SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0110
         (490 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5C0F6 Cluster: Putative uncharacterized protein; n=1; ...    57   2e-07
UniRef50_Q6NKM5 Cluster: LD48059p; n=1; Drosophila melanogaster|...    53   4e-06
UniRef50_A7RNM9 Cluster: Predicted protein; n=4; Eumetazoa|Rep: ...    51   1e-05
UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;...    51   2e-05
UniRef50_UPI0000F2E2E1 Cluster: PREDICTED: similar to SH2-B homo...    50   3e-05
UniRef50_Q59KL1 Cluster: Putative uncharacterized protein; n=1; ...    45   0.001
UniRef50_A3LSK4 Cluster: Predicted protein; n=4; Ascomycota|Rep:...    45   0.001
UniRef50_Q652R5 Cluster: Putative uncharacterized protein P0603C...    38   0.091
UniRef50_A4M975 Cluster: Putative uncharacterized protein; n=1; ...    36   0.48 
UniRef50_Q4P4F7 Cluster: Putative uncharacterized protein; n=1; ...    36   0.48 
UniRef50_A3LSK3 Cluster: Predicted protein; n=7; Fungi/Metazoa g...    36   0.64 
UniRef50_UPI0000F2EBE7 Cluster: PREDICTED: similar to COL5A2 pro...    35   0.84 
UniRef50_Q17778 Cluster: Deoxyribonuclease-2 precursor; n=1; Cae...    35   1.1  
UniRef50_Q4H3J4 Cluster: Transcription factor protein; n=2; Cion...    34   1.5  
UniRef50_A0C4X9 Cluster: Chromosome undetermined scaffold_15, wh...    33   2.6  
UniRef50_A5KL06 Cluster: Putative uncharacterized protein; n=10;...    32   6.0  
UniRef50_A1ZJS2 Cluster: Putative uncharacterized protein; n=1; ...    32   7.9  

>UniRef50_Q5C0F6 Cluster: Putative uncharacterized protein; n=1;
           Schistosoma japonicum|Rep: Putative uncharacterized
           protein - Schistosoma japonicum (Blood fluke)
          Length = 102

 Score = 56.8 bits (131), Expect = 2e-07
 Identities = 24/29 (82%), Positives = 25/29 (86%)
 Frame = +3

Query: 255 CKSIVGTGYRGERLIEPSSSWVRPKFPSG 341
           CKS+V  GYRGERLIEPSSSW  PKFPSG
Sbjct: 74  CKSVVRPGYRGERLIEPSSSWFPPKFPSG 102



 Score = 49.2 bits (112), Expect = 5e-05
 Identities = 23/40 (57%), Positives = 28/40 (70%)
 Frame = +1

Query: 136 PISE*RRALSTNAGTRKMVNYAWSGRSQGKP*WRTVAILT 255
           P +  R + S    TRKMVNYAW+GRSQ K  WR+VA+LT
Sbjct: 34  PAAPGRWSTSARVRTRKMVNYAWAGRSQRKLWWRSVAVLT 73


>UniRef50_Q6NKM5 Cluster: LD48059p; n=1; Drosophila
           melanogaster|Rep: LD48059p - Drosophila melanogaster
           (Fruit fly)
          Length = 46

 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 23/31 (74%), Positives = 26/31 (83%)
 Frame = +3

Query: 162 EHKCWDPKDGELCLVRSQSGETLMEDRSDSD 254
           EH C DPKDGEL L+R +SGETLMEDR+ SD
Sbjct: 9   EHICCDPKDGELYLIRLKSGETLMEDRNSSD 39


>UniRef50_A7RNM9 Cluster: Predicted protein; n=4; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 53

 Score = 51.2 bits (117), Expect = 1e-05
 Identities = 23/43 (53%), Positives = 26/43 (60%)
 Frame = -2

Query: 291 FRPYTQFRRSICSQNRYGPPSGFPLTAT*PGIVHHLSGPSICA 163
           F P  +F      QNRY PP  FPL +   GIVHHLSGP+ CA
Sbjct: 2   FAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNRCA 44


>UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 440

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 21/34 (61%), Positives = 26/34 (76%)
 Frame = -2

Query: 252 QNRYGPPSGFPLTAT*PGIVHHLSGPSICAQSAP 151
           Q+RYGPP  FPL +  PGIVHHLSGP+  A++ P
Sbjct: 125 QDRYGPPPEFPLASPCPGIVHHLSGPNAYARAPP 158


>UniRef50_UPI0000F2E2E1 Cluster: PREDICTED: similar to SH2-B
           homolog,; n=2; Mammalia|Rep: PREDICTED: similar to SH2-B
           homolog, - Monodelphis domestica
          Length = 394

 Score = 50.0 bits (114), Expect = 3e-05
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = -2

Query: 252 QNRYGPPSGFPLTAT*PGIVHHLSGPSICAQSAP 151
           Q+RYGPP  FPL +  PGIVHHLSGP+  A + P
Sbjct: 62  QDRYGPPPEFPLASPCPGIVHHLSGPNTHAHAPP 95


>UniRef50_Q59KL1 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 108

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 22/31 (70%), Positives = 23/31 (74%)
 Frame = -1

Query: 253 SESLRSSIRVSPDCDLTRHSSPSFGSQHLCS 161
           SE LR+S RVS    L RHSSPSFGSQ LCS
Sbjct: 19  SEPLRASTRVSSGFTLFRHSSPSFGSQQLCS 49



 Score = 38.3 bits (85), Expect = 0.091
 Identities = 16/18 (88%), Positives = 17/18 (94%)
 Frame = -2

Query: 306 MVRLVFRPYTQFRRSICS 253
           MVRLVFRPYTQ RRSIC+
Sbjct: 1   MVRLVFRPYTQIRRSICT 18


>UniRef50_A3LSK4 Cluster: Predicted protein; n=4; Ascomycota|Rep:
           Predicted protein - Pichia stipitis (Yeast)
          Length = 81

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 20/40 (50%), Positives = 23/40 (57%)
 Frame = -2

Query: 291 FRPYTQFRRSICSQNRYGPPSGFPLTAT*PGIVHHLSGPS 172
           F P  +F      QNRY PP  FP  +   GIVHHLSGP+
Sbjct: 2   FAPIPKFDDRFARQNRYEPPPEFPSASPYSGIVHHLSGPN 41


>UniRef50_Q652R5 Cluster: Putative uncharacterized protein
           P0603C10.50; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0603C10.50 - Oryza sativa subsp. japonica (Rice)
          Length = 248

 Score = 38.3 bits (85), Expect = 0.091
 Identities = 16/21 (76%), Positives = 17/21 (80%)
 Frame = -1

Query: 343 YPEGNFGRTQLLDGSISLSPL 281
           YPEGNFG  QLLDGSI L P+
Sbjct: 19  YPEGNFGGNQLLDGSIGLIPI 39



 Score = 37.5 bits (83), Expect = 0.16
 Identities = 16/39 (41%), Positives = 22/39 (56%)
 Frame = -2

Query: 285 PYTQFRRSICSQNRYGPPSGFPLTAT*PGIVHHLSGPSI 169
           P  +  +    Q R+ PP  FPLT+    I+HHLSGP +
Sbjct: 38  PIPKSDKRFVRQYRFEPPLDFPLTSPRSSIIHHLSGPDM 76


>UniRef50_A4M975 Cluster: Putative uncharacterized protein; n=1;
           Petrotoga mobilis SJ95|Rep: Putative uncharacterized
           protein - Petrotoga mobilis SJ95
          Length = 124

 Score = 35.9 bits (79), Expect = 0.48
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 2/63 (3%)
 Frame = -2

Query: 345 AILRETSDGPSY*MVRLVFRPYTQFRRSICSQNRYGPPSGFPLTAT*PGIVHHLSG--PS 172
           A+    S   SY  VRL F  Y    R   + +++GPP GF   ++   + H  SG  P 
Sbjct: 24  AVPTHVSGRTSYPQVRLAFHSYPHVIRGFFTIHQFGPPLGFTQASSCTWVAHLASGLFPV 83

Query: 171 ICA 163
            CA
Sbjct: 84  TCA 86


>UniRef50_Q4P4F7 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 1918

 Score = 35.9 bits (79), Expect = 0.48
 Identities = 26/94 (27%), Positives = 38/94 (40%)
 Frame = -1

Query: 427  RLRSFRPKCL*SCALPDETVLKFYIDASYPEGNFGRTQLLDGSISLSPLYPVPTIDLQSE 248
            RL++F   C    AL  +     + D   P   F     LD  ++L P  P+    ++  
Sbjct: 1049 RLKAFHHACAKFVALRSQASTSNHADGLLPLSFFWTEAPLDLFLALVPT-PIMDESVEET 1107

Query: 247  SLRSSIRVSPDCDLTRHSSPSFGSQHLCSERAFI 146
             L   ++V+P CDL      S G  H   E A I
Sbjct: 1108 VLDPQVQVTPICDLPEQLKASLGLTHRALEEAGI 1141


>UniRef50_A3LSK3 Cluster: Predicted protein; n=7; Fungi/Metazoa
           group|Rep: Predicted protein - Pichia stipitis (Yeast)
          Length = 94

 Score = 35.5 bits (78), Expect = 0.64
 Identities = 15/20 (75%), Positives = 19/20 (95%)
 Frame = -1

Query: 457 GVLTHLKFENRLRSFRPKCL 398
           G+LT+LKFENRLRSF+P+ L
Sbjct: 75  GLLTYLKFENRLRSFQPQDL 94


>UniRef50_UPI0000F2EBE7 Cluster: PREDICTED: similar to COL5A2
           protein; n=9; Monodelphis domestica|Rep: PREDICTED:
           similar to COL5A2 protein - Monodelphis domestica
          Length = 774

 Score = 35.1 bits (77), Expect = 0.84
 Identities = 14/21 (66%), Positives = 16/21 (76%)
 Frame = -2

Query: 252 QNRYGPPSGFPLTAT*PGIVH 190
           Q+RYGPP  FPL +  PGIVH
Sbjct: 26  QDRYGPPPEFPLASPCPGIVH 46


>UniRef50_Q17778 Cluster: Deoxyribonuclease-2 precursor; n=1;
           Caenorhabditis elegans|Rep: Deoxyribonuclease-2
           precursor - Caenorhabditis elegans
          Length = 375

 Score = 34.7 bits (76), Expect = 1.1
 Identities = 25/94 (26%), Positives = 47/94 (50%), Gaps = 1/94 (1%)
 Frame = -1

Query: 382 PDETVLKFYIDASYPEGNFGRTQLLDGSISLSPLYPVPTIDLQSESLRSSIRVSPDCDLT 203
           P ++V++    A Y   NF +++  +  +  + + P    DL  E+ R    +  DC LT
Sbjct: 239 PFQSVIELETMAGYSFTNFAKSKEFNADLYDTLVAPTLKTDLVVETWRRGSEIPLDCKLT 298

Query: 202 RHSSPSFGSQHLCSERAFIH*LETSRLG-SAKIT 104
            H++ +  S H+ S  AF +  + S++  SA +T
Sbjct: 299 YHANDAL-SIHVGSTTAFSYTKDHSKMAHSADMT 331


>UniRef50_Q4H3J4 Cluster: Transcription factor protein; n=2; Ciona
           intestinalis|Rep: Transcription factor protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 484

 Score = 34.3 bits (75), Expect = 1.5
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 2/107 (1%)
 Frame = -2

Query: 399 SNHALYRMRLF*NFISTPAILRETSDGPSY*MVRLVFRPYTQFRRSICSQNRYG--PPSG 226
           S+HAL R +   N  S    L    D PSY M+        Q ++ + ++ R+G  P  G
Sbjct: 124 SHHALSRYQHIANVRSGEVGLNSIEDNPSYNMINR--HNLYQAQQQLLNRPRFGTFPTPG 181

Query: 225 FPLTAT*PGIVHHLSGPSICAQSAPSFTDWKRAASGVRKSRT*LDNF 85
           FP+    PG++ H   P     S P     + AA+ V   R+ +  F
Sbjct: 182 FPMK---PGMMGHPLNPQY-LPSLPGMQSPEAAAAAVAYFRSAMTGF 224


>UniRef50_A0C4X9 Cluster: Chromosome undetermined scaffold_15, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_15,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 350

 Score = 33.5 bits (73), Expect = 2.6
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 5/46 (10%)
 Frame = +3

Query: 207 RSQSGETLMEDRSDSDCKSIV-----GTGYRGERLIEPSSSWVRPK 329
           + + GE ++E+ SD D   +V     G GYRGE L E  +   +PK
Sbjct: 212 QDEQGEKIIENLSDEDLGKVVRELLRGDGYRGEYLFEDDTKSTKPK 257


>UniRef50_A5KL06 Cluster: Putative uncharacterized protein; n=10;
           Bacteria|Rep: Putative uncharacterized protein -
           Ruminococcus torques ATCC 27756
          Length = 245

 Score = 32.3 bits (70), Expect = 6.0
 Identities = 23/59 (38%), Positives = 29/59 (49%)
 Frame = -2

Query: 354 STPAILRETSDGPSY*MVRLVFRPYTQFRRSICSQNRYGPPSGFPLTAT*PGIVHHLSG 178
           S  AI R TS    Y  VRL F PY     ++ +   +GPP  F  T+T   I H +SG
Sbjct: 5   SPKAISRRTS----YLRVRLEFLPYPHLIPTLFNGCGFGPPLPFTATSTWTWIDHPVSG 59


>UniRef50_A1ZJS2 Cluster: Putative uncharacterized protein; n=1;
           Microscilla marina ATCC 23134|Rep: Putative
           uncharacterized protein - Microscilla marina ATCC 23134
          Length = 199

 Score = 31.9 bits (69), Expect = 7.9
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = -1

Query: 343 YPEGNFGRTQLLDGSISLSPLYPVPTIDL-QSESLRSSIRV 224
           YP G  G+TQ+L G  +LS L+P+P  D  +  S +S +++
Sbjct: 46  YPAG--GQTQILRGDFTLSTLFPLPPYDFAKGGSAKSPVKL 84


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 475,626,540
Number of Sequences: 1657284
Number of extensions: 9666881
Number of successful extensions: 20034
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 19659
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20032
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 28019067077
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).