BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0229.Seq (901 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ... 97 5e-19 UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ... 95 2e-18 UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet... 95 2e-18 UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L... 93 7e-18 UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo... 84 5e-15 UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:... 67 5e-10 UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; ... 54 5e-06 UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteoba... 51 5e-05 UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteoba... 43 0.012 UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barre... 36 1.1 UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus la... 36 1.4 UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barre... 36 1.9 UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio choler... 34 4.3 UniRef50_UPI0000F1EDC6 Cluster: PREDICTED: hypothetical protein;... 34 5.7 UniRef50_Q75V16 Cluster: NukT; n=1; Staphylococcus warneri|Rep: ... 33 7.5 UniRef50_A6G4K3 Cluster: Putative uncharacterized protein; n=1; ... 33 7.5 UniRef50_A7TE63 Cluster: Putative uncharacterized protein; n=1; ... 33 9.9 >UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organisms|Rep: LacZ-alpha peptide - Escherichia coli Length = 90 Score = 97.1 bits (231), Expect = 5e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 514 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 642 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP Sbjct: 20 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 62 >UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; Erwinia amylovora|Rep: Putative uncharacterized protein - Erwinia amylovora (Fire blight bacteria) Length = 123 Score = 95.1 bits (226), Expect = 2e-18 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 511 YNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 642 Y LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP Sbjct: 65 YYGLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 108 >UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Beta-galactosidase - Escherichia coli (strain K12) Length = 1024 Score = 95.1 bits (226), Expect = 2e-18 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 514 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 642 +SLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP Sbjct: 6 DSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ protein - Phage M13mp18 Length = 102 Score = 93.5 bits (222), Expect = 7e-18 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +1 Query: 517 SLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 642 +LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP Sbjct: 25 ALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 66 >UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryota|Rep: beta-galactosidase - Entamoeba histolytica HM-1:IMSS Length = 86 Score = 83.8 bits (198), Expect = 5e-15 Identities = 41/54 (75%), Positives = 43/54 (79%) Frame = +2 Query: 518 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALSQQLRX*NGRMA 679 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI++ SQQLR RMA Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVISEEARTDRPSQQLRSLKWRMA 58 >UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep: Beta-galactosidase - Yersinia pseudotuberculosis Length = 1066 Score = 67.3 bits (157), Expect = 5e-10 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 517 SLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFP 648 SL +L RRDWENP +TQ +RL AHPPF SWR+ E A+ DRP P Sbjct: 14 SLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSP 57 >UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; Enterobacter sakazakii ATCC BAA-894|Rep: Putative uncharacterized protein - Enterobacter sakazakii ATCC BAA-894 Length = 1043 Score = 54.0 bits (124), Expect = 5e-06 Identities = 21/48 (43%), Positives = 29/48 (60%) Frame = +1 Query: 520 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFPTVAXL 663 LA +L R DW+NP +T +NRL +H P WR+++ AR P V L Sbjct: 18 LATILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEPSDAVLSL 65 >UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteobacteria|Rep: Beta-galactosidase - Klebsiella pneumoniae Length = 1034 Score = 50.8 bits (116), Expect = 5e-05 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = +1 Query: 529 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 642 VL R DW N +T LNRL AHP FASWR+ AR + P Sbjct: 17 VLAREDWHNQTITHLNRLPAHPVFASWRDELAARDNLP 54 >UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteobacteria|Rep: Beta-galactosidase - Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) Length = 1039 Score = 42.7 bits (96), Expect = 0.012 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +1 Query: 517 SLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 630 SL ++ RRDWENP Q+N++ AH P ++ E+AR Sbjct: 3 SLQHIINRRDWENPITVQVNQVKAHSPLNGFKTIEDAR 40 >UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barrel precursor; n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside hydrolase family 2, TIM barrel precursor - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 1079 Score = 36.3 bits (80), Expect = 1.1 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 517 SLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART-DRPFPTVAXL 663 S V + DWENP V Q+NRL A S+ E+A T DR T+ L Sbjct: 24 SAKTVQVKNDWENPDVIQINRLPARATSYSFDTPEQALTRDRNQSTIQSL 73 >UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus lactis|Rep: Beta-galactosidase - Lactococcus lactis subsp. lactis (Streptococcus lactis) Length = 998 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 529 VLQRRDWENPGVTQLNRLAAHPP 597 VL+R+DWENP V+ NRL H P Sbjct: 9 VLERKDWENPVVSNWNRLPMHTP 31 >UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barrel; n=1; Clostridium cellulolyticum H10|Rep: Glycoside hydrolase family 2, TIM barrel - Clostridium cellulolyticum H10 Length = 1033 Score = 35.5 bits (78), Expect = 1.9 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 541 RDWENPGVTQLNRLAAHPPFASWRNSEEA 627 R+WEN +TQ+NR H P+ ++ + E+A Sbjct: 3 REWENQYITQINRYPMHSPYGAYESVEQA 31 >UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio cholerae|Rep: Beta-galactosidase - Vibrio cholerae Length = 56 Score = 34.3 bits (75), Expect = 4.3 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 529 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 636 +L +DW+NP + + + H P S+R +EAR D Sbjct: 7 ILLSQDWQNPHIVKWHCRTPHVPLHSYRTEQEARLD 42 >UniRef50_UPI0000F1EDC6 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 195 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 517 SLAVVLQRRDWENP 558 SLAVVLQRRDWENP Sbjct: 178 SLAVVLQRRDWENP 191 >UniRef50_Q75V16 Cluster: NukT; n=1; Staphylococcus warneri|Rep: NukT - Staphylococcus warneri Length = 694 Score = 33.5 bits (73), Expect = 7.5 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +2 Query: 812 VLFQFXNKSPLLKNVGLQRSXGEKPSIKGD 901 V F F K+P+LKN+ Q GEK +I GD Sbjct: 469 VTFGFDEKAPILKNITFQVKKGEKVAIVGD 498 >UniRef50_A6G4K3 Cluster: Putative uncharacterized protein; n=1; Plesiocystis pacifica SIR-1|Rep: Putative uncharacterized protein - Plesiocystis pacifica SIR-1 Length = 531 Score = 33.5 bits (73), Expect = 7.5 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +2 Query: 542 VTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALSQ 649 V+G L LP+L+ PL P G++A++ PIAL + Sbjct: 64 VSGPNLQLPHLVDELATPLPPTGLLARKMDPIALDE 99 >UniRef50_A7TE63 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 757 Score = 33.1 bits (72), Expect = 9.9 Identities = 18/71 (25%), Positives = 40/71 (56%) Frame = +2 Query: 392 VQRQRKTIAKSIILFLVRRCSKASIRRGGPVPNSPYSESITIHWPSFYNVVTGKTLALPN 571 ++R++K + ++ L +V + S+ + V N + SIT +P ++ + T++LPN Sbjct: 425 IKRRKKVVNQNDFLTIVPKASRQNHSNTNVVDNKVDNNSITNSYPDISSLNSFSTVSLPN 484 Query: 572 LIALQHIPLSP 604 L L++ ++P Sbjct: 485 L-TLENTGITP 494 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 882,923,698 Number of Sequences: 1657284 Number of extensions: 17834553 Number of successful extensions: 42738 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 41051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42727 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 81571813589 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -