SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0109
         (498 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B432D Cluster: PREDICTED: similar to munc13-4; ...   103   2e-21
UniRef50_Q9VBY8 Cluster: CG11819-PA; n=1; Drosophila melanogaste...    95   8e-19
UniRef50_UPI0000DB72C1 Cluster: PREDICTED: similar to CG11819-PA...    78   1e-13
UniRef50_Q6Z6R6 Cluster: C2 domain-containing protein-like; n=3;...    64   1e-09
UniRef50_O61224 Cluster: Serine/Threonine protein kinase; n=1; S...    64   2e-09
UniRef50_P05129 Cluster: Protein kinase C gamma type; n=98; Eume...    64   2e-09
UniRef50_P90980 Cluster: Protein kinase C-like 2; n=49; Eumetazo...    63   3e-09
UniRef50_Q6FKH9 Cluster: Similar to sp|Q03640 Saccharomyces cere...    63   4e-09
UniRef50_Q69G16 Cluster: Protein kinase C type beta; n=2; Bilate...    62   7e-09
UniRef50_Q9BQG1 Cluster: Synaptotagmin-3; n=19; Euteleostomi|Rep...    62   9e-09
UniRef50_O94812 Cluster: BAI1-associated protein 3; n=16; Theria...    50   4e-08
UniRef50_UPI0000DB79ED Cluster: PREDICTED: similar to Rabphilin ...    60   4e-08
UniRef50_Q3Y418 Cluster: Synaptotagmin protein 2; n=4; Caenorhab...    60   4e-08
UniRef50_Q872A4 Cluster: Related to phosphatidylserine decarboxy...    59   5e-08
UniRef50_Q6XYQ8 Cluster: Synaptotagmin-10; n=79; Gnathostomata|R...    59   5e-08
UniRef50_Q8CF95 Cluster: Synaptotagmin VIIgamma; n=4; Eutheria|R...    59   6e-08
UniRef50_P13677 Cluster: Protein kinase C, eye isozyme (EC 2.7.1...    59   6e-08
UniRef50_A2EYC8 Cluster: C2 domain containing protein; n=2; Tric...    58   8e-08
UniRef50_A7QXA9 Cluster: Chromosome chr19 scaffold_218, whole ge...    58   1e-07
UniRef50_UPI00015B5D82 Cluster: PREDICTED: hypothetical protein;...    57   2e-07
UniRef50_Q9LPH4 Cluster: T3F20.10 protein; n=6; Arabidopsis thal...    57   2e-07
UniRef50_A7RFY4 Cluster: Predicted protein; n=1; Nematostella ve...    57   2e-07
UniRef50_O43581 Cluster: Synaptotagmin-7; n=62; Eumetazoa|Rep: S...    57   2e-07
UniRef50_UPI0000F2EC82 Cluster: PREDICTED: similar to synaptotag...    56   3e-07
UniRef50_Q9FYD9 Cluster: Calcium lipid binding protein-like; n=3...    56   3e-07
UniRef50_UPI00006A071C Cluster: BAI1-associated protein 3 (BAP3)...    46   4e-07
UniRef50_Q5RG04 Cluster: Novel protein similar to vertebrate syn...    56   4e-07
UniRef50_Q0JP57 Cluster: Os01g0242600 protein; n=4; Oryza sativa...    56   6e-07
UniRef50_Q6NN63 Cluster: RH64806p; n=7; Endopterygota|Rep: RH648...    56   6e-07
UniRef50_UPI0000660ADD Cluster: Synaptotagmin-2 (Synaptotagmin I...    55   8e-07
UniRef50_Q9W2R9 Cluster: CG11556-PA; n=4; Sophophora|Rep: CG1155...    55   8e-07
UniRef50_O43374 Cluster: Ras GTPase-activating protein 4; n=65; ...    55   8e-07
UniRef50_Q9ESN1 Cluster: Double C2-like domain-containing protei...    55   8e-07
UniRef50_A2CE77 Cluster: Novel protein similar to vertebrate RAS...    55   1e-06
UniRef50_Q86J14 Cluster: Similar to Dictyostelium discoideum (Sl...    54   1e-06
UniRef50_O96997 Cluster: Protein kinase C; n=2; Tetractinomorpha...    54   1e-06
UniRef50_UPI00015B4343 Cluster: PREDICTED: similar to CG2381-PA;...    54   2e-06
UniRef50_UPI0000EBC5BC Cluster: PREDICTED: similar to Synaptotag...    54   2e-06
UniRef50_UPI0000E4A632 Cluster: PREDICTED: similar to Syt7 prote...    54   2e-06
UniRef50_UPI0000EB28DE Cluster: Synaptotagmin-6 (Synaptotagmin V...    54   2e-06
UniRef50_Q3UY13 Cluster: Adult male olfactory brain cDNA, RIKEN ...    54   2e-06
UniRef50_Q6Z8U1 Cluster: C2 domain/GRAM domain-containing protei...    54   2e-06
UniRef50_Q9I7M6 Cluster: CG5559-PA; n=4; Diptera|Rep: CG5559-PA ...    54   2e-06
UniRef50_A2E8X1 Cluster: C2 domain containing protein; n=4; Tric...    54   2e-06
UniRef50_Q59EZ0 Cluster: Protein kinase C, gamma variant; n=5; E...    54   2e-06
UniRef50_Q0UEG6 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_UPI0000D565A6 Cluster: PREDICTED: similar to CG11556-PA...    53   3e-06
UniRef50_A7QTN2 Cluster: Chromosome chr11 scaffold_170, whole ge...    53   3e-06
UniRef50_A5APY9 Cluster: Putative uncharacterized protein; n=1; ...    53   3e-06
UniRef50_Q55F06 Cluster: Putative uncharacterized protein; n=1; ...    53   3e-06
UniRef50_Q32P40 Cluster: PCLO protein; n=7; Tetrapoda|Rep: PCLO ...    53   3e-06
UniRef50_P21579 Cluster: Synaptotagmin-1; n=84; Eumetazoa|Rep: S...    53   3e-06
UniRef50_Q9Y6V0 Cluster: Protein piccolo; n=17; Amniota|Rep: Pro...    53   3e-06
UniRef50_UPI00015556CD Cluster: PREDICTED: hypothetical protein;...    53   4e-06
UniRef50_UPI00005883FB Cluster: PREDICTED: similar to B/K protei...    53   4e-06
UniRef50_Q965S5 Cluster: Synaptotagmin protein 3; n=2; Caenorhab...    53   4e-06
UniRef50_A7SG63 Cluster: Predicted protein; n=1; Nematostella ve...    53   4e-06
UniRef50_A2FZS0 Cluster: C2 domain containing protein; n=3; Tric...    53   4e-06
UniRef50_Q9FY55 Cluster: CLB1-like protein; n=15; Magnoliophyta|...    52   5e-06
UniRef50_Q9V4C4 Cluster: CG2381-PA, isoform A; n=6; Endopterygot...    52   5e-06
UniRef50_UPI00015B4FEC Cluster: PREDICTED: similar to CG15078-PA...    52   7e-06
UniRef50_UPI00015A4B3C Cluster: UPI00015A4B3C related cluster; n...    52   7e-06
UniRef50_Q9JM89 Cluster: Synaptotagmin II; n=3; Mammalia|Rep: Sy...    52   7e-06
UniRef50_A2FDM6 Cluster: C2 domain containing protein; n=1; Tric...    52   7e-06
UniRef50_Q8N9I0 Cluster: Synaptotagmin-2; n=18; Tetrapoda|Rep: S...    52   7e-06
UniRef50_A6SCP3 Cluster: Putative uncharacterized protein; n=2; ...    52   1e-05
UniRef50_UPI0000D55D8D Cluster: PREDICTED: similar to synaptotag...    51   1e-05
UniRef50_Q4S9W0 Cluster: Chromosome undetermined SCAF14694, whol...    51   1e-05
UniRef50_A7EYQ9 Cluster: Putative uncharacterized protein; n=1; ...    51   1e-05
UniRef50_UPI0000E481BD Cluster: PREDICTED: similar to Transmembr...    51   2e-05
UniRef50_Q9LEX1 Cluster: CaLB protein; n=9; Magnoliophyta|Rep: C...    51   2e-05
UniRef50_A2D7F1 Cluster: C2 domain containing protein; n=1; Tric...    51   2e-05
UniRef50_Q6C3Y8 Cluster: Similar to wi|NCU03263.1 Neurospora cra...    51   2e-05
UniRef50_A0JJX1 Cluster: NtermTM-C2Type1.2 protein; n=2; Physcom...    50   2e-05
UniRef50_Q66KE5 Cluster: MGC86555 protein; n=9; Euteleostomi|Rep...    50   3e-05
UniRef50_A7TNP3 Cluster: Putative uncharacterized protein; n=1; ...    50   3e-05
UniRef50_UPI0000E47252 Cluster: PREDICTED: similar to ENSANGP000...    50   4e-05
UniRef50_Q4RUZ4 Cluster: Chromosome 12 SCAF14993, whole genome s...    50   4e-05
UniRef50_Q259Q9 Cluster: Glutathione peroxidase; n=5; Magnolioph...    50   4e-05
UniRef50_Q7RUV0 Cluster: Putative uncharacterized protein B14D6....    50   4e-05
UniRef50_A4RHF5 Cluster: Putative uncharacterized protein; n=2; ...    50   4e-05
UniRef50_Q03640 Cluster: Tricalbin-3; n=2; Saccharomyces cerevis...    50   4e-05
UniRef50_Q1EC12 Cluster: IP11216p; n=5; Endopterygota|Rep: IP112...    49   5e-05
UniRef50_A7RQE8 Cluster: Predicted protein; n=1; Nematostella ve...    49   5e-05
UniRef50_A2EZF8 Cluster: C2 domain containing protein; n=2; Tric...    49   5e-05
UniRef50_A2QU82 Cluster: Catalytic activity: Phosphatidyl-L-seri...    49   5e-05
UniRef50_Q9UT00 Cluster: Uncharacterized protein PYUK71.03c; n=2...    49   5e-05
UniRef50_Q12466 Cluster: Tricalbin-1; n=6; Saccharomycetaceae|Re...    49   5e-05
UniRef50_O00445 Cluster: Synaptotagmin-5; n=35; Bilateria|Rep: S...    49   5e-05
UniRef50_UPI00015B587F Cluster: PREDICTED: similar to GA15723-PA...    49   7e-05
UniRef50_UPI0000E81A79 Cluster: PREDICTED: hypothetical protein ...    49   7e-05
UniRef50_UPI00005A11E3 Cluster: PREDICTED: similar to BAI1-assoc...    49   7e-05
UniRef50_A4S8P5 Cluster: Predicted protein; n=1; Ostreococcus lu...    49   7e-05
UniRef50_A2FRX6 Cluster: C2 domain containing protein; n=5; Tric...    49   7e-05
UniRef50_Q9UUY6 Cluster: Transmembrane protein; n=3; Pezizomycot...    49   7e-05
UniRef50_Q8NB66 Cluster: Protein unc-13 homolog C; n=28; Euteleo...    49   7e-05
UniRef50_Q9NZM3 Cluster: Intersectin-2; n=40; Euteleostomi|Rep: ...    49   7e-05
UniRef50_UPI0000F1E4F7 Cluster: PREDICTED: similar to Multiple C...    48   9e-05
UniRef50_UPI000069E2B8 Cluster: Fer-1-like 4 (C. elegans); n=5; ...    48   9e-05
UniRef50_Q9VUJ3 Cluster: CG3020-PA; n=3; Sophophora|Rep: CG3020-...    48   9e-05
UniRef50_A2DBY2 Cluster: XYPPX repeat family protein; n=1; Trich...    48   9e-05
UniRef50_Q6BUH3 Cluster: Similar to tr|Q12466 Saccharomyces cere...    48   9e-05
UniRef50_O14795 Cluster: Protein unc-13 homolog B; n=48; Eumetaz...    48   9e-05
UniRef50_Q14183 Cluster: Double C2-like domain-containing protei...    48   9e-05
UniRef50_UPI000155C669 Cluster: PREDICTED: similar to munc 13-1;...    48   1e-04
UniRef50_Q4SUJ8 Cluster: Chromosome undetermined SCAF13899, whol...    48   1e-04
UniRef50_A2F388 Cluster: C2 domain containing protein; n=1; Tric...    48   1e-04
UniRef50_Q4WAM6 Cluster: Membrane bound C2 domain protein (Vp115...    48   1e-04
UniRef50_Q2UC55 Cluster: Phosphatidylserine decarboxylase; n=5; ...    48   1e-04
UniRef50_A4RK65 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_Q9UPW8 Cluster: Protein unc-13 homolog A; n=15; Euteleo...    48   1e-04
UniRef50_Q4T435 Cluster: Chromosome undetermined SCAF9838, whole...    48   2e-04
UniRef50_Q0E927 Cluster: CG15078-PC, isoform C; n=7; Diptera|Rep...    48   2e-04
UniRef50_A7RQE7 Cluster: Predicted protein; n=1; Nematostella ve...    48   2e-04
UniRef50_A2EVN2 Cluster: XYPPX repeat family protein; n=1; Trich...    48   2e-04
UniRef50_Q6BSE5 Cluster: Similar to CA3124|IPF5353.3 Candida alb...    48   2e-04
UniRef50_Q9USG8 Cluster: Meiotically up-regulated gene 190 prote...    48   2e-04
UniRef50_UPI0000E4A5D1 Cluster: PREDICTED: similar to mKIAA0734 ...    47   2e-04
UniRef50_UPI000065FF01 Cluster: Homolog of Homo sapiens "Rabphil...    47   2e-04
UniRef50_Q55DS5 Cluster: Putative uncharacterized protein; n=1; ...    47   2e-04
UniRef50_A2FNQ6 Cluster: XYPPX repeat family protein; n=1; Trich...    47   2e-04
UniRef50_Q6CDF0 Cluster: Similar to DEHA0F10824g Debaryomyces ha...    47   2e-04
UniRef50_A6R438 Cluster: Putative uncharacterized protein; n=1; ...    47   2e-04
UniRef50_Q9Y2J0 Cluster: Rabphilin-3A; n=48; Deuterostomia|Rep: ...    47   2e-04
UniRef50_UPI00015B593D Cluster: PREDICTED: similar to bitesize; ...    47   3e-04
UniRef50_A7PT45 Cluster: Chromosome chr8 scaffold_29, whole geno...    47   3e-04
UniRef50_Q0IFK0 Cluster: Putative uncharacterized protein; n=1; ...    47   3e-04
UniRef50_Q4PAR4 Cluster: Putative uncharacterized protein; n=1; ...    47   3e-04
UniRef50_Q9QYX7 Cluster: Protein piccolo; n=22; cellular organis...    47   3e-04
UniRef50_UPI00003C022B Cluster: PREDICTED: similar to Synaptotag...    46   4e-04
UniRef50_Q17IK9 Cluster: Putative uncharacterized protein; n=1; ...    46   4e-04
UniRef50_A7T2P9 Cluster: Predicted protein; n=2; Nematostella ve...    46   4e-04
UniRef50_Q6CWE6 Cluster: Similar to sp|Q03640 Saccharomyces cere...    46   4e-04
UniRef50_Q7L804 Cluster: Rab11 family-interacting protein 2; n=2...    46   4e-04
UniRef50_UPI000155C868 Cluster: PREDICTED: hypothetical protein;...    46   5e-04
UniRef50_UPI0000E4A2C5 Cluster: PREDICTED: similar to otoferlin,...    46   5e-04
UniRef50_Q4S4L6 Cluster: Chromosome 2 SCAF14738, whole genome sh...    46   5e-04
UniRef50_Q6XK19 Cluster: Bitesize isoform 2; n=6; Diptera|Rep: B...    46   5e-04
UniRef50_Q59DX2 Cluster: CG33555-PA, isoform A; n=4; Coelomata|R...    46   5e-04
UniRef50_A7RZG6 Cluster: Predicted protein; n=2; Nematostella ve...    46   5e-04
UniRef50_A7RS41 Cluster: Predicted protein; n=1; Nematostella ve...    46   5e-04
UniRef50_A2FZR9 Cluster: C2 domain containing protein; n=1; Tric...    46   5e-04
UniRef50_A2F8Y1 Cluster: C2 domain containing protein; n=1; Tric...    46   5e-04
UniRef50_Q756V3 Cluster: AER148Wp; n=1; Eremothecium gossypii|Re...    46   5e-04
UniRef50_UPI00015B5F3B Cluster: PREDICTED: similar to ENSANGP000...    46   6e-04
UniRef50_UPI00015B563B Cluster: PREDICTED: similar to ENSANGP000...    46   6e-04
UniRef50_UPI00006D0DBC Cluster: C2 domain containing protein; n=...    46   6e-04
UniRef50_Q7QEM8 Cluster: ENSANGP00000004715; n=1; Anopheles gamb...    46   6e-04
UniRef50_Q54PM1 Cluster: Putative uncharacterized protein; n=1; ...    46   6e-04
UniRef50_Q1RL36 Cluster: Zinc finger protein; n=1; Ciona intesti...    46   6e-04
UniRef50_Q6FNW3 Cluster: Candida glabrata strain CBS138 chromoso...    46   6e-04
UniRef50_A1CL98 Cluster: Phosphatidylserine decarboxylase; n=5; ...    46   6e-04
UniRef50_Q9HAU4 Cluster: E3 ubiquitin-protein ligase SMURF2; n=7...    46   6e-04
UniRef50_Q9HC10 Cluster: Otoferlin; n=33; Euteleostomi|Rep: Otof...    46   6e-04
UniRef50_UPI0000500DEB Cluster: Double C2-like domain-containing...    45   8e-04
UniRef50_Q95Q59 Cluster: Putative uncharacterized protein; n=2; ...    45   8e-04
UniRef50_Q55A55 Cluster: Ankyrin repeat-containing protein; n=2;...    45   8e-04
UniRef50_Q4RHB4 Cluster: Chromosome 3 SCAF15050, whole genome sh...    45   0.001
UniRef50_Q3U4B9 Cluster: NOD-derived CD11c +ve dendritic cells c...    45   0.001
UniRef50_Q9SSF7 Cluster: F25A4.30 protein; n=23; Magnoliophyta|R...    45   0.001
UniRef50_A7PI32 Cluster: Chromosome chr13 scaffold_17, whole gen...    45   0.001
UniRef50_A4RYC5 Cluster: Predicted protein; n=1; Ostreococcus lu...    45   0.001
UniRef50_Q8IM86 Cluster: CG2999-PB, isoform B; n=5; Eumetazoa|Re...    45   0.001
UniRef50_Q7PRZ3 Cluster: ENSANGP00000007487; n=6; Bilateria|Rep:...    45   0.001
UniRef50_O95294 Cluster: RasGAP-activating-like protein 1; n=25;...    45   0.001
UniRef50_UPI0000D556EA Cluster: PREDICTED: similar to CG33555-PC...    44   0.001
UniRef50_Q4SDC9 Cluster: Chromosome 1 SCAF14640, whole genome sh...    44   0.001
UniRef50_Q4S0W7 Cluster: Chromosome 5 SCAF14773, whole genome sh...    44   0.001
UniRef50_A2YKH2 Cluster: Putative uncharacterized protein; n=2; ...    44   0.001
UniRef50_Q9TZL3 Cluster: Synaptotagmin protein 6; n=2; Caenorhab...    44   0.001
UniRef50_Q86AY8 Cluster: Similar to Dictyostelium discoideum (Sl...    44   0.001
UniRef50_Q16F96 Cluster: Otoferlin; n=1; Aedes aegypti|Rep: Otof...    44   0.001
UniRef50_Q9H448 Cluster: Fer-1-like 4; n=22; Tetrapoda|Rep: Fer-...    44   0.001
UniRef50_Q5KKG1 Cluster: Transmembrane protein, putative; n=4; E...    44   0.001
UniRef50_Q4PA47 Cluster: Putative uncharacterized protein; n=1; ...    44   0.001
UniRef50_P41885 Cluster: Rabphilin-1; n=6; Caenorhabditis|Rep: R...    44   0.001
UniRef50_Q6DN14 Cluster: Multiple C2 and transmembrane domain-co...    44   0.001
UniRef50_UPI0000D56250 Cluster: PREDICTED: similar to CG6643-PA,...    44   0.002
UniRef50_UPI0000ECAF25 Cluster: Unc-13 homolog C (Munc13-3); n=6...    44   0.002
UniRef50_Q4TBR0 Cluster: Chromosome undetermined SCAF7099, whole...    44   0.002
UniRef50_A2DBY3 Cluster: C2 domain containing protein; n=1; Tric...    44   0.002
UniRef50_Q4PCK2 Cluster: Putative uncharacterized protein; n=1; ...    44   0.002
UniRef50_Q4S8E6 Cluster: Chromosome undetermined SCAF14706, whol...    44   0.003
UniRef50_Q9SKR2 Cluster: Expressed protein; n=12; Magnoliophyta|...    44   0.003
UniRef50_Q9U6P7 Cluster: Synaptotagmin IV; n=6; Diptera|Rep: Syn...    44   0.003
UniRef50_Q61D00 Cluster: Putative uncharacterized protein CBG126...    44   0.003
UniRef50_Q55ZK4 Cluster: Putative uncharacterized protein; n=2; ...    44   0.003
UniRef50_UPI00015B605D Cluster: PREDICTED: similar to IP14914p; ...    43   0.003
UniRef50_UPI0000E813D9 Cluster: PREDICTED: similar to brain otof...    43   0.003
UniRef50_UPI0000E4A388 Cluster: PREDICTED: similar to mFLJ00175 ...    43   0.003
UniRef50_UPI0000D575D9 Cluster: PREDICTED: similar to CG2999-PC,...    43   0.003
UniRef50_UPI0000ECD473 Cluster: Synaptotagmin-like protein 5.; n...    43   0.003
UniRef50_Q66VB0 Cluster: No pollen; n=6; Oryza sativa|Rep: No po...    43   0.003
UniRef50_Q00VK1 Cluster: Ca2+-dependent lipid-binding protein CL...    43   0.003
UniRef50_A7Q1H3 Cluster: Chromosome chr7 scaffold_44, whole geno...    43   0.003
UniRef50_O15755 Cluster: R2005 protein; n=4; Dictyostelium disco...    43   0.003
UniRef50_A7STM9 Cluster: Predicted protein; n=2; Nematostella ve...    43   0.003
UniRef50_Q6DN12 Cluster: Multiple C2 and transmembrane domain-co...    43   0.003
UniRef50_Q7SZV6 Cluster: Novel protein; n=3; Euteleostomi|Rep: N...    43   0.004
UniRef50_Q4RRT5 Cluster: Chromosome 16 SCAF15002, whole genome s...    43   0.004
UniRef50_A2EWW5 Cluster: C2 domain containing protein; n=2; Tric...    43   0.004
UniRef50_A7TMU3 Cluster: Putative uncharacterized protein; n=1; ...    43   0.004
UniRef50_UPI0000DB7557 Cluster: PREDICTED: similar to SMAD speci...    42   0.006
UniRef50_UPI000065F386 Cluster: Homolog of Homo sapiens "Interse...    42   0.006
UniRef50_Q4SKC0 Cluster: Chromosome 13 SCAF14566, whole genome s...    42   0.006
UniRef50_Q4RZQ9 Cluster: Chromosome 18 SCAF14786, whole genome s...    42   0.006
UniRef50_Q4RF05 Cluster: Chromosome 13 SCAF15122, whole genome s...    42   0.006
UniRef50_Q7PSY9 Cluster: ENSANGP00000019593; n=1; Anopheles gamb...    42   0.006
UniRef50_Q9HCH3 Cluster: Copine-5; n=22; Euteleostomi|Rep: Copin...    42   0.006
UniRef50_O64492 Cluster: F20D22.8 protein; n=7; Magnoliophyta|Re...    42   0.008
UniRef50_A3BDF6 Cluster: Putative uncharacterized protein; n=2; ...    42   0.008
UniRef50_Q7QE48 Cluster: ENSANGP00000016777; n=1; Anopheles gamb...    42   0.008
UniRef50_Q5DEH7 Cluster: SJCHGC06647 protein; n=1; Schistosoma j...    42   0.008
UniRef50_Q4DCX8 Cluster: Putative uncharacterized protein; n=5; ...    42   0.008
UniRef50_A0E0J1 Cluster: Chromosome undetermined scaffold_71, wh...    42   0.008
UniRef50_UPI0000F2B5FC Cluster: PREDICTED: similar to hCG1810857...    42   0.010
UniRef50_UPI0000DB751D Cluster: PREDICTED: similar to bitesize C...    42   0.010
UniRef50_UPI00005A965F Cluster: PREDICTED: similar to B/K protei...    42   0.010
UniRef50_Q7SY69 Cluster: LOC398672 protein; n=4; Euteleostomi|Re...    42   0.010
UniRef50_Q4SB00 Cluster: Chromosome undetermined SCAF14678, whol...    42   0.010
UniRef50_Q69MT7 Cluster: C2 domain-containing protein-like; n=7;...    42   0.010
UniRef50_P91493 Cluster: Synaptotagmin protein 4; n=2; Caenorhab...    42   0.010
UniRef50_A1CG04 Cluster: C2 domain protein; n=9; Pezizomycotina|...    42   0.010
UniRef50_O75923 Cluster: Dysferlin; n=39; Deuterostomia|Rep: Dys...    42   0.010
UniRef50_UPI000155F647 Cluster: PREDICTED: similar to hCG1810857...    41   0.013
UniRef50_UPI00006A1671 Cluster: UPI00006A1671 related cluster; n...    41   0.013
UniRef50_UPI000065FBA3 Cluster: multiple C2-domains with two tra...    41   0.013
UniRef50_A7S352 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ...    41   0.013
UniRef50_A2EUT8 Cluster: C2 domain containing protein; n=1; Tric...    41   0.013
UniRef50_UPI00004D1F3F Cluster: UPI00004D1F3F related cluster; n...    41   0.018
UniRef50_Q4T1V0 Cluster: Chromosome undetermined SCAF10467, whol...    41   0.018
UniRef50_Q4RY01 Cluster: Chromosome 11 SCAF14979, whole genome s...    41   0.018
UniRef50_Q4REK5 Cluster: Chromosome 10 SCAF15123, whole genome s...    41   0.018
UniRef50_Q00TV8 Cluster: RBF1_CAEEL Rabphilin 1; n=1; Ostreococc...    41   0.018
UniRef50_O16700 Cluster: Synaptotagmin protein 5; n=2; Caenorhab...    41   0.018
UniRef50_A7SG61 Cluster: Predicted protein; n=1; Nematostella ve...    41   0.018
UniRef50_Q9LNV0 Cluster: F22G5.35; n=1; Arabidopsis thaliana|Rep...    40   0.023
UniRef50_Q0D8E3 Cluster: Os07g0165100 protein; n=5; Oryza sativa...    40   0.023
UniRef50_A5AXU7 Cluster: Putative uncharacterized protein; n=1; ...    40   0.023
UniRef50_Q8MQJ2 Cluster: RE01517p; n=4; Sophophora|Rep: RE01517p...    40   0.023
UniRef50_Q54YT1 Cluster: C2 domain-containing protein; n=1; Dict...    40   0.023
UniRef50_UPI0000E23F62 Cluster: PREDICTED: similar to group IVB ...    40   0.031
UniRef50_UPI0000ECB77F Cluster: family with sequence similarity ...    40   0.031
UniRef50_Q6PBU6 Cluster: Synaptotagmin IV; n=7; Elopocephala|Rep...    40   0.031
UniRef50_Q4RZ64 Cluster: Chromosome undetermined SCAF14961, whol...    40   0.031
UniRef50_A2X930 Cluster: Putative uncharacterized protein; n=3; ...    40   0.031
UniRef50_A7S4Y1 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.031
UniRef50_Q2WGJ9 Cluster: C8orfK23 protein; n=24; Euteleostomi|Re...    40   0.031
UniRef50_P27715 Cluster: Phorbol ester/diacylglycerol-binding pr...    40   0.031
UniRef50_Q8TDW5 Cluster: Synaptotagmin-like protein 5; n=6; Euar...    40   0.031
UniRef50_O95712 Cluster: Cytosolic phospholipase A2 beta; n=38; ...    40   0.031
UniRef50_Q96PU5 Cluster: E3 ubiquitin-protein ligase NEDD4-like ...    40   0.031
UniRef50_UPI00015B56F2 Cluster: PREDICTED: similar to E3 ubiquit...    40   0.041
UniRef50_UPI0000E804F7 Cluster: PREDICTED: similar to dysferlin;...    40   0.041
UniRef50_UPI00006CCC01 Cluster: C2 domain containing protein; n=...    40   0.041
UniRef50_Q4T6B2 Cluster: Chromosome undetermined SCAF8829, whole...    40   0.041
UniRef50_Q4S1V1 Cluster: Chromosome undetermined SCAF14764, whol...    40   0.041
UniRef50_Q4RTT2 Cluster: Chromosome 2 SCAF14997, whole genome sh...    40   0.041
UniRef50_A7PGU5 Cluster: Chromosome chr17 scaffold_16, whole gen...    40   0.041
UniRef50_Q9BHF8 Cluster: C2 domain protein; n=3; Leishmania|Rep:...    40   0.041
UniRef50_Q54FM6 Cluster: C2 domain-containing protein; n=2; Dict...    40   0.041
UniRef50_Q2GVP0 Cluster: Putative uncharacterized protein; n=2; ...    40   0.041
UniRef50_Q0CQR6 Cluster: Putative uncharacterized protein; n=1; ...    40   0.041
UniRef50_Q70J99 Cluster: Protein unc-13 homolog D; n=25; Amniota...    40   0.041
UniRef50_UPI0000E23F90 Cluster: PREDICTED: phospholipase A2, gro...    39   0.054
UniRef50_UPI00005A0641 Cluster: PREDICTED: similar to Copine-1 (...    39   0.054
UniRef50_Q4SIF8 Cluster: Chromosome 5 SCAF14581, whole genome sh...    39   0.054
UniRef50_O48645 Cluster: CLB1; n=1; Solanum lycopersicum|Rep: CL...    39   0.054
UniRef50_A6N000 Cluster: Zac, putative; n=7; Poaceae|Rep: Zac, p...    39   0.054
UniRef50_A5BRF5 Cluster: Putative uncharacterized protein; n=1; ...    39   0.054
UniRef50_A2FRW4 Cluster: C2 domain containing protein; n=1; Tric...    39   0.054
UniRef50_A2EHX7 Cluster: C2 domain containing protein; n=2; Tric...    39   0.054
UniRef50_Q4WQ04 Cluster: C2 domain protein; n=13; Pezizomycotina...    39   0.054
UniRef50_Q6ZM21 Cluster: Novel protein similar to mouse and huma...    39   0.072
UniRef50_Q6ZM20 Cluster: Novel protein similar to mouse and huma...    39   0.072
UniRef50_Q400L7 Cluster: Putative uncharacterized protein; n=4; ...    39   0.072
UniRef50_A0CFD6 Cluster: Chromosome undetermined scaffold_175, w...    39   0.072
UniRef50_Q9R0N6 Cluster: Synaptotagmin-8; n=20; Eutheria|Rep: Sy...    39   0.072
UniRef50_A0AVI2 Cluster: Fer-1-like protein 5; n=2; Catarrhini|R...    39   0.072
UniRef50_UPI00015547E6 Cluster: PREDICTED: similar to Sytl2 prot...    38   0.095
UniRef50_UPI0000E49E19 Cluster: PREDICTED: similar to Ccdc40 pro...    38   0.095
UniRef50_UPI0000E463E8 Cluster: PREDICTED: hypothetical protein;...    38   0.095
UniRef50_UPI0000D55BF1 Cluster: PREDICTED: similar to otoferlin;...    38   0.095
UniRef50_UPI00005A2992 Cluster: PREDICTED: similar to otoferlin;...    38   0.095
UniRef50_UPI00004D61AA Cluster: Synaptotagmin-10 (Synaptotagmin ...    38   0.095
UniRef50_UPI0000448403 Cluster: UPI0000448403 related cluster; n...    38   0.095
UniRef50_Q4T3L7 Cluster: Chromosome undetermined SCAF10007, whol...    38   0.095
UniRef50_Q9FI32 Cluster: Phosphoribosylanthranilate transferase-...    38   0.095
UniRef50_Q93ZM0 Cluster: AT3g18370/MYF24_8; n=3; core eudicotyle...    38   0.095
UniRef50_A7NYK0 Cluster: Chromosome chr6 scaffold_3, whole genom...    38   0.095
UniRef50_O96942 Cluster: Serine /threonine protein kinase; n=1; ...    38   0.095
UniRef50_P49796 Cluster: Regulator of G-protein signaling 3; n=6...    38   0.095
UniRef50_Q86XP0 Cluster: Cytosolic phospholipase A2 delta; n=16;...    38   0.095
UniRef50_UPI00015B51A1 Cluster: PREDICTED: similar to synaptotag...    38   0.13 
UniRef50_UPI00006A0739 Cluster: UPI00006A0739 related cluster; n...    38   0.13 
UniRef50_UPI000069DB72 Cluster: UPI000069DB72 related cluster; n...    38   0.13 
UniRef50_Q6PFJ8 Cluster: LOC402861 protein; n=14; Clupeocephala|...    38   0.13 
UniRef50_Q4REU8 Cluster: Chromosome 13 SCAF15122, whole genome s...    38   0.13 
UniRef50_A0JJX4 Cluster: NtermTM-C2Type3.1 protein; n=1; Physcom...    38   0.13 
UniRef50_Q5BVG7 Cluster: SJCHGC09581 protein; n=1; Schistosoma j...    38   0.13 
UniRef50_A2E2I3 Cluster: C2 domain containing protein; n=1; Tric...    38   0.13 
UniRef50_Q5M7N9 Cluster: Family with sequence similarity 62 (C2 ...    38   0.17 
UniRef50_A0JPE7 Cluster: Zgc:152940; n=2; Danio rerio|Rep: Zgc:1...    38   0.17 
UniRef50_Q9FIK8 Cluster: Similarity to GTPase activating protein...    38   0.17 
UniRef50_Q5C2C6 Cluster: SJCHGC09340 protein; n=1; Schistosoma j...    38   0.17 
UniRef50_Q9NZ18 Cluster: B/K protein; n=24; Euteleostomi|Rep: B/...    38   0.17 
UniRef50_Q2GTP7 Cluster: Putative uncharacterized protein; n=1; ...    38   0.17 
UniRef50_Q9UBL6 Cluster: Copine-7; n=14; Euteleostomi|Rep: Copin...    38   0.17 
UniRef50_UPI0001555D44 Cluster: PREDICTED: similar to synaptotag...    37   0.22 
UniRef50_UPI0000588BBC Cluster: PREDICTED: similar to CG5559-PA;...    37   0.22 
UniRef50_A7RR93 Cluster: Predicted protein; n=1; Nematostella ve...    37   0.22 
UniRef50_Q86YQ8 Cluster: Copine-8; n=69; Deuterostomia|Rep: Copi...    37   0.22 
UniRef50_Q5RI59 Cluster: Novel protein; n=6; Cyprinidae|Rep: Nov...    37   0.29 
UniRef50_Q4T9P3 Cluster: Chromosome undetermined SCAF7518, whole...    37   0.29 
UniRef50_Q8RZA2 Cluster: Zinc finger protein-like; n=5; Magnolio...    37   0.29 
UniRef50_Q55CG6 Cluster: Putative uncharacterized protein; n=1; ...    37   0.29 
UniRef50_Q554T9 Cluster: Putative uncharacterized protein; n=2; ...    37   0.29 
UniRef50_Q8IYJ3 Cluster: Synaptotagmin-like protein 1; n=22; Amn...    37   0.29 
UniRef50_Q9NZM1 Cluster: Myoferlin; n=59; Eumetazoa|Rep: Myoferl...    37   0.29 
UniRef50_UPI0000E4A908 Cluster: PREDICTED: similar to dysferlin,...    36   0.38 
UniRef50_UPI0000E4A23F Cluster: PREDICTED: similar to synaptotag...    36   0.38 
UniRef50_UPI0000D56251 Cluster: PREDICTED: similar to CG6643-PA,...    36   0.38 
UniRef50_O80558 Cluster: T22J18.21 protein; n=10; Magnoliophyta|...    36   0.38 
UniRef50_A4S6Y7 Cluster: Predicted protein; n=1; Ostreococcus lu...    36   0.38 
UniRef50_A4S2R8 Cluster: Predicted protein; n=1; Ostreococcus lu...    36   0.38 
UniRef50_Q9BHE7 Cluster: C2 domain protein; n=4; Leishmania|Rep:...    36   0.38 
UniRef50_Q5CS58 Cluster: Ferlin like type II membrane associated...    36   0.38 
UniRef50_Q5C322 Cluster: SJCHGC05115 protein; n=1; Schistosoma j...    36   0.38 
UniRef50_Q55D03 Cluster: Putative uncharacterized protein; n=1; ...    36   0.38 
UniRef50_Q38B77 Cluster: Putative uncharacterized protein; n=1; ...    36   0.38 
UniRef50_A7SHC0 Cluster: Predicted protein; n=3; Nematostella ve...    36   0.38 
UniRef50_A7S1X8 Cluster: Predicted protein; n=1; Nematostella ve...    36   0.38 
UniRef50_A0CHA8 Cluster: Chromosome undetermined scaffold_180, w...    36   0.38 
UniRef50_Q9VVI3 Cluster: E3 ubiquitin-protein ligase Nedd-4; n=1...    36   0.38 
UniRef50_UPI0000E8030C Cluster: PREDICTED: similar to synaptotag...    36   0.51 
UniRef50_UPI0000499707 Cluster: calcium-binding protein; n=1; En...    36   0.51 
UniRef50_UPI000065FFAB Cluster: Synaptotagmin-11 (Synaptotagmin ...    36   0.51 
UniRef50_Q4SK45 Cluster: Chromosome 2 SCAF14570, whole genome sh...    36   0.51 
UniRef50_Q28Z37 Cluster: GA18543-PA; n=3; Eukaryota|Rep: GA18543...    36   0.51 
UniRef50_A7TD10 Cluster: Predicted protein; n=1; Nematostella ve...    36   0.51 
UniRef50_A7ST78 Cluster: Predicted protein; n=1; Nematostella ve...    36   0.51 
UniRef50_UPI0000499CA2 Cluster: hypothetical protein 5.t00066; n...    36   0.67 
UniRef50_A7Q020 Cluster: Chromosome chr8 scaffold_41, whole geno...    36   0.67 
UniRef50_A2YC01 Cluster: Putative uncharacterized protein; n=2; ...    36   0.67 
UniRef50_Q1ZXM7 Cluster: C2 domain-containing protein; n=2; Dict...    36   0.67 
UniRef50_A7RRA6 Cluster: Predicted protein; n=2; Nematostella ve...    36   0.67 
UniRef50_Q8IV01 Cluster: Synaptotagmin-12; n=20; Euteleostomi|Re...    36   0.67 
UniRef50_Q9V853 Cluster: E3 ubiquitin-protein ligase Smurf1; n=1...    36   0.67 
UniRef50_UPI0001555DB1 Cluster: PREDICTED: similar to cytosolic ...    35   0.88 
UniRef50_UPI0000F2E24D Cluster: PREDICTED: similar to Synaptotag...    35   0.88 
UniRef50_UPI000069EB16 Cluster: UPI000069EB16 related cluster; n...    35   0.88 
UniRef50_Q99NE5-4 Cluster: Isoform 4 of Q99NE5 ; n=6; Tetrapoda|...    35   0.88 
UniRef50_Q6INN6 Cluster: LOC432290 protein; n=5; Xenopus|Rep: LO...    35   0.88 
UniRef50_Q4SXP7 Cluster: Chromosome 6 SCAF12355, whole genome sh...    35   0.88 
UniRef50_Q6K295 Cluster: C2 domain-containing protein-like; n=2;...    35   0.88 
UniRef50_Q9BHE8 Cluster: C2 domain protein; n=2; Leishmania|Rep:...    35   0.88 
UniRef50_Q22070 Cluster: Putative uncharacterized protein plc-3;...    35   0.88 
UniRef50_Q16TE9 Cluster: E3 ubiquitin ligase; n=1; Aedes aegypti...    35   0.88 
UniRef50_Q9BT88 Cluster: Synaptotagmin-11; n=29; Euteleostomi|Re...    35   0.88 
UniRef50_Q9JIR4 Cluster: Regulating synaptic membrane exocytosis...    35   0.88 
UniRef50_Q99NE5 Cluster: Regulating synaptic membrane exocytosis...    35   0.88 
UniRef50_Q15811 Cluster: Intersectin-1; n=93; Eumetazoa|Rep: Int...    35   0.88 
UniRef50_UPI0000F2EC05 Cluster: PREDICTED: similar to Sytl2 prot...    35   1.2  
UniRef50_UPI000049893E Cluster: Rap/Ran GTPase activating protei...    35   1.2  
UniRef50_Q4SMR0 Cluster: Chromosome 8 SCAF14545, whole genome sh...    35   1.2  
UniRef50_Q4RP33 Cluster: Chromosome 1 SCAF15008, whole genome sh...    35   1.2  
UniRef50_Q9S7J9 Cluster: Putative uncharacterized protein F5A18....    35   1.2  
UniRef50_O65279 Cluster: F6N23.8 protein; n=1; Arabidopsis thali...    35   1.2  
UniRef50_Q6PUB6 Cluster: Smurf; n=2; Anopheles gambiae|Rep: Smur...    35   1.2  
UniRef50_A6RB21 Cluster: E3 ubiquitin--protein ligase pub1; n=2;...    35   1.2  
UniRef50_P39940 Cluster: E3 ubiquitin-protein ligase RSP5; n=31;...    35   1.2  
UniRef50_A0FGR8 Cluster: Protein FAM62B; n=27; Euteleostomi|Rep:...    35   1.2  
UniRef50_UPI0000DB7090 Cluster: PREDICTED: similar to CG6643-PA,...    34   1.5  
UniRef50_UPI00006A2032 Cluster: UPI00006A2032 related cluster; n...    34   1.5  
UniRef50_UPI000069EDD9 Cluster: Protein FAM62A (Membrane-bound C...    34   1.5  
UniRef50_UPI000066132C Cluster: Homolog of Homo sapiens "Perfori...    34   1.5  
UniRef50_Q4SKP9 Cluster: Chromosome undetermined SCAF14565, whol...    34   1.5  
UniRef50_Q4S223 Cluster: Chromosome undetermined SCAF14764, whol...    34   1.5  
UniRef50_Q4RNK5 Cluster: Chromosome 21 SCAF15012, whole genome s...    34   1.5  
UniRef50_A5BZ85 Cluster: Putative uncharacterized protein; n=1; ...    34   1.5  
UniRef50_Q54SN5 Cluster: Putative uncharacterized protein; n=1; ...    34   1.5  
UniRef50_Q4Q6Z7 Cluster: Phospholipase c-like protein; n=2; Leis...    34   1.5  
UniRef50_A7RYY7 Cluster: Predicted protein; n=2; Nematostella ve...    34   1.5  
UniRef50_Q5AK66 Cluster: Putative uncharacterized protein PSD2; ...    34   1.5  
UniRef50_Q0C976 Cluster: Putative uncharacterized protein; n=1; ...    34   1.5  
UniRef50_UPI00015A608E Cluster: Synaptotagmin-like protein 5.; n...    34   2.0  
UniRef50_UPI00004D2181 Cluster: UPI00004D2181 related cluster; n...    34   2.0  
UniRef50_Q4SXY8 Cluster: Chromosome undetermined SCAF12276, whol...    34   2.0  
UniRef50_Q4SG36 Cluster: Chromosome 12 SCAF14600, whole genome s...    34   2.0  
UniRef50_Q4RBA2 Cluster: Chromosome undetermined SCAF21883, whol...    34   2.0  
UniRef50_A5WUP7 Cluster: Novel protein; n=2; Danio rerio|Rep: No...    34   2.0  
UniRef50_A7RGR5 Cluster: Predicted protein; n=1; Nematostella ve...    34   2.0  
UniRef50_A2FF50 Cluster: C2 domain containing protein; n=1; Tric...    34   2.0  
UniRef50_Q9H2B2 Cluster: Synaptotagmin-4; n=25; Tetrapoda|Rep: S...    34   2.0  
UniRef50_UPI0000DB7823 Cluster: PREDICTED: similar to CG10737-PB...    33   2.7  
UniRef50_UPI000069E88C Cluster: phospholipase A2, group IVD; n=1...    33   2.7  
UniRef50_Q68EQ4 Cluster: Sytl2 protein; n=2; Xenopus tropicalis|...    33   2.7  
UniRef50_Q7KS16 Cluster: CG6643-PB, isoform B; n=8; Endopterygot...    33   2.7  
UniRef50_A7RF18 Cluster: Predicted protein; n=1; Nematostella ve...    33   2.7  
UniRef50_O14065 Cluster: Uncharacterized protein C962.01; n=1; S...    33   2.7  
UniRef50_Q9T052 Cluster: Phospholipase D gamma 3; n=27; Magnolio...    33   2.7  
UniRef50_UPI0000F2B51D Cluster: PREDICTED: similar to MGC83776 p...    33   3.6  
UniRef50_UPI000069FBC7 Cluster: UPI000069FBC7 related cluster; n...    33   3.6  
UniRef50_O76835 Cluster: Putative uncharacterized protein T12A2....    33   3.6  
UniRef50_A7SHB9 Cluster: Predicted protein; n=1; Nematostella ve...    33   3.6  
UniRef50_A2IB48 Cluster: Phospholipase C gamma; n=5; Eumetazoa|R...    33   3.6  
UniRef50_Q4RG56 Cluster: Chromosome 2 SCAF15106, whole genome sh...    33   4.7  
UniRef50_Q9M2D4 Cluster: Anthranilate phosphoribosyltransferase-...    33   4.7  
UniRef50_Q0DPY0 Cluster: Os03g0652000 protein; n=7; Magnoliophyt...    33   4.7  
UniRef50_A7PAR0 Cluster: Chromosome chr14 scaffold_9, whole geno...    33   4.7  
UniRef50_A7RLZ1 Cluster: Predicted protein; n=1; Nematostella ve...    33   4.7  
UniRef50_Q75DN3 Cluster: ABL016Cp; n=1; Eremothecium gossypii|Re...    33   4.7  
UniRef50_Q9BQS2 Cluster: Synaptotagmin-15; n=31; Tetrapoda|Rep: ...    33   4.7  
UniRef50_UPI0000F21142 Cluster: PREDICTED: similar to Protein FA...    32   6.2  
UniRef50_UPI0000E4836F Cluster: PREDICTED: hypothetical protein;...    32   6.2  
UniRef50_UPI0000499E83 Cluster: conserved hypothetical protein; ...    32   6.2  
UniRef50_Q4SL13 Cluster: Chromosome 17 SCAF14563, whole genome s...    32   6.2  
UniRef50_Q23FT6 Cluster: C2 domain containing protein; n=1; Tetr...    32   6.2  
UniRef50_A7T6V1 Cluster: Predicted protein; n=1; Nematostella ve...    32   6.2  
UniRef50_A0CIG0 Cluster: Chromosome undetermined scaffold_19, wh...    32   6.2  
UniRef50_Q7SGL9 Cluster: Putative uncharacterized protein NCU080...    32   6.2  
UniRef50_Q96C24 Cluster: Synaptotagmin-like protein 4; n=26; Tet...    32   6.2  
UniRef50_UPI0000E80625 Cluster: PREDICTED: similar to Cytosolic ...    32   8.2  
UniRef50_UPI0000E4A29A Cluster: PREDICTED: similar to synaptotag...    32   8.2  
UniRef50_UPI0000D55BA9 Cluster: PREDICTED: similar to CG10737-PB...    32   8.2  
UniRef50_A6NSB8 Cluster: Putative uncharacterized protein; n=1; ...    32   8.2  
UniRef50_Q00W50 Cluster: Chromosome 14 contig 1, DNA sequence; n...    32   8.2  
UniRef50_Q6FSV3 Cluster: Similar to tr|Q08748 Saccharomyces cere...    32   8.2  
UniRef50_Q0UXZ8 Cluster: Putative uncharacterized protein; n=1; ...    32   8.2  
UniRef50_Q86UR5 Cluster: Regulating synaptic membrane exocytosis...    32   8.2  

>UniRef50_UPI00015B432D Cluster: PREDICTED: similar to munc13-4;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           munc13-4 - Nasonia vitripennis
          Length = 1221

 Score =  103 bits (248), Expect = 2e-21
 Identities = 48/84 (57%), Positives = 60/84 (71%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A  + LN+EV+EA +LV KD NG SDPF  +YL S  + RYNT+VK+ TL PVW+EHF +
Sbjct: 233 APEMHLNIEVIEAKELVSKDANGKSDPFCVLYLESAPTRRYNTAVKTETLTPVWQEHFEM 292

Query: 427 PMSGTVNEDSLCLEVWDFDPAETV 498
           P+    N D L +EVWDFD AETV
Sbjct: 293 PLENPEN-DVLYIEVWDFDAAETV 315



 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 28/83 (33%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query: 8   LLDTDSEPDEHDKIGRII-EAVGWNIDXXXXXXXXXXXHNVGGCDVGCEVGQHAMLSYVQ 184
           L +TDSE +EH+    I+ ++VG NI+           H +G  DV  EV Q A++ Y+Q
Sbjct: 153 LPETDSESEEHETAYNIVAQSVGLNIEELYTALLYITQHQIG-FDVVDEVEQDAVIQYLQ 211

Query: 185 EAFKIGNDKHTQLLTKAEAKEPP 253
           EAF + ++ H +++ +    E P
Sbjct: 212 EAFNVNDETHDRVMEETRQMEAP 234



 Score = 39.9 bits (89), Expect = 0.031
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH----RYNTSVKSGTLNPVWEEHFSL 426
            +LN++++ A +L   D +G  D +V I L   ++      Y T V+  T  P++EE FS+
Sbjct: 1067 LLNIQILNARNLKANDNSGKCDSYVKIRLFPENAFIGMKTYKTGVQKETQFPLYEESFSI 1126

Query: 427  PMS 435
            P++
Sbjct: 1127 PLT 1129


>UniRef50_Q9VBY8 Cluster: CG11819-PA; n=1; Drosophila
           melanogaster|Rep: CG11819-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 977

