BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0207.Seq (668 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 70 6e-11 UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: ... 48 2e-04 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 46 6e-04 UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein;... 40 0.054 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 38 0.29 UniRef50_Q5FSR0 Cluster: Phosphoenolpyruvate-protein phosphotran... 33 4.7 UniRef50_UPI0000DA1C3D Cluster: PREDICTED: similar to CCR4-NOT t... 33 6.2 UniRef50_Q0SK29 Cluster: ABC transporter, subtrate-binding compo... 33 8.2 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 69.7 bits (163), Expect = 6e-11 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +1 Query: 256 TAAAGTRLALQLFLVKIFKVYSFRLRGLVRVPYRYFSSLPPRAGSG 393 TAAAGTRLALQ LVK FKV SF+L+GL RV Y YFSSLPPR GSG Sbjct: 58 TAAAGTRLALQWILVKGFKVDSFQLQGLERVLYCYFSSLPPRVGSG 103 >UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: LRRG00114 - Rattus norvegicus (Rat) Length = 223 Score = 48.0 bits (109), Expect = 2e-04 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 406 LLPSLDVVAVSQAPSPESNPDSP 474 LLPSLDVVAVSQAPSPE NPDSP Sbjct: 167 LLPSLDVVAVSQAPSPELNPDSP 189 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 46.4 bits (105), Expect = 6e-04 Identities = 34/80 (42%), Positives = 43/80 (53%) Frame = +1 Query: 256 TAAAGTRLALQLFLVKIFKVYSFRLRGLVRVPYRYFSSLPPRAGSG*XARLLPSLDVVAV 435 TAAAGTRLALQL K+ + + + PY S L L++ A+ Sbjct: 328 TAAAGTRLALQLIFGKVLSSHHSNYKTKIW-PYIVIS-----------CHYLSYLEL-AI 374 Query: 436 SQAPSPESNPDSPLPVTTMV 495 SQAPSPESN +SPLPV M+ Sbjct: 375 SQAPSPESNSNSPLPVKAML 394 Score = 40.7 bits (91), Expect = 0.031 Identities = 25/54 (46%), Positives = 28/54 (51%) Frame = +2 Query: 215 LTATILVYAIGAGIPRLLAPDLPSNCSSLKYLKCTHSDYEAS*ESRIVIFRHYL 376 LTATIL+YAIGAGI L K L HS+Y+ IVI HYL Sbjct: 314 LTATILIYAIGAGITAAAGTRLALQLIFGKVLSSHHSNYKTKIWPYIVISCHYL 367 >UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 493 Score = 39.9 bits (89), Expect = 0.054 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +3 Query: 336 PRKSPVSLFFVTTSPCREW 392 PRKSPV LFFVTTSP REW Sbjct: 24 PRKSPVLLFFVTTSPGREW 42 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 37.5 bits (83), Expect = 0.29 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +1 Query: 373 PPRAGSG*XARLLPSLDVVAVSQAPSP 453 PP+ SG +RLL +D+VA+SQAPSP Sbjct: 46 PPKVSSGKVSRLLLPVDIVAISQAPSP 72 >UniRef50_Q5FSR0 Cluster: Phosphoenolpyruvate-protein phosphotransferase; n=1; Gluconobacter oxydans|Rep: Phosphoenolpyruvate-protein phosphotransferase - Gluconobacter oxydans (Gluconobacter suboxydans) Length = 589 Score = 33.5 bits (73), Expect = 4.7 Identities = 39/141 (27%), Positives = 61/141 (43%), Gaps = 4/141 (2%) Frame = +1 Query: 34 VQSKIVGPPRHSPKSTATRILILNRRFLERRLTDDMLRKRVSITADACTDSAAHKCNYEL 213 ++ ++VG P + A+ +++ R RL + R R++ C ++A + EL Sbjct: 47 MRDRLVGLPEEGREEIASLLMVYERMLGPSRLLRQV-RSRIA-DEGLCAEAAVSEVTREL 104 Query: 214 ---FNRNNFSIRYWSWNTAAAGTRLALQLFLVKIFKVYSFRL-RGLVRVPYRYFSSLPPR 381 +R ++ + NT A L L F+ RL R L + YR FSSLPP Sbjct: 105 ALQVSRMAEAVARENNNTQEADANLRL----AGEFEEIGRRLVRNLTGISYRAFSSLPP- 159 Query: 382 AGSG*XARLLPSLDVVAVSQA 444 GS A L DV + A Sbjct: 160 -GSVLVAEQLRPADVAMIDPA 179 >UniRef50_UPI0000DA1C3D Cluster: PREDICTED: similar to CCR4-NOT transcription complex, subunit 3; n=1; Rattus norvegicus|Rep: PREDICTED: similar to CCR4-NOT transcription complex, subunit 3 - Rattus norvegicus Length = 750 Score = 33.1 bits (72), Expect = 6.2 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +1 Query: 364 SSLPPRAGSG*XARLLPSLDVVAVSQAPSPESNPDSPLP 480 +++P G G A P L + A S PSPE PD+PLP Sbjct: 607 AAIPTGHGRGRLAPHAPPLXLRAHSAVPSPEPLPDTPLP 645 >UniRef50_Q0SK29 Cluster: ABC transporter, subtrate-binding component; n=1; Rhodococcus sp. RHA1|Rep: ABC transporter, subtrate-binding component - Rhodococcus sp. (strain RHA1) Length = 361 Score = 32.7 bits (71), Expect = 8.2 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 2/29 (6%) Frame = +2 Query: 209 SFLTATILVYAIGAGIP--RLLAPDLPSN 289 SF TAT ++YAIG G+P L+A LP+N Sbjct: 108 SFATATAVIYAIGGGVPIVPLVAYPLPAN 136 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 674,754,064 Number of Sequences: 1657284 Number of extensions: 14005618 Number of successful extensions: 37780 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 35968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37759 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51239674196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -