SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0112
         (679 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...    94   3e-18
UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ...    64   3e-09
UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0...    58   3e-07
UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella ve...    51   2e-05
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    45   0.001
UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontog...    44   0.005
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    42   0.018
UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; ...    40   0.056
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    39   0.13 
UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; ...    38   0.17 
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    36   1.2  
UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia scl...    35   2.1  
UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7; ...    35   2.1  
UniRef50_Q00UM3 Cluster: Chromosome 16 contig 1, DNA sequence; n...    34   3.7  
UniRef50_Q5KHX1 Cluster: Putative uncharacterized protein; n=1; ...    33   4.8  
UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20; ...    33   6.4  
UniRef50_Q7F7E2 Cluster: OSJNBa0036E02.9 protein; n=5; Oryza sat...    33   8.4  
UniRef50_Q5KKC3 Cluster: Expressed protein; n=2; Filobasidiella ...    33   8.4  

>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 41/46 (89%), Positives = 42/46 (91%)
 Frame = +1

Query: 370 HQ*GKTNLSHDGLSPAHVPF*WVNNPTLGEFCFAMIGRADIEGSKS 507
           HQ GKTNLSHDGL PAHVP+ WVNNPTLGEFCF MIGRADIEGSKS
Sbjct: 57  HQWGKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKS 102



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 38/58 (65%), Positives = 41/58 (70%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIKPAFALLLH 674
           K +VAMNAWL QASYPCGNFS TS  K   LKDR A LS+ + VL I IK AF LL H
Sbjct: 101 KSNVAMNAWLPQASYPCGNFSDTSSFKFRSLKDRLATLSRFVFVLEIRIKRAFTLLFH 158


>UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 116

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 34/57 (59%), Positives = 40/57 (70%)
 Frame = -1

Query: 679 LAWSKRAKAGLIQMFSTHRDCESTAYRSFSIKSF*QEVPEKLPQG*LACXSQAFIAT 509
           L  +KR KA LI +FS + + ES AYRSF+  SF  EV EKLPQG LAC SQ FI+T
Sbjct: 30  LTQNKRVKATLILIFSRNTNRESVAYRSFNFTSFKLEVSEKLPQGQLACGSQEFIST 86



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 28/57 (49%), Positives = 33/57 (57%)
 Frame = -3

Query: 590 YKEFLARGARKVTTGITGLXXPSVHSDVLFDPSMSALPIIAKQNSPSVGLFTHQKGT 420
           +  F    + K+  G          S +LFDPSMSALPII KQNS  VGLFT Q+GT
Sbjct: 60  FTSFKLEVSEKLPQGQLACGSQEFISTLLFDPSMSALPIIVKQNSQRVGLFTRQQGT 116


>UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep:
           LRRG00134 - Rattus norvegicus (Rat)
          Length = 221

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 24/25 (96%), Positives = 24/25 (96%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCF MIGRADIEGSKS
Sbjct: 25  WVNNPTLGEFCFTMIGRADIEGSKS 49



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 21/27 (77%), Positives = 21/27 (77%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*K 581
           K  VAMNAW  QASYPCGNFS TSC K
Sbjct: 48  KSDVAMNAWPPQASYPCGNFSDTSCLK 74


>UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 746

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 22/30 (73%), Positives = 26/30 (86%)
 Frame = -3

Query: 356 IVILLSTRGTAVSDIWFMHSAERPVVRSYH 267
           +VILLSTRGTA SD W +H AE+P+VRSYH
Sbjct: 660 VVILLSTRGTADSDNWHLHLAEKPMVRSYH 689


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 18/19 (94%), Positives = 18/19 (94%)
 Frame = +3

Query: 516 MNAWLXQASYPCGNFSGTS 572
           MNAWL QASYPCGNFSGTS
Sbjct: 1   MNAWLPQASYPCGNFSGTS 19


>UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3;
           Euarchontoglires|Rep: 4933429F08Rik protein - Mus
           musculus (Mouse)
          Length = 29

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/22 (81%), Positives = 18/22 (81%)
 Frame = +3

Query: 516 MNAWLXQASYPCGNFSGTSC*K 581
           MNAW  QASYPCGNFS TSC K
Sbjct: 1   MNAWPPQASYPCGNFSDTSCLK 22


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 41.5 bits (93), Expect = 0.018
 Identities = 17/24 (70%), Positives = 19/24 (79%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTS 572
           K +VA +AW  QASYPCGNFS TS
Sbjct: 11  KSYVARSAWQPQASYPCGNFSDTS 34


>UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4;
           Bacteria|Rep: Putative uncharacterized protein -
           Magnetospirillum gryphiswaldense
          Length = 76

 Score = 39.9 bits (89), Expect = 0.056
 Identities = 20/34 (58%), Positives = 21/34 (61%)
 Frame = -1

Query: 493 RCRLFLSLRSKIRQALDCSPIKRERELGLDRRET 392
           RCRL  S      Q   CSPIK  RELGL+RRET
Sbjct: 4   RCRLITSWGWSRSQGFGCSPIKVVRELGLERRET 37


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 38.7 bits (86), Expect = 0.13
 Identities = 15/19 (78%), Positives = 17/19 (89%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGN 557
           K +VAMNAWL QASYPCG+
Sbjct: 11  KSNVAMNAWLPQASYPCGS 29



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 17/31 (54%), Positives = 20/31 (64%)
 Frame = +2

Query: 587 YTKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           Y  GSIG AF V +RTE+ +Q SF PF   E
Sbjct: 25  YPCGSIGHAFTVCIRTENQNQMSFYPFVLHE 55


>UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4;
           Eukaryota|Rep: Putative uncharacterized protein -
           Plasmodium berghei
          Length = 54

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 16/18 (88%), Positives = 16/18 (88%)
 Frame = -1

Query: 445 DCSPIKRERELGLDRRET 392
           DCSP  RERELGLDRRET
Sbjct: 6   DCSPANRERELGLDRRET 23


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 14/21 (66%), Positives = 16/21 (76%)
 Frame = +3

Query: 495 RIKKHVAMNAWLXQASYPCGN 557
           R K +VA NAW  QASYPCG+
Sbjct: 9   RSKSYVAKNAWQPQASYPCGS 29


>UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia
           sclerotiorum 1980|Rep: Predicted protein - Sclerotinia
           sclerotiorum 1980
          Length = 147

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 15/23 (65%), Positives = 18/23 (78%)
 Frame = +1

Query: 436 VNNPTLGEFCFAMIGRADIEGSK 504
           VN+P L EFCF +  RADIEGS+
Sbjct: 120 VNSPMLTEFCFGIRERADIEGSE 142


>UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7;
           Archaea|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-062
          Length = 272

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 19/39 (48%), Positives = 21/39 (53%)
 Frame = -2

Query: 492 DVGSSYHCEAKFAKRWIVHPSKGNVSWA*TVVRQVSFTL 376
           DV SS+   A  AK  +  P KGNV W  TV RQV   L
Sbjct: 228 DVVSSHPGGAAAAKGGVARPLKGNVRWVQTVARQVGLYL 266


>UniRef50_Q00UM3 Cluster: Chromosome 16 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 16 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 367

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 21/60 (35%), Positives = 26/60 (43%)
 Frame = -2

Query: 393 QVSFTLLMACRCDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLS*TPLRPKPA*PNP 214
           ++S T +MA   D N     R RSF  ++    R  G    P  GLS   L P  A P P
Sbjct: 82  EISSTTIMALAADCNAVAIARRRSFLFILIDQSRGFGPNDTPPPGLSGVRLEPARALPVP 141


>UniRef50_Q5KHX1 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 628

 Score = 33.5 bits (73), Expect = 4.8
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = -2

Query: 357 DSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLS-*TPLR-PKPA*PNP 214
           ++  A ++  RS G LV  LGR  G  KLPS   S  +P R P P   NP
Sbjct: 48  EAGDADFDPERSLGRLVDELGRVMGSDKLPSRPSSPFSPTRTPTPLGSNP 97


>UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20;
           n=1; Yarrowia lipolytica|Rep: Serine/threonine-protein
           kinase STE20 - Yarrowia lipolytica (Candida lipolytica)
          Length = 1125

 Score = 33.1 bits (72), Expect = 6.4
 Identities = 22/69 (31%), Positives = 30/69 (43%)
 Frame = -2

Query: 303 ALGRAAGGAKLPSAGLS*TPLRPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR 124
           A G +  GA  PSA     P RP PA   P  + S+ +P S      +T L AF  +  +
Sbjct: 639 ASGDSGAGAAPPSAAPKSPPPRPPPA--PPLGVPSVHAPNSEYRQKMITQLEAFNAKRQQ 696

Query: 123 RDVEAHLDR 97
              E H  +
Sbjct: 697 ERAERHAQK 705


>UniRef50_Q7F7E2 Cluster: OSJNBa0036E02.9 protein; n=5; Oryza
           sativa|Rep: OSJNBa0036E02.9 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 498

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%)
 Frame = +3

Query: 129 RFECETRLVKSH---CLEPPDSRGSTVSISLPDSARLVSALEAFRIIPRM 269
           R  C  R +K H   C  PP  R +  S++LP  +RL     A RI+ R+
Sbjct: 425 RLRCRLRCIKLHPGGCFAPPTHRLNAFSLALPSHSRLWLPSAAPRILSRI 474


>UniRef50_Q5KKC3 Cluster: Expressed protein; n=2; Filobasidiella
           neoformans|Rep: Expressed protein - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 778

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 18/49 (36%), Positives = 24/49 (48%)
 Frame = -2

Query: 357 DSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLS*TPLRPKPA*PNPA 211
           D     ++  RS G LV  LGR  G  KLP   +  +P RP+   P P+
Sbjct: 147 DQGDGGFDPERSLGRLVGELGRIIGDEKLPK--IPNSPFRPRSRSPLPS 193


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 686,630,065
Number of Sequences: 1657284
Number of extensions: 13564049
Number of successful extensions: 32839
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 31838
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32829
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 52479343733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).