BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0255.Seq (505 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D57655 Cluster: PREDICTED: similar to CG1962-PA,... 36 0.69 UniRef50_A4A2J6 Cluster: Putative uncharacterized protein; n=1; ... 33 3.7 >UniRef50_UPI0000D57655 Cluster: PREDICTED: similar to CG1962-PA, isoform A; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG1962-PA, isoform A - Tribolium castaneum Length = 707 Score = 35.5 bits (78), Expect = 0.69 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 5/98 (5%) Frame = -1 Query: 340 ERSMGGRH----TTGICASDERCQRI*ISVK*KRMRVPL*RKMRAQDSVNQIREK*TSLE 173 E S G +H TT I + + RC+ + ++ R++V K RAQ + K T Sbjct: 107 ENSAGKKHIKTLTTNIESLETRCEELQTTIDDLRLQVDA-LKRRAQ---RPVEVKSTPPA 162 Query: 172 CRVRRHTSHY-ERAIRVYITPTTKTIRASCCRNSQPLE 62 RH Y E A P T TI A C +NS P++ Sbjct: 163 TITLRHVEKYDEEATPTSPEPKTHTIDAQCVKNSTPIK 200 >UniRef50_A4A2J6 Cluster: Putative uncharacterized protein; n=1; Blastopirellula marina DSM 3645|Rep: Putative uncharacterized protein - Blastopirellula marina DSM 3645 Length = 761 Score = 33.1 bits (72), Expect = 3.7 Identities = 20/52 (38%), Positives = 26/52 (50%) Frame = +2 Query: 59 YFEGLRVSTARSSNRFRRWSYINPNRSLVVRRVASYSALEARSLFSYLIHRI 214 YF G R R SNRF W +L+ VA S L+A + FS+ IH + Sbjct: 30 YFRGWRNLRQRGSNRFPVWRLAAFCGALLTIFVALQSPLDALAPFSFQIHMV 81 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 421,818,832 Number of Sequences: 1657284 Number of extensions: 7191992 Number of successful extensions: 18959 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18956 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 30110042232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -