SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0113
         (659 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes ...    63   5e-09
UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: ...    44   0.003
UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;...    42   0.017
UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n...    39   0.12 
UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513...    39   0.12 
UniRef50_Q6Z8F1 Cluster: Putative uncharacterized protein P0459B...    37   0.37 
UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|...    36   0.86 
UniRef50_A7HQK3 Cluster: Cytochrome c oxidase subunit II; n=1; P...    36   1.1  
UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ...    34   2.6  
UniRef50_Q8BL71 Cluster: Adult male corpora quadrigemina cDNA, R...    33   4.6  
UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; ...    33   6.1  

>UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes
           scapularis|Rep: Putative secreted protein - Ixodes
           scapularis (Black-legged tick) (Deer tick)
          Length = 65

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 30/53 (56%), Positives = 35/53 (66%)
 Frame = +1

Query: 58  PY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSDGMSAFIRSKPI 216
           P  G+TANGS+ Q WFLRS+  TWITV ILELIHA+         AFIR + I
Sbjct: 2   PKQGETANGSLNQLWFLRSFLPTWITVAILELIHAVSPKPLGATGAFIRPRSI 54


>UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep:
           LRRG00114 - Rattus norvegicus (Rat)
          Length = 223

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/23 (91%), Positives = 21/23 (91%)
 Frame = -1

Query: 437 LLPSLDVVAVSQAPSPESNLDSP 369
           LLPSLDVVAVSQAPSPE N DSP
Sbjct: 167 LLPSLDVVAVSQAPSPELNPDSP 189


>UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;
           n=2; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 508

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 19/31 (61%), Positives = 20/31 (64%)
 Frame = +3

Query: 123 YLDNCGNSRANTCNQNSDQ*WDECFY*IKTN 215
           YLDNCGNSRANTC +      D C Y  KTN
Sbjct: 468 YLDNCGNSRANTCRRAPTS-GDACIYQTKTN 497



 Score = 33.5 bits (73), Expect = 4.6
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%)
 Frame = +1

Query: 1   PASSYMLVSKIK-PCMSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 177
           PASS  L  ++   C+S    Y  +TANGS+ Q WFL S    ++        +  R   
Sbjct: 426 PASSICLSQRLSHACLSTHGRY-SETANGSLNQLWFLWSLPSRYLDNCGNSRANTCRRAP 484

Query: 178 SDGMSAFIRSKPIDGGP 228
           + G +   ++K   G P
Sbjct: 485 TSGDACIYQTKTNPGSP 501


>UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1;
           Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry -
           Gallus gallus
          Length = 103

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 23/44 (52%), Positives = 26/44 (59%)
 Frame = -3

Query: 639 TTSFLTVTILVYXXXXXXXXXXXTRLALQLCLVKIFKVYSFRLR 508
           TTSFLT   L+Y           TRLALQ  LVK FKV SF+L+
Sbjct: 40  TTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFKVDSFQLQ 83


>UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130;
           n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY05130 - Plasmodium yoelii yoelii
          Length = 402

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = -1

Query: 416 VAVSQAPSPESNLDSPLPVTTMVVAETTIES 324
           +A+SQAPSPESN +SPLPV  M+     I+S
Sbjct: 372 LAISQAPSPESNSNSPLPVKAMLGQYPNIKS 402


>UniRef50_Q6Z8F1 Cluster: Putative uncharacterized protein
           P0459B01.16; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0459B01.16 - Oryza sativa subsp. japonica (Rice)
          Length = 172

 Score = 37.1 bits (82), Expect = 0.37
 Identities = 16/17 (94%), Positives = 16/17 (94%)
 Frame = +2

Query: 2   LPVVICLSQRLSHACLS 52
           LPVVICLSQRLSHAC S
Sbjct: 154 LPVVICLSQRLSHACAS 170


>UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus
           tropicalis|Rep: Novel protein - Xenopus tropicalis
           (Western clawed frog) (Silurana tropicalis)
          Length = 118

 Score = 35.9 bits (79), Expect = 0.86
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +3

Query: 309 MSALSTFDGSFCDYHG 356
           MSALSTFDG+FC YHG
Sbjct: 1   MSALSTFDGTFCAYHG 16


>UniRef50_A7HQK3 Cluster: Cytochrome c oxidase subunit II; n=1;
           Parvibaculum lavamentivorans DS-1|Rep: Cytochrome c
           oxidase subunit II - Parvibaculum lavamentivorans DS-1
          Length = 394

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 25/67 (37%), Positives = 32/67 (47%)
 Frame = -3

Query: 558 LQLCLVKIFKVYSFRLRAS*ESRIVIFRHYLPCREWVICAPAAFLGCGSRFSGSLSGIEP 379
           L L L ++F+V  F    S   +I + R     R   ICA AA  GC    SG LS ++P
Sbjct: 140 LDLRLDRVFRVVGFAHDTSPIRKITLLRRGPFRRAAAICAGAALSGC----SGDLSALDP 195

Query: 378 *FPVTRD 358
             P  RD
Sbjct: 196 AGPAARD 202


>UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 76

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 11/13 (84%), Positives = 11/13 (84%)
 Frame = -2

Query: 595 SWNYRGCWHQTCP 557
           SWNYR CWHQT P
Sbjct: 7   SWNYRSCWHQTGP 19


>UniRef50_Q8BL71 Cluster: Adult male corpora quadrigemina cDNA,
           RIKEN full-length enriched library, clone:B230353G19
           product:weakly similar to GROUP III SECRETED
           PHOSPHOLIPASE A2; n=1; Mus musculus|Rep: Adult male
           corpora quadrigemina cDNA, RIKEN full-length enriched
           library, clone:B230353G19 product:weakly similar to
           GROUP III SECRETED PHOSPHOLIPASE A2 - Mus musculus
           (Mouse)
          Length = 218

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 20/78 (25%), Positives = 28/78 (35%)
 Frame = +2

Query: 200 LDQNQSTEGLACEVVNFDDLDNFCRSHGQVPATHLSNVCLINFRW*FLRLPWLSRVTGNQ 379
           L  N          ++  D D  CR++G  P  HL      N  W   +    S     Q
Sbjct: 58  LQYNYGIRNFRFHTISHCDCDARCRAYGSTPLAHLRPRTYYNASW---KAEATSYTPSPQ 114

Query: 380 GSIPEREPEKRLPHPRKA 433
              P + P+KR P   +A
Sbjct: 115 SPAPSKHPQKRGPQQTQA 132


>UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1;
           Roseovarius sp. HTCC2601|Rep: Putative uncharacterized
           protein - Roseovarius sp. HTCC2601
          Length = 507

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 16/40 (40%), Positives = 24/40 (60%)
 Frame = +1

Query: 115 YSVTWITVVILELIHAIRTLTSDGMSAFIRSKPIDGGPRV 234
           YS T + VV+ EL+    T+ SD  +A I + P+DG  R+
Sbjct: 139 YSATSMAVVLSELVVDDETIPSDNAAAQISAGPVDGETRI 178


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 648,893,956
Number of Sequences: 1657284
Number of extensions: 13363099
Number of successful extensions: 30460
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 29432
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30454
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 50000004659
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).