SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0001
         (485 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A4QTL6 Cluster: Predicted protein; n=1; Magnaporthe gri...    35   1.1  
UniRef50_A7RP24 Cluster: Predicted protein; n=1; Nematostella ve...    34   1.5  
UniRef50_Q1DNR0 Cluster: Putative uncharacterized protein; n=1; ...    34   2.0  
UniRef50_Q296S4 Cluster: GA10209-PA; n=1; Drosophila pseudoobscu...    33   3.4  
UniRef50_Q5DA16 Cluster: SJCHGC09092 protein; n=4; Schistosoma|R...    33   4.5  
UniRef50_Q2H526 Cluster: Putative uncharacterized protein; n=1; ...    33   4.5  
UniRef50_A2QKD5 Cluster: Putative uncharacterized protein; n=1; ...    33   4.5  
UniRef50_P65093 Cluster: Uncharacterized protein Rv3785/MT3893; ...    33   4.5  
UniRef50_Q211Z4 Cluster: Transcriptional modulator of MazE/toxin...    32   7.9  
UniRef50_Q0LHU3 Cluster: Putative uncharacterized protein precur...    32   7.9  
UniRef50_P77073 Cluster: AF/R2 fimbrial major subunit Afr2G; n=2...    32   7.9  
UniRef50_Q5JLK9 Cluster: Putative uncharacterized protein B1144D...    32   7.9  
UniRef50_Q5K9U1 Cluster: Putative uncharacterized protein; n=1; ...    32   7.9  

>UniRef50_A4QTL6 Cluster: Predicted protein; n=1; Magnaporthe
           grisea|Rep: Predicted protein - Magnaporthe grisea (Rice
           blast fungus) (Pyricularia grisea)
          Length = 699

 Score = 34.7 bits (76), Expect = 1.1
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -3

Query: 246 VLIWVWRLTDHLTTASNGSDS-SSRGTEYSTTCRTARRAYSKARMACDT 103
           VLIW  RLT +L  AS G D+ +   T +STTC       S+ +  CDT
Sbjct: 422 VLIWTGRLTKYLAGASIGHDNINFYNTPFSTTCTCCT---SRLKDLCDT 467


>UniRef50_A7RP24 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 934

 Score = 34.3 bits (75), Expect = 1.5
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = -2

Query: 463 ENEKHRSNSELQY*AASRXHFPTSEPRQRTASRALEDRGATTRSEAQRAL 314
           E EK+  + EL+    S  HF   E ++R   RA+ED+    +SE ++ L
Sbjct: 264 EEEKYGKDGELRMLKESLAHFQAEEAKKREQIRAMEDQRKQEQSEKEKEL 313


>UniRef50_Q1DNR0 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 644

 Score = 33.9 bits (74), Expect = 2.0
 Identities = 28/106 (26%), Positives = 41/106 (38%), Gaps = 3/106 (2%)
 Frame = -3

Query: 465 RKTKNTVRTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGAS 286
           RK +     A  + K P+    + P       PE  +   PRRG K  +R +S     A 
Sbjct: 334 RKRRKNATRAPASDKEPLQHHKEWPESTQPGQPENTRAVKPRRGRKRRSRGSSKSSGEAF 393

Query: 285 LGNGDSVXSN---AIAVLIWVWRLTDHLTTASNGSDSSSRGTEYST 157
              G S  S     +  +  +  L D L+  SN SD    G+  +T
Sbjct: 394 SDEGTSSKSTIPVTVHRICNISALEDMLSDKSNVSDDEHSGSHTAT 439


>UniRef50_Q296S4 Cluster: GA10209-PA; n=1; Drosophila
           pseudoobscura|Rep: GA10209-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 1786

 Score = 33.1 bits (72), Expect = 3.4
 Identities = 30/103 (29%), Positives = 39/103 (37%), Gaps = 1/103 (0%)
 Frame = -3

Query: 450 TVRTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGN-G 274
           TVRT     KR      QH NH      E  ++  P  GA +N R  S      S G  G
Sbjct: 349 TVRTTRDRAKREANVGQQHNNHHHHHKRE--QSNGPTGGATINQRHQSQSPANVSGGGLG 406

Query: 273 DSVXSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRT 145
            +    A A       L    +T S+G  ++  G   +TT  T
Sbjct: 407 GAAGGGATAAASKTRHLDMESSTESDGEATNGNGGNTTTTTTT 449


>UniRef50_Q5DA16 Cluster: SJCHGC09092 protein; n=4; Schistosoma|Rep:
           SJCHGC09092 protein - Schistosoma japonicum (Blood
           fluke)
          Length = 414

 Score = 32.7 bits (71), Expect = 4.5
 Identities = 21/62 (33%), Positives = 32/62 (51%)
 Frame = -3

Query: 459 TKNTVRTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLG 280
           TK+ V+  +  I + V+ +S+ PN  + +PP ++   V    AK    S S  VRG  LG
Sbjct: 66  TKSAVKVET-TIPKAVSRVSRSPN--ANEPPPVVFEDVQITSAKETDESASPFVRGRGLG 122

Query: 279 NG 274
            G
Sbjct: 123 RG 124


>UniRef50_Q2H526 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 418

 Score = 32.7 bits (71), Expect = 4.5
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +1

Query: 268 AVSVPERRSSDEYGRRARVELRSASWHRGLQELWRLFAVVVR 393
           A+ V  R +S E GRR ++ + +A+WHR ++  WRL   V R
Sbjct: 333 AIGVETRTASLEDGRR-QLGVYTAAWHRRMEHEWRLSFTVDR 373


>UniRef50_A2QKD5 Cluster: Putative uncharacterized protein; n=1;
           Aspergillus niger|Rep: Putative uncharacterized protein
           - Aspergillus niger
          Length = 352

 Score = 32.7 bits (71), Expect = 4.5
 Identities = 24/68 (35%), Positives = 33/68 (48%)
 Frame = -1

Query: 437 RVTILSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRSGTETAXLQ 258
           R++I++G     P + T T  S+Q   +PR HD +  S  + RP SS    S  E A L 
Sbjct: 255 RLSIVNGDFQELPIVATATMQSIQIRFQPRRHD-DLKSPSSCRPSSSLPSIS-RERAQLL 312

Query: 257 TPSQFSFG 234
           T     FG
Sbjct: 313 TTRDNPFG 320


>UniRef50_P65093 Cluster: Uncharacterized protein Rv3785/MT3893;
           n=14; Mycobacterium tuberculosis complex|Rep:
           Uncharacterized protein Rv3785/MT3893 - Mycobacterium
           tuberculosis
          Length = 357

 Score = 32.7 bits (71), Expect = 4.5
 Identities = 16/48 (33%), Positives = 21/48 (43%)
 Frame = -3

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLL 79
           TDHL       D  S   +Y    R AR  + +     D+GG A WL+
Sbjct: 51  TDHLEARLASLDKFSTAWDYRARARAARALHGEPVRCQDSGGGARWLI 98


>UniRef50_Q211Z4 Cluster: Transcriptional modulator of MazE/toxin,
           MazF; n=1; Rhodopseudomonas palustris BisB18|Rep:
           Transcriptional modulator of MazE/toxin, MazF -
           Rhodopseudomonas palustris (strain BisB18)
          Length = 123

 Score = 31.9 bits (69), Expect = 7.9
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = +1

Query: 271 VSVPERRSSDEYGRRARVELRSASWHRGLQELWRLFAVVVRMLGNVGDWPLNIV 432
           V + + R S++ GRR  + L   S+H+  +      AV+  +   V DWP NIV
Sbjct: 12  VDLDDTRGSEQSGRRPALVLTPLSFHQRSRR-----AVICPITSKVRDWPTNIV 60


>UniRef50_Q0LHU3 Cluster: Putative uncharacterized protein
           precursor; n=1; Herpetosiphon aurantiacus ATCC
           23779|Rep: Putative uncharacterized protein precursor -
           Herpetosiphon aurantiacus ATCC 23779
          Length = 472

 Score = 31.9 bits (69), Expect = 7.9
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = -3

Query: 336 GAKLNARSTSILVRGASLGNGDSVXSNAIAVLIWVWRLTDHLTTASNGSD 187
           GAK ++  T+  V    +G G +V   A A LI V R+T  + T + G D
Sbjct: 416 GAKASSNPTNAGVTNMGVGGGSAVVEGAGAQLIVVARVTSPVGTGTTGED 465


>UniRef50_P77073 Cluster: AF/R2 fimbrial major subunit Afr2G; n=2;
           Escherichia coli|Rep: AF/R2 fimbrial major subunit Afr2G
           - Escherichia coli
          Length = 279

 Score = 31.9 bits (69), Expect = 7.9
 Identities = 13/47 (27%), Positives = 26/47 (55%)
 Frame = -3

Query: 294 GASLGNGDSVXSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTT 154
           G ++  G ++  ++    +W W+L D +T ASN +D ++  T  + T
Sbjct: 32  GGTIDIGGTIEVDSQYDDLWTWKLGDAITVASNAADMNAEKTSLTIT 78


>UniRef50_Q5JLK9 Cluster: Putative uncharacterized protein
           B1144D11.2; n=3; Oryza sativa|Rep: Putative
           uncharacterized protein B1144D11.2 - Oryza sativa subsp.
           japonica (Rice)
          Length = 874

 Score = 31.9 bits (69), Expect = 7.9
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = -1

Query: 395 IRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERR 285
           ++T T +   +S RPR  D+E  ++  L PYSSE++R
Sbjct: 583 MQTITDSGEDNSRRPRSGDSEIPNSSKLEPYSSEQQR 619


>UniRef50_Q5K9U1 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 368

 Score = 31.9 bits (69), Expect = 7.9
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = -1

Query: 458 RKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERR 285
           R+ P     +  +  +    N  T T +  QSS   +  +A +SS+RALRP SS ERR
Sbjct: 23  RRGPARNTRSAAAAAAAAVDNAHTLTLS--QSSQSTQVSNASQSSSRALRPQSSLERR 78


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 451,765,589
Number of Sequences: 1657284
Number of extensions: 7608796
Number of successful extensions: 26046
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 25168
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26033
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 28130105105
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).