BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0226.Seq (742 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 77 3e-13 UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein;... 40 0.064 UniRef50_Q9FPR2 Cluster: Lysine-rich arabinogalactan protein 18 ... 35 2.4 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 34 3.2 UniRef50_A0QK95 Cluster: Putative uncharacterized protein; n=2; ... 33 7.4 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 33 7.4 UniRef50_Q4P0I5 Cluster: Putative uncharacterized protein; n=1; ... 33 7.4 UniRef50_A7HGN2 Cluster: Aspartate-semialdehyde dehydrogenase; n... 33 9.7 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 77.4 bits (182), Expect = 3e-13 Identities = 42/72 (58%), Positives = 46/72 (63%) Frame = +2 Query: 257 PTARRTNATTSFLTATILVYXXXXXXXXXXXXRLALQLFLVKIFKVYSFRLRGLVRVPYR 436 P AR + TTSFLTA L+Y RLALQ LVK FKV SF+L+GL RV Y Sbjct: 32 PPARSQDPTTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFKVDSFQLQGLERVLYC 91 Query: 437 YFSSLPPRAGSG 472 YFSSLPPR GSG Sbjct: 92 YFSSLPPRVGSG 103 >UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 493 Score = 39.9 bits (89), Expect = 0.064 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +1 Query: 415 PRKSPVSLFFVTTSPCREW 471 PRKSPV LFFVTTSP REW Sbjct: 24 PRKSPVLLFFVTTSPGREW 42 >UniRef50_Q9FPR2 Cluster: Lysine-rich arabinogalactan protein 18 precursor; n=3; Arabidopsis thaliana|Rep: Lysine-rich arabinogalactan protein 18 precursor - Arabidopsis thaliana (Mouse-ear cress) Length = 209 Score = 34.7 bits (76), Expect = 2.4 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = +1 Query: 403 PITRPRKSPVSLFFVTTSPCREWVICAPAAFLGCGTVSQAPSPESNPDSPLXVT 564 PI+ P KSP + TTSP + + +P + A SP +P SP V+ Sbjct: 24 PISSPTKSPTTPSAPTTSPTKSPAVTSPTTAPAKTPTASASSPVESPKSPAPVS 77 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 34.3 bits (75), Expect = 3.2 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +1 Query: 325 SWNYRGCWHQTCP 363 SWNYR CWHQT P Sbjct: 7 SWNYRSCWHQTGP 19 >UniRef50_A0QK95 Cluster: Putative uncharacterized protein; n=2; Mycobacterium avium|Rep: Putative uncharacterized protein - Mycobacterium avium (strain 104) Length = 380 Score = 33.1 bits (72), Expect = 7.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 247 GCVTDSAAHKCNYELFNRNNFSIRYWSWN 333 G V H C YE+F++ +R+W+WN Sbjct: 151 GAVCVGFVHNCYYEIFDQLGPQLRWWAWN 179 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 33.1 bits (72), Expect = 7.4 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 511 VSQAPSPESNPDSPLXVTTMV 573 +SQAPSPESN +SPL V M+ Sbjct: 374 ISQAPSPESNSNSPLPVKAML 394 >UniRef50_Q4P0I5 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 689 Score = 33.1 bits (72), Expect = 7.4 Identities = 16/48 (33%), Positives = 28/48 (58%) Frame = +2 Query: 161 RDRILILNRRFLERRLTDDMLRKRVSITADASPTARRTNATTSFLTAT 304 RD ++++NR+ RL + LRK + T A+ +A ++TT+ AT Sbjct: 392 RDPLILVNRKLANARLVEASLRKLIQNTDRAAASAYAASSTTNGTAAT 439 >UniRef50_A7HGN2 Cluster: Aspartate-semialdehyde dehydrogenase; n=2; Anaeromyxobacter|Rep: Aspartate-semialdehyde dehydrogenase - Anaeromyxobacter sp. Fw109-5 Length = 340 Score = 32.7 bits (71), Expect = 9.7 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 418 RKSPVSLFFVTTSPCREWVICAPAAFL-GCGTVSQAPSPESNPDSPLXVTTM 570 R V+LF V REW AP A+ GC V +P+ ++PD PL + + Sbjct: 66 RGCDVALFCVPAEVAREW---APRAWAEGCAVVDVSPAFRADPDVPLALAEL 114 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 725,057,025 Number of Sequences: 1657284 Number of extensions: 14594361 Number of successful extensions: 32595 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 31511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32585 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60500186565 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -