB210
          Length = 498

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIK--ETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F+ MD D +  L++EE L  +K  +   ++N    +ELF   DT+S G +SL+  L
Sbjct: 47  FKIMDKDNNGFLSQEEILNYLKYEKQVRQINMKVIQELFDSMDTNSDGRVSLESEL 102


>UniRef50_UPI00006CAFC4 Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 682

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 18/57 (31%), Positives = 30/57 (52%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L ++F+  D      L  +EF   +K+   +LN+ E E +F++FD+D    I   EF
Sbjct: 312 LMQLFKYFDLTNDSKLTIKEFEQLMKQIDKDLNREEIEYIFNKFDSDGDNKIDFTEF 368


>UniRef50_UPI00005A0143 Cluster: PREDICTED: similar to
           Calmodulin-related protein NB-1 (Calmodulin-like
           protein) (CLP); n=1; Canis lupus familiaris|Rep:
           PREDICTED: similar to Calmodulin-related protein NB-1
           (Calmodulin-like protein) (CLP) - Canis familiaris
          Length = 409

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG+ L++  E  + +   G +L+  E +E+    D D  G ++ +EF+
Sbjct: 350 FRVFDKDGNGLVSAAELRHVMTRLGEKLSDEEVDEMIRAADVDGDGQVNYEEFV 403


>UniRef50_UPI000058509B Cluster: PREDICTED: similar to Calmodulin
           (CaM); n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Calmodulin (CaM) -
           Strongylocentrotus purpuratus
          Length = 162

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 17/64 (26%), Positives = 33/64 (51%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + FR++D +G + L+ +E    +      + K + EE+  + D +  G +S+ EF   I 
Sbjct: 97  KAFRKLDKNGDRFLSPDELRQAMSTIDPLMAKEKIEEMIYKADLNDDGYVSITEFAKMIY 156

Query: 483 PPMS 494
           P +S
Sbjct: 157 PELS 160


>UniRef50_Q9F6V9 Cluster: Calsymin; n=3; Rhizobium|Rep: Calsymin -
           Rhizobium etli
          Length = 293

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 18/55 (32%), Positives = 32/55 (58%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           L  +   +D DG  L++K EF+ G      ++ + +A  LF  FD++ +GS+S+D
Sbjct: 158 LSSMLSDLDTDGDGLISKAEFVAGRPS---DVTEDQAGTLFDSFDSEGAGSLSVD 209



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           G G    ++D DG   ++K EF   +     ++ + +A  LF  FD++ +GS+S+D    
Sbjct: 79  GEGMDVSQLDTDGDGYVSKAEF---VAARPSDVTEDQAGTLFDSFDSEGTGSLSVDALAE 135

Query: 474 KIRPPMSE 497
            +    SE
Sbjct: 136 AMSAQQSE 143



 Score = 32.7 bits (71), Expect = 6.7
 Identities = 15/47 (31%), Positives = 31/47 (65%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISL 458
           +D +G  L++ EEF+ G  +   ++ +S+A +LF+  D+  +GS+S+
Sbjct: 245 LDTNGDGLVSLEEFMAGKPD---DVTESQASQLFALLDSSGAGSLSV 288


>UniRef50_Q22DL9 Cluster: EF hand family protein; n=1; Tetrahymena
           thermophila SB210|Rep: EF hand family protein -
           Tetrahymena thermophila SB210
          Length = 669

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 22/83 (26%), Positives = 38/83 (45%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           LCL +  +  + L ++F+++D         EE L  + +  +     E + L  Q DTD 
Sbjct: 31  LCLFKNPN--IDLFKVFQQIDVKRKGFFKNEELLDFLCKNNIYATTREVKFLTDQLDTDK 88

Query: 441 SGSISLDEFLIKIRPPMSESRRK 509
              ++ D FL  + P   E+ RK
Sbjct: 89  DSIVTYDNFLHFLAPQQDENLRK 111



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 19/71 (26%), Positives = 31/71 (43%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F  +D  G   + +++    +K+ GL   K +    F Q+D D S  +   EF+    P 
Sbjct: 462 FYFIDLQGKGYITQQDLHVNLKQIGLNPTKDQIYLFFKQYDLDFSNRLEFSEFVKTFIPI 521

Query: 489 MSESRRKL*NK 521
             E R  L N+
Sbjct: 522 DQEYRNILNNR 532


>UniRef50_A7SEX3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 546

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 17/53 (32%), Positives = 29/53 (54%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           +F+R D D S  L+ +EF  G+++ G  +  +EA  L    D D+  +I  +E
Sbjct: 327 VFKRFDTDNSGKLSYDEFFLGMQDLGAPVTMTEAYMLAMSLDEDNDETIDYNE 379


>UniRef50_A7S3W3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 72

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 19/54 (35%), Positives = 27/54 (50%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FRR D DG   L+ EEF  G+++     N  E   L  + D D +G +   EF
Sbjct: 15  LFRRFDVDGDGELSYEEFYAGMRDLNAPANSLELYVLAKKLDRDGNGLLDYLEF 68


>UniRef50_Q5AK12 Cluster: Putative uncharacterized protein CNB1;
           n=1; Candida albicans|Rep: Putative uncharacterized
           protein CNB1 - Candida albicans (Yeast)
          Length = 201

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 22/58 (37%), Positives = 31/58 (53%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L + F ++D DGS  ++K+EFL      G+  N   A  L   FD D  GSI  +EF+
Sbjct: 53  LRKRFMKLDKDGSGQIDKQEFL---SIPGISSNPL-ATRLMDVFDKDGDGSIDFEEFI 106


>UniRef50_P25071 Cluster: Calmodulin-related protein 3,
           touch-induced; n=3; Arabidopsis thaliana|Rep:
           Calmodulin-related protein 3, touch-induced -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 324

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           IL     FR  D +G   +   E    ++  G    K+E +++ ++ D D  G+IS  EF
Sbjct: 189 ILEFREAFRVFDKNGDGYITVNELRTTMRSLGETQTKAELQDMINEADADGDGTISFSEF 248

Query: 468 LIKIRPPMSESRRK 509
           +  +   M +++ K
Sbjct: 249 VCVMTGKMIDTQSK 262


>UniRef50_P25070 Cluster: Calmodulin-related protein 2,
           touch-induced; n=8; Magnoliophyta|Rep:
           Calmodulin-related protein 2, touch-induced -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 161

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F+R D +G   ++ +E    I+      +  E   +  QFD D +G I LDEF+
Sbjct: 20  KVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQFDLDGNGFIDLDEFV 75


>UniRef50_Q9Y2I6 Cluster: Ninein-like protein; n=10; Eutheria|Rep:
           Ninein-like protein - Homo sapiens (Human)
          Length = 1382

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLE-LNKSEAEELFSQFDTDSSGSISLDEF 467
           L+++E     +  GL+ L K E E+LF++ D D  G +SL+EF
Sbjct: 216 LSEQELAVVCQSVGLQGLEKEELEDLFNKLDQDGDGKVSLEEF 258


>UniRef50_O15865 Cluster: Calcium-dependent protein kinase 2; n=2;
           Plasmodium falciparum|Rep: Calcium-dependent protein
           kinase 2 - Plasmodium falciparum (isolate K1 / Thailand)
          Length = 513

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I  L  IF  +D D S  L+ +E L G+K+ G +    +  ++    D+++SG I   +F
Sbjct: 372 INNLRNIFIALDVDNSGTLSSQEILDGLKKIGYQKIPPDIHQVLRDIDSNASGQIHYTDF 431

Query: 468 L 470
           L
Sbjct: 432 L 432


>UniRef50_UPI000156019D Cluster: PREDICTED: similar to KIAA0980
           protein; n=1; Equus caballus|Rep: PREDICTED: similar to
           KIAA0980 protein - Equus caballus
          Length = 1215

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLE-LNKSEAEELFSQFDTDSSGSISLDEF 467
           I+  +    S  LN++E     +  GL+ L ++E E+LF + D D  G +SL+EF
Sbjct: 320 IWEELGVGSSGHLNEQELALVCQSIGLQGLEEAELEDLFHKLDQDGDGRVSLEEF 374


>UniRef50_UPI0000E49932 Cluster: PREDICTED: similar to LOC553519
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to LOC553519 protein -
           Strongylocentrotus purpuratus
          Length = 632

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L + F  +D  G+  ++ EEF   ++E  + LN  E + L  +FDT   G +S  EFL
Sbjct: 449 LRKEFLNLDTYGTGFVSAEEFRDVLQELCVHLNAYELDMLSRKFDTQKDGRVSYVEFL 506


>UniRef50_Q4RRW1 Cluster: Chromosome 7 SCAF15001, whole genome
           shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 7
           SCAF15001, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 239

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           FR +D DG+  ++K+E    ++  G   ++ E   +  + D D  G +  +EF+  + P 
Sbjct: 45  FRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFEEFMTILGPK 104

Query: 489 MSES 500
           +  S
Sbjct: 105 LLSS 108


>UniRef50_Q9FPM8 Cluster: JD1; n=4; core eudicotyledons|Rep: JD1 -
           Nicotiana tabacum (Common tobacco)
          Length = 407

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           F    DDG   + ++EF Y +  +   L+ +E   LF+ FDTD  G IS  + +  +R
Sbjct: 331 FTACGDDGKNYILEQEFGYSLMLSLPGLSNNEIHGLFTLFDTDHDGKISKADLIACLR 388


>UniRef50_Q8T378 Cluster: SCBP3 protein; n=3; Lumbricus
           terrestris|Rep: SCBP3 protein - Lumbricus terrestris
           (Common earthworm)
          Length = 177

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 20/55 (36%), Positives = 29/55 (52%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           F  +D +G  L+ K+EF    K  G+      AE+ F   DT+  G IS +EF+I
Sbjct: 103 FSAVDGNGDGLIQKDEFQLFFKLLGIP---ESAEKSFEAIDTNKDGDISKEEFVI 154


>UniRef50_Q8IJC7 Cluster: Centrin, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Centrin, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 249

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + F+  DDD +  ++ +      +E G  L+  E + +  +FD D  G IS +EFL
Sbjct: 185 KAFKLFDDDDTGKISLKNLRRVSRELGENLSDDELQAMIDEFDKDMDGEISQEEFL 240


>UniRef50_Q6A1M7 Cluster: Caltractin; n=1; Euplotes vannus|Rep:
           Caltractin - Euplotes vannus
          Length = 194

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 16/55 (29%), Positives = 33/55 (60%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +IFR  D+D +  ++ +      K+ G +++ +E ++L S+ D D+ G I+ D+F
Sbjct: 120 KIFRLFDEDNTGKISFKNLRKIAKDLGEDISDAELKDLISEADRDNDGLITADDF 174


>UniRef50_Q4X2G4 Cluster: Centrin, putative; n=3; Plasmodium
           (Vinckeia)|Rep: Centrin, putative - Plasmodium chabaudi
          Length = 212

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + F+  DDD +  ++ +      +E G  L+  E + +  +FD D  G IS +EFL
Sbjct: 148 KAFKLFDDDDTGKISLKNLRRVSRELGENLSDDELQAMIDEFDKDMDGEISQEEFL 203


>UniRef50_Q18136 Cluster: Unidentified vitellogenin-linked
           transcript protein 2; n=2; Caenorhabditis|Rep:
           Unidentified vitellogenin-linked transcript protein 2 -
           Caenorhabditis elegans
          Length = 156

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 17/56 (30%), Positives = 28/56 (50%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           IFR  D +G   + +EE    +++ G    + E + +F   D D  G+I   EFL+
Sbjct: 26  IFREFDLNGDGYIQREELRAVMQKMGQSPTEDELDAMFQAADKDCDGNIDFQEFLV 81


>UniRef50_A7S2Y1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 162

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 21/72 (29%), Positives = 32/72 (44%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I  L  +F   D D S  ++  E    ++  G +++K     + +  D D SG I  DEF
Sbjct: 18  IRDLKLVFDTFDTDKSGSIDGRELRKAMRTLGFKISKEGIAGMIADLDADQSGRIEFDEF 77

Query: 468 LIKIRPPMSESR 503
           L  I    S+ R
Sbjct: 78  LDFIISKQSDGR 89


>UniRef50_A5K9U4 Cluster: Centrin, putative; n=11; Eukaryota|Rep:
           Centrin, putative - Plasmodium vivax
          Length = 168

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 19/69 (27%), Positives = 34/69 (49%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L +   F   D +G+  ++ +E    ++  G E  K +  ++ S  D D SG+I  ++FL
Sbjct: 27  LEIKEAFDLFDTNGTGRIDAKELKVAMRALGFEPKKEDIRKIISDVDQDGSGTIDFNDFL 86

Query: 471 IKIRPPMSE 497
             +   MSE
Sbjct: 87  DIMTIKMSE 95


>UniRef50_A2EF97 Cluster: EF hand family protein; n=1; Trichomonas
           vaginalis G3|Rep: EF hand family protein - Trichomonas
           vaginalis G3
          Length = 172

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I+GL   F + D D    L K+EF   ++ T ++    EA  +F  FD +  G ++ D+F
Sbjct: 34  IIGLRSFFNQRDMDSDGRLGKDEFKCFLQSTHMDTRFIEA--IFQIFDRNKDGFLTFDDF 91

Query: 468 L 470
           L
Sbjct: 92  L 92


>UniRef50_Q7S5W4 Cluster: Putative uncharacterized protein
           NCU09871.1; n=2; Sordariales|Rep: Putative
           uncharacterized protein NCU09871.1 - Neurospora crassa
          Length = 1051

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 23/83 (27%), Positives = 37/83 (44%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L R FR  D DG  ++ +++     K+ G  +  ++   +  +FD    G +  DEFL  
Sbjct: 114 LRRAFRLFDIDGKGMITQDDLRRVSKQVGNNIPDADITAMIEEFDASGKGGVDEDEFL-- 171

Query: 477 IRPPMSESRRKL*NKHSRSLTRL 545
            R  MS    K  +  +R  T L
Sbjct: 172 -RLMMSRMHTKPCSVSARDATTL 193


>UniRef50_P09226 Cluster: 25 kDa calcium-binding protein (TCBP-25)
           [Contains: 10 kDa calcium- binding protein (TCBP-10)];
           n=1; Tetrahymena thermophila|Rep: 25 kDa calcium-binding
           protein (TCBP-25) [Contains: 10 kDa calcium- binding
           protein (TCBP-10)] - Tetrahymena thermophila
          Length = 218

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 7/62 (11%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKS------EAEELFSQF-DTDSSGSISLD 461
           R+F+R D DGS  L  +E    +K+T  E+  S      E  +++ Q  DT+S GS+SL+
Sbjct: 135 RLFKRYDKDGSGQLQDDEIAGLLKDTYAEMGMSNFTPTKEDVKIWLQMADTNSDGSVSLE 194

Query: 462 EF 467
           E+
Sbjct: 195 EY 196


>UniRef50_UPI0000F1F4FE Cluster: PREDICTED: similar to phospholipase
           C-like 3; n=3; Danio rerio|Rep: PREDICTED: similar to
           phospholipase C-like 3 - Danio rerio
          Length = 1715

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT-DSSGSISLDEFLI 473
           F   D +G  LLN EE    + +  + L + + +++F + DT D  G+++ +EF +
Sbjct: 133 FEEADKNGDGLLNMEEIYQLLHKMNVNLPRRKVKQMFQEADTDDQQGTLTFEEFTV 188


>UniRef50_UPI00006CD8F2 Cluster: HELP domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: HELP domain
           containing protein - Tetrahymena thermophila SB210
          Length = 2326

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 20/64 (31%), Positives = 34/64 (53%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           RIF   D D S  ++  EF+  I        K +AE +F+ +D D + +I+ +E +I ++
Sbjct: 62  RIFEYFDTDSSGRIDSYEFISAIALLSQAPLKRKAELIFNLYDFDKNQTITQNELVILLK 121

Query: 483 PPMS 494
             MS
Sbjct: 122 TTMS 125



 Score = 32.3 bits (70), Expect = 8.9
 Identities = 13/34 (38%), Positives = 24/34 (70%)
 Frame = +3

Query: 366 GIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           G +E  ++  +++ +E+ S++DT+  GSISL EF
Sbjct: 132 GKEEATIQQAEAKTKEILSKYDTNKDGSISLKEF 165


>UniRef50_UPI00006A2EFC Cluster: Microtubule-actin cross-linking
            factor 1, isoforms 1/2/3/5 (Actin cross-linking family
            protein 7) (Macrophin-1) (Trabeculin-alpha) (620 kDa
            actin-binding protein) (ABP620).; n=3; Xenopus
            tropicalis|Rep: Microtubule-actin cross-linking factor 1,
            isoforms 1/2/3/5 (Actin cross-linking family protein 7)
            (Macrophin-1) (Trabeculin-alpha) (620 kDa actin-binding
            protein) (ABP620). - Xenopus tropicalis
          Length = 7083

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 18/59 (30%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     + E   +   FD D  G I   EF+  + P
Sbjct: 6720 FRRIDKDQDGKITRQEFIDGILASKFPTTRLEMTAVADIFDRDGDGYIDYYEFVAALHP 6778


>UniRef50_A1KBM7 Cluster: Putative calcium binding protein; n=1;
           Azoarcus sp. BH72|Rep: Putative calcium binding protein
           - Azoarcus sp. (strain BH72)
          Length = 222

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLE-LNKSEAEELFSQFDTDSSGSISLDE 464
           +F  +D  G   L + +F     + G++  + + AEELFS  D D+ G ++ DE
Sbjct: 33  LFSALDTSGQGYLQQTDFESAFSQLGIDDSDAASAEELFSALDADADGKLTQDE 86


>UniRef50_Q6DUX2 Cluster: Regulator of gene silencing; n=4; core
           eudicotyledons|Rep: Regulator of gene silencing -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 198

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 21/71 (29%), Positives = 34/71 (47%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L R+F   D++G   ++  E    +K  G E+   EAE +    D+D  G +  ++F  K
Sbjct: 65  LERVFTYFDENGDGKVSPMELRRCMKAVGGEITVEEAEMVVRLSDSDGDGLLGFEDF-TK 123

Query: 477 IRPPMSESRRK 509
           +   M E R K
Sbjct: 124 LMEGMEEERNK 134


>UniRef50_Q4QCJ3 Cluster: Calmodulin-like protein; n=3;
           Leishmania|Rep: Calmodulin-like protein - Leishmania
           major
          Length = 154

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSE 497
           +DDD    L   +  + +   G  +++ EAEE+    + D  G I +D+ +  + P   E
Sbjct: 92  LDDDADGYLTTTQLRHILVNLGARISQEEAEEILCDVEKDGEGMIMVDDIIQLLMPAEGE 151

Query: 498 SR 503
            R
Sbjct: 152 ER 153


>UniRef50_O17068 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 249

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F   D+D +  L++EE    + E  L   +    +LF +FD D SG + L E++
Sbjct: 109 KVFEDFDEDFNMALSREELERVLAERFLVKPRENFPKLFFKFDVDKSGGLDLTEYM 164


>UniRef50_A0DN99 Cluster: Chromosome undetermined scaffold_57, whole
           genome shotgun sequence; n=5; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_57, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 506

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 15/23 (65%), Positives = 19/23 (82%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIKG 580
           +EQAFK  DK G G+I+ID+IKG
Sbjct: 431 LEQAFKMFDKDGSGSISIDEIKG 453


>UniRef50_A0BVG6 Cluster: Chromosome undetermined scaffold_13, whole
            genome shotgun sequence; n=3; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_13, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1903

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 19/67 (28%), Positives = 32/67 (47%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            +F  +D DG +++   EF    +E    +      +LF Q D D +G IS +E L  +R 
Sbjct: 870  VFNMIDRDGDQIITLMEFQALFRELEGGIAPDLIRQLFDQMDQDRNGQISYNEMLNYLRT 929

Query: 486  PMSESRR 506
              +E  +
Sbjct: 930  AKTEEEK 936


>UniRef50_Q2UPN8 Cluster: Predicted protein; n=3;
           Eurotiomycetidae|Rep: Predicted protein - Aspergillus
           oryzae
          Length = 977

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 20/67 (29%), Positives = 30/67 (44%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           R+F   D +G  L+  EEFL G+     + N      +F  +D D  G +   +FL   R
Sbjct: 295 RMFAFYDTNGDGLIGFEEFLKGLASLNNKSNDERLRRVFRGYDIDGDGYVERKDFLRVFR 354

Query: 483 PPMSESR 503
              + SR
Sbjct: 355 AYYALSR 361


>UniRef50_Q09665 Cluster: Troponin C, isoform 2; n=2;
           Caenorhabditis|Rep: Troponin C, isoform 2 -
           Caenorhabditis elegans
          Length = 160

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 15/58 (25%), Positives = 31/58 (53%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G+  +N  +    ++     +++ E +E+ ++ D D SG++  DEF+
Sbjct: 97  LREAFRLYDKEGNGYINVSDLRDILRALDDNVSEEELDEMIAEIDADGSGTVDFDEFM 154


>UniRef50_P54670 Cluster: Calfumirin-1; n=2; Dictyostelium
           discoideum|Rep: Calfumirin-1 - Dictyostelium discoideum
           (Slime mold)
          Length = 169

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 17/56 (30%), Positives = 31/56 (55%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           I R   DD + +  K+E + G KETG +  +  A  + ++ DT+  G+I++ E  +
Sbjct: 102 ILRHNKDDNTDI-TKDELIQGFKETGAKDPEKSANFILTEMDTNKDGTITVKELRV 156


>UniRef50_UPI00006CC451 Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 762

 Score = 35.9 bits (79), Expect = 0.72
 Identities = 18/59 (30%), Positives = 31/59 (52%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + L  +F R D D    L  +EF   +K+   ++ +S+A+ LFS  D   +G +  D+F
Sbjct: 512 INLKDLFDRFDLDQDGKLTGDEFFILLKKLDKQIKESQAKHLFSILDKQENGYMLFDQF 570


>UniRef50_P90802 Cluster: Putative uncharacterized protein; n=5;
           Rhabditida|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 202

 Score = 35.9 bits (79), Expect = 0.72
 Identities = 17/60 (28%), Positives = 29/60 (48%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           ++F   D D S  +  +E    IK  GLE  + E +++  + D   +  I  DEF + +R
Sbjct: 60  QVFNMFDADRSGAIAIDELEAAIKNLGLEQTRDELDKIIDEVDQRGNHQIDFDEFCVVMR 119



 Score = 35.9 bits (79), Expect = 0.72
 Identities = 17/64 (26%), Positives = 37/64 (57%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           +F R ++ G   ++K++F + ++E G   +    +E+F++ D D +G I  DEF   ++ 
Sbjct: 138 VFDRSENGG---ISKKDFRFILRELGDITDNQIIDEIFNEADVDGNGVIDYDEFTYMVKN 194

Query: 486 PMSE 497
            M++
Sbjct: 195 YMTD 198


>UniRef50_O45209 Cluster: Calmodulin-like protein; n=3;
           Eukaryota|Rep: Calmodulin-like protein - Branchiostoma
           lanceolatum (Common lancelet) (Amphioxus)
          Length = 225

 Score = 35.9 bits (79), Expect = 0.72
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG  ++  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 10  FSLFDKDGDGVITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAKK 69

Query: 489 MSES 500
           M E+
Sbjct: 70  MKET 73


>UniRef50_A4VE20 Cluster: Centrin; n=3; Eukaryota|Rep: Centrin -
           Tetrahymena thermophila SB210
          Length = 156

 Score = 35.9 bits (79), Expect = 0.72
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + F+  D+D +  ++        +E G +L   E + +  +FD D  G IS +EFL
Sbjct: 92  KAFKLFDEDNTGKISLRNLKRVARELGEQLTDEELQAMIDEFDRDQDGQISEEEFL 147


>UniRef50_A0DGC5 Cluster: Chromosome undetermined scaffold_5, whole
           genome shotgun sequence; n=13; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_5, whole genome shotgun
           sequence - Paramecium tetraurelia
          Length = 582

 Score = 35.9 bits (79), Expect = 0.72
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGI--KETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           F+R+D++    L+K+E L G    +T  +L + E E +    D + SG I   EF
Sbjct: 451 FQRLDENNDGFLSKDELLKGYIQIQTDSKLAEDEVERILQMIDINRSGQIDFSEF 505


>UniRef50_P35622 Cluster: Troponin C; n=4; Mollusca|Rep: Troponin C
           - Patinopecten yessoensis (Ezo giant scallop) (Yesso
           scallop)
          Length = 152

 Score = 35.9 bits (79), Expect = 0.72
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L   FR +D +   ++  +   + +   G EL + E E + ++ DTD SG++  +EF
Sbjct: 87  LKEAFRVLDKEKKGVIKVDVLRWILSSLGDELTEEEIENMIAETDTDGSGTVDYEEF 143


>UniRef50_P63316 Cluster: Troponin C, slow skeletal and cardiac
           muscles; n=73; Vertebrata|Rep: Troponin C, slow skeletal
           and cardiac muscles - Homo sapiens (Human)
          Length = 161

 Score = 35.9 bits (79), Expect = 0.72
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  +FR  D +    ++ +E    ++ TG  + + + EEL    D ++ G I  DEFL
Sbjct: 97  LSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFL 154



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           L  +   +D+DGS  ++ +EFL  +     + +K ++EE    LF  FD ++ G I LDE
Sbjct: 57  LQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDE 116

Query: 465 FLIKIR 482
             I ++
Sbjct: 117 LKIMLQ 122


>UniRef50_P36609 Cluster: Neuronal calcium sensor 2; n=6;
           Bilateria|Rep: Neuronal calcium sensor 2 -
           Caenorhabditis elegans
          Length = 190

 Score = 35.9 bits (79), Expect = 0.72
 Identities = 20/58 (34%), Positives = 30/58 (51%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           +FR  D D S  ++ +EFL  I  T     + + E  F  +D D +G+I   E +IKI
Sbjct: 70  VFRTFDTDNSGFIDFKEFLLAINVTSSGTPEQKLEWAFRMYDIDGNGTIDEKE-MIKI 126


>UniRef50_Q8L3R2 Cluster: Calmodulin-like protein 41; n=4; core
           eudicotyledons|Rep: Calmodulin-like protein 41 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 205

 Score = 35.9 bits (79), Expect = 0.72
 Identities = 15/58 (25%), Positives = 30/58 (51%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L ++F   D DG   ++  E  +     G  ++   A+E  ++ DTD+ GS+  ++F+
Sbjct: 65  LRQVFSHFDSDGDGKISAFELRHYFGSVGEYISHEAAQEAINEVDTDADGSLGFEDFV 122


>UniRef50_UPI00015B4DD0 Cluster: PREDICTED: similar to CG17765-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG17765-PA - Nasonia vitripennis
          Length = 183

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 15/56 (26%), Positives = 26/56 (46%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           +FR  D D S  + +EE      + G          L  ++D    GSI++D+F++
Sbjct: 89  VFRGFDHDNSGSIQEEELAAAFTQMGYRFKPEFINFLIKRYDCSQQGSITVDQFIV 144


>UniRef50_UPI00006D004E Cluster: EF hand family protein; n=1;
            Tetrahymena thermophila SB210|Rep: EF hand family protein
            - Tetrahymena thermophila SB210
          Length = 1391

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKET-GLELNKSEAEELFSQFDTDSSGSISLDEFL 470
            +  ++D D +  L ++E     K   G++L + + + +F  FD D  G ISL EF+
Sbjct: 1279 LHHQIDKDKNNSLGRQELSTFFKNKFGIQLTRRDMDVVFQTFDKDKDGQISLKEFV 1334


>UniRef50_UPI00006CE58E Cluster: EF hand family protein; n=1;
           Tetrahymena thermophila SB210|Rep: EF hand family
           protein - Tetrahymena thermophila SB210
          Length = 150

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 19/60 (31%), Positives = 36/60 (60%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I+ L +IF++ +++G   +N E+    + + G  L++ E  +L  +FD+D  G IS +EF
Sbjct: 89  IVDLFKIFKQ-NENGH--INVEDLRMCVTQMGENLSEEEFNDLIREFDSDKDGYISFEEF 145


>UniRef50_Q6W3E0 Cluster: Skin calmodulin-related protein 2; n=2;
           Eutheria|Rep: Skin calmodulin-related protein 2 - Mus
           musculus (Mouse)
          Length = 140

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           +N +E    +K+ G  L+  E + L S+ DTD  G IS +EF   I+
Sbjct: 15  INVQELGDVMKQLGKNLSHEELKALISKLDTDGDGKISFEEFFKSIK 61



 Score = 33.9 bits (74), Expect = 2.9
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF--- 467
           L  +  ++D DG   ++ EEF   IK+   E    E + +FS  D +  G I++DE    
Sbjct: 36  LKALISKLDTDGDGKISFEEFFKSIKKYTKE---QELQAMFSVLDQNGDGYITVDELKEG 92

Query: 468 LIKIRPPMSE 497
           L K+  P+S+
Sbjct: 93  LSKMGEPLSQ 102


>UniRef50_Q54NH0 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 139

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 20/56 (35%), Positives = 26/56 (46%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L R F   D DG+  ++ +     +   G  L   EA+EL    DTD  G IS DE
Sbjct: 74  LKRAFNCFDTDGTGSISAQHLKQILTTLGDTLTSQEADELIRDTDTDRDGYISSDE 129


>UniRef50_A2FU76 Cluster: EF hand family protein; n=1; Trichomonas
           vaginalis G3|Rep: EF hand family protein - Trichomonas
           vaginalis G3
          Length = 149

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           F+ +D D    +   +     KE G  +   E  E+ ++ DTD+ G IS +EF+  I+
Sbjct: 86  FQMLDIDKKGKITFSDLKKVAKELGENITDQELHEMINEADTDNDGEISFEEFVALIK 143


>UniRef50_A0BU82 Cluster: Chromosome undetermined scaffold_129,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_129,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 771

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 23/64 (35%), Positives = 32/64 (50%)
 Frame = +3

Query: 279 ASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISL 458
           A  +  L R F+RM + GS  L K +F   +   GLE  +  ++ LF   D D  G I  
Sbjct: 24  AEEVQELHRRFQRMTN-GSNFLTKNQFRDNMGLLGLETVQVLSDCLFQIIDEDQDGKIQF 82

Query: 459 DEFL 470
           +EFL
Sbjct: 83  NEFL 86


>UniRef50_Q6C6B6 Cluster: Similar to DEHA0A11253g Debaryomyces
           hansenii; n=1; Yarrowia lipolytica|Rep: Similar to
           DEHA0A11253g Debaryomyces hansenii - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 551

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGL-ELNKSEAEELFSQFDTDSSGSISLDEF 467
           +F  +DD G   L++EE   G+   GL +++    ++ F   D D  G I  DE+
Sbjct: 125 LFHIIDDKGDGKLDREELADGMAAVGLGDMDSDTIDDFFKALDRDKDGYICFDEW 179


>UniRef50_A4RJY1 Cluster: Calmodulin, putative; n=1; Magnaporthe
           grisea|Rep: Calmodulin, putative - Magnaporthe grisea
           (Rice blast fungus) (Pyricularia grisea)
          Length = 161

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 17/54 (31%), Positives = 29/54 (53%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F+  D DGS  ++ EE  + ++  G     +E +E+ +  D D +GSI   EF+
Sbjct: 103 FKVFDSDGSGSISPEELRHALRPLGY--TPAEIDEMIAHADLDGNGSIDYQEFV 154


>UniRef50_A4RF57 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 180

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 14/56 (25%), Positives = 30/56 (53%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           R F+  D +G  ++  E+    + + G  + + E + +  +FD++  G I+ DEF+
Sbjct: 117 RAFKLFDVEGRGIITVEDLRRVMDDLGQAIEEQELQSMIREFDSEGKGGINEDEFI 172


>UniRef50_P14202 Cluster: Tegument antigen (I(H)A); n=11;
           Schistosoma|Rep: Tegument antigen (I(H)A) - Schistosoma
           mansoni (Blood fluke)
          Length = 190

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           R F  +D D +++++K+E +   ++  L++     +   ++FDTD    IS++EF     
Sbjct: 15  RAFLEIDADSNEMIDKQELIKYCQKYRLDMKL--IDPWIARFDTDKDNKISIEEFCRGFG 72

Query: 483 PPMSESRRK 509
             +SE RR+
Sbjct: 73  LKVSEIRRE 81


>UniRef50_P04571 Cluster: Sarcoplasmic calcium-binding protein; n=2;
           Nereididae|Rep: Sarcoplasmic calcium-binding protein -
           Nereis diversicolor (Sandworm) (Hediste diversicolor)
          Length = 174

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           FR +D +    ++++E  YGI    L L+K+ A   F   DT++ G +SL+EF+I
Sbjct: 100 FRAVDTNEDNNISRDE--YGIFFGMLGLDKTMAPASFDAIDTNNDGLLSLEEFVI 152


>UniRef50_O64943 Cluster: Polcalcin Jun o 2; n=2; Cupressaceae|Rep:
           Polcalcin Jun o 2 - Juniperus oxycedrus (Prickly
           juniper)
          Length = 165

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 14/58 (24%), Positives = 31/58 (53%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  +F++ D +G   ++  E    ++  G ++ ++E + +  + D D  G +SL EF+
Sbjct: 27  LEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYVSLQEFV 84


>UniRef50_O75340 Cluster: Programmed cell death protein 6; n=31;
           Eumetazoa|Rep: Programmed cell death protein 6 - Homo
           sapiens (Human)
          Length = 191

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D D S +++K E    +   G  L+    + L  +FD    G I+ D+F+
Sbjct: 98  VFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFI 152


>UniRef50_P30187 Cluster: 22 kDa calmodulin-like calcium-binding
           protein; n=4; core eudicotyledons|Rep: 22 kDa
           calmodulin-like calcium-binding protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 191

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D +G   +  EEF   ++  GL L ++E +E  +  D D  G+I+  EFL
Sbjct: 17  FSVYDKNGDGHITTEEFGAVMRSLGLNLTQAELQEEINDSDLDGDGTINFTEFL 70


>UniRef50_UPI00015B5597 Cluster: PREDICTED: similar to calmodulin;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           calmodulin - Nasonia vitripennis
          Length = 610

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG   + KEE    ++  G      E   +  + D D  G++S +EF+
Sbjct: 444 FRLFDKDGDGSITKEELGRVMRSLGQFARAEELRTMLEEIDIDGDGNVSFEEFV 497


>UniRef50_UPI0001509F5B Cluster: EF hand family protein; n=1;
           Tetrahymena thermophila SB210|Rep: EF hand family
           protein - Tetrahymena thermophila SB210
          Length = 300

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 20/75 (26%), Positives = 37/75 (49%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           +L+  ++GA+    L ++F+  D   S  L  +E    + +  + + K     +FSQ D 
Sbjct: 220 KLIQKTKGANDEFLLRKLFKEFDISNSGFLTLDEMNAMLIKLEIPIQKRYLNAVFSQLDR 279

Query: 435 DSSGSISLDEFLIKI 479
           + SG I  +EF+  I
Sbjct: 280 NHSGVIEFEEFVYYI 294


>UniRef50_UPI0000E800D1 Cluster: PREDICTED: similar to cardiac muscle
            ryanodine receptor; n=1; Gallus gallus|Rep: PREDICTED:
            similar to cardiac muscle ryanodine receptor - Gallus
            gallus
          Length = 2575

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
            F+  D DG  +++K +F +   E+     +SE E L S  +TD + ++  +EF+ +   P
Sbjct: 1759 FKEYDPDGKGIISKRDF-HKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEP 1817

Query: 489  MSE 497
              +
Sbjct: 1818 AKD 1820


>UniRef50_UPI00006CD585 Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 595

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLE--LNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  +F+R+D +    L+KEE + G  +      + + +   +F Q D+D S SI   EF+
Sbjct: 445 LENLFKRLDTNQDGRLSKEEIMNGFNQIWHNDYMTEEQINLIFDQVDSDKSDSIDYSEFI 504



 Score = 33.9 bits (74), Expect = 2.9
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IF ++D D S  ++  EF+    E      K   ++ F+ FD D  G I+ DE L
Sbjct: 486 IFDQVDSDKSDSIDYSEFITATLERKTFNEKEYLQKAFNLFDQDGDGHITKDEIL 540


>UniRef50_Q4RJ45 Cluster: Chromosome 1 SCAF15039, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 1
           SCAF15039, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 619

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 14/55 (25%), Positives = 27/55 (49%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           R F++MD++G   ++  E    +   G ++   E   +FS  D +  G ++  EF
Sbjct: 79  RAFKKMDENGDGYISHSELEKALTTKGEKMTSEEVSAIFSLLDINKDGKLNYSEF 133


>UniRef50_Q8RLY3 Cluster: Calmodulin; n=16; cellular organisms|Rep:
           Calmodulin - Nostoc punctiforme PCC 73102
          Length = 155

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF--L 470
           L + F+ +D DG+  ++ +E    ++  G    ++   +L  + D D SG+I  DEF  L
Sbjct: 10  LWQAFKVLDVDGNGAISTDELGEVMRSLGQNPTETGLRDLIKEIDVDLSGTIDFDEFKTL 69

Query: 471 IKIRPPMSESRRKL 512
           +  +    ESR KL
Sbjct: 70  MIAKVGDRESRLKL 83


>UniRef50_Q1D9Y7 Cluster: EF hand domain protein; n=1; Myxococcus
           xanthus DK 1622|Rep: EF hand domain protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 224

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           IF+R D D +  +++ EF   ++  G  ++  E E      DTD +G IS +EF
Sbjct: 164 IFQRYDRDRTGTIDRAEFARLLEALGQNISDEELEIAVDIVDTDRTGKISWNEF 217


>UniRef50_A6DN05 Cluster: Putative uncharacterized protein; n=1;
           Lentisphaera araneosa HTCC2155|Rep: Putative
           uncharacterized protein - Lentisphaera araneosa HTCC2155
          Length = 265

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEF-LYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           G    ++++D D S  LN++EF L  +      +++   EE+F+  D D++  +S +EF
Sbjct: 152 GASNFYKKLDLDKSGALNEQEFELAVVNSLWWRMSRKSPEEMFNAADKDNNQILSKEEF 210


>UniRef50_Q5CTY5 Cluster: Calcium/calmodulin dependent protein
           kinase with a kinas domain and 4 calmodulin-like EF
           hands; n=3; Cryptosporidium|Rep: Calcium/calmodulin
           dependent protein kinase with a kinas domain and 4
           calmodulin-like EF hands - Cryptosporidium parvum Iowa
           II
          Length = 718

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 19/63 (30%), Positives = 31/63 (49%)
 Frame = +3

Query: 282 SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           S I  L   F  +D +    L  +E + G+K +G+    S+   + +  D+D SGSI   
Sbjct: 569 SQISNLKEAFILLDANCDGTLTPQEIITGLKNSGITELPSDLLAILNDIDSDGSGSIDYT 628

Query: 462 EFL 470
           EF+
Sbjct: 629 EFI 631


>UniRef50_Q4QG09 Cluster: EF hand-like protein; n=1; Leishmania
           major|Rep: EF hand-like protein - Leishmania major
          Length = 216

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 15/53 (28%), Positives = 28/53 (52%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           F+  D D +  ++  E    +   G   +    E+L +++D D SGSI+++EF
Sbjct: 58  FQAADSDHNGRIDVAELNAALSSAGFRFSLGTTEKLLARYDLDRSGSITMEEF 110



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR+ D  G   L++ E L   + +G  L +   + +  +FD    GS+  DE++
Sbjct: 124 FRQCDTSGDGRLDRREALEAFRLSGFVLGEQTFQAVMRKFDRQHRGSLGFDEYI 177


>UniRef50_Q3SDW4 Cluster: Calmodulin 5-1; n=2; Paramecium
           tetraurelia|Rep: Calmodulin 5-1 - Paramecium tetraurelia
          Length = 151

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 15/55 (27%), Positives = 26/55 (47%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +F   D DG   ++  E    +KE G      + +E+  + D D +G +  DEF+
Sbjct: 17  LFAMFDKDGGGTISTNEIGNLMKECGENPTPQQLKEMIEEVDVDGNGEVDFDEFI 71



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLE-LNKSEAEELFSQFDTDSSGSISLDEFLI 473
           L + F  +D D    L+K +   G+ + G + L  ++ ++LF + D D  G  S DEF+ 
Sbjct: 87  LNQAFNLLDLDKDGFLSKTDIQLGLVKLGQQKLPDNDLDDLFLKADLDKDGKFSYDEFIR 146

Query: 474 KIRP 485
            + P
Sbjct: 147 FMTP 150


>UniRef50_P91328 Cluster: Paralysed arrest at two-fold protein 10;
           n=5; Chromadorea|Rep: Paralysed arrest at two-fold
           protein 10 - Caenorhabditis elegans
          Length = 161

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 17/57 (29%), Positives = 27/57 (47%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L   FR  D +G+  +++      +KE   +L   + EE   + D D SG I  +EF
Sbjct: 96  LREAFRLFDKEGNGYISRPTLKALLKEIADDLTDQQLEEAVDEIDEDGSGKIEFEEF 152


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 543,952,871
Number of Sequences: 1657284
Number of extensions: 10251421
Number of successful extensions: 31233
Number of sequences better than 10.0: 418
Number of HSP's better than 10.0 without gapping: 29336
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31125
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41902926763
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).