 Score = 95.1 bits (226), Expect = 8e-19
 Identities = 43/73 (58%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +1

Query: 211 THATSYQSGG*RAS-GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS 387
           TH   Y++   +    + LNVE+++A +L+ KD NGLSDPFVT+YL SN SHRYN+SVK 
Sbjct: 163 THEEIYEAARLKEPPNVRLNVEIIKAENLMSKDSNGLSDPFVTLYLESNGSHRYNSSVKP 222

Query: 388 GTLNPVWEEHFSL 426
            TLNP+WEEHFSL
Sbjct: 223 ATLNPIWEEHFSL 235



 Score = 37.1 bits (82), Expect = 0.22
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 3/42 (7%)
 Frame = +2

Query: 137 DVGCEVGQ---HAMLSYVQEAFKIGNDKHTQLLTKAEAKEPP 253
           ++GCE  +   ++++ +VQ+AFKI N  H ++   A  KEPP
Sbjct: 136 NIGCENNEECTNSLVEFVQDAFKIPNATHEEIYEAARLKEPP 177


>UniRef50_UPI0000DB72C1 Cluster: PREDICTED: similar to CG11819-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to
           CG11819-PA - Apis mellifera
          Length = 1114

 Score = 77.8 bits (183), Expect = 1e-13
 Identities = 35/55 (63%), Positives = 42/55 (76%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           L VEV+EA +LV KD NG SDPF  +YL S  + RYNT+VK+ TL+PVWEEHF L
Sbjct: 233 LCVEVIEAKELVSKDANGKSDPFCALYLESAPTRRYNTAVKTSTLSPVWEEHFEL 287



 Score = 58.8 bits (136), Expect = 6e-08
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +2

Query: 2   ETLLDTDSEPDEHDKIGRII-EAVGWNIDXXXXXXXXXXXHNVGGCDVGCEVGQHAMLSY 178
           E LL+TDS+ DE++     + E++GWNI+           H +G  DV  E     +L++
Sbjct: 146 EALLETDSDRDENEHATIFLAESMGWNIEELYAALVFMTQHQIG-YDVSNECKLETLLNH 204

Query: 179 VQEAFKIGNDKHTQLLTKAEAKEPP 253
           +Q AFK+ ND H ++L + +  EPP
Sbjct: 205 LQNAFKVDNDVHERVLDETKNMEPP 229


>UniRef50_Q6Z6R6 Cluster: C2 domain-containing protein-like; n=3;
           Oryza sativa|Rep: C2 domain-containing protein-like -
           Oryza sativa subsp. japonica (Rice)
          Length = 718

 Score = 64.5 bits (150), Expect = 1e-09
 Identities = 30/73 (41%), Positives = 44/73 (60%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
           VE++E  D+ P DPNGL+DP+V  +L     +R+ T +   TLNP W E F +P++    
Sbjct: 289 VEILEGADMKPSDPNGLADPYVKGHL---GPYRFQTKIHKKTLNPKWMEEFKIPVTSWAA 345

Query: 448 EDSLCLEVWDFDP 486
            + L L+V D DP
Sbjct: 346 LNLLSLQVRDKDP 358


>UniRef50_O61224 Cluster: Serine/Threonine protein kinase; n=1;
           Sycon raphanus|Rep: Serine/Threonine protein kinase -
           Sycon raphanus
          Length = 756

 Score = 63.7 bits (148), Expect = 2e-09
 Identities = 33/76 (43%), Positives = 46/76 (60%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L V V EA +L P D NGL+DP+V ++L  +   + +  T  K  TLNPVW E FS  ++
Sbjct: 183 LEVVVKEAKNLPPMDANGLADPYVKLWLSDDPQKATKKKTETKMKTLNPVWGEKFSFNLT 242

Query: 436 GTVNEDSLCLEVWDFD 483
               + SL +EVWD+D
Sbjct: 243 QGDLKRSLIIEVWDWD 258


>UniRef50_P05129 Cluster: Protein kinase C gamma type; n=98;
           Eumetazoa|Rep: Protein kinase C gamma type - Homo
           sapiens (Human)
          Length = 697

 Score = 63.7 bits (148), Expect = 2e-09
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           ++V V EA +L+P DPNGLSDP+V + L+ +  +  +  T     TLNPVW E F   + 
Sbjct: 173 IHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLK 232

Query: 436 GTVNEDSLCLEVWDFD 483
               E  L +EVWD+D
Sbjct: 233 PGDVERRLSVEVWDWD 248


>UniRef50_P90980 Cluster: Protein kinase C-like 2; n=49;
           Eumetazoa|Rep: Protein kinase C-like 2 - Caenorhabditis
           elegans
          Length = 682

 Score = 63.3 bits (147), Expect = 3e-09
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L ++++EA +L+P DPNGLSDP+V   L+   S    +  T     TLNP W E F+  +
Sbjct: 175 LTIKILEAKNLIPMDPNGLSDPYVKCKLIPEDSGCKSKQKTKTLRATLNPQWNETFTYKL 234

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  L +EVWD+D
Sbjct: 235 LPGDKDRRLSIEVWDWD 251


>UniRef50_Q6FKH9 Cluster: Similar to sp|Q03640 Saccharomyces
            cerevisiae YML072c; n=1; Candida glabrata|Rep: Similar to
            sp|Q03640 Saccharomyces cerevisiae YML072c - Candida
            glabrata (Yeast) (Torulopsis glabrata)
          Length = 1530

 Score = 62.9 bits (146), Expect = 4e-09
 Identities = 29/76 (38%), Positives = 44/76 (57%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            LN+ ++  + L+  D NG SDPFV IY+  N    Y T  +  TL+PVW EH  +P+   
Sbjct: 1103 LNLNIISGSHLMAADRNGKSDPFVGIYI--NGKRVYKTHTEKKTLDPVWNEHCKIPIPSR 1160

Query: 442  VNEDSLCLEVWDFDPA 489
             +  ++ + VWD+D A
Sbjct: 1161 -SRSNVVMRVWDWDRA 1175


>UniRef50_Q69G16 Cluster: Protein kinase C type beta; n=2;
           Bilateria|Rep: Protein kinase C type beta - Schistosoma
           mansoni (Blood fluke)
          Length = 618

 Score = 62.1 bits (144), Expect = 7e-09
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 2/74 (2%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYL--MSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           VEV E  +L+P DPNGL+DP+V I          ++ T      LNPVW+E F++ +   
Sbjct: 170 VEVKEGRNLIPMDPNGLADPYVKIKFGPTDELGRKFRTKTIKSNLNPVWDEKFTIDLHPD 229

Query: 442 VNEDSLCLEVWDFD 483
                L  EVWD+D
Sbjct: 230 DESKRLHFEVWDWD 243


>UniRef50_Q9BQG1 Cluster: Synaptotagmin-3; n=19; Euteleostomi|Rep:
           Synaptotagmin-3 - Homo sapiens (Human)
          Length = 590

 Score = 61.7 bits (143), Expect = 9e-09
 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMS 435
           L V +++A DL  KD NG SDP+V IYL+ +   ++ T V   TLNPV+ E   FS+P++
Sbjct: 316 LVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPVFNETFQFSVPLA 375

Query: 436 GTVNEDSLCLEVWDFD 483
             + +  L   V+DFD
Sbjct: 376 -ELAQRKLHFSVYDFD 390



 Score = 42.7 bits (96), Expect = 0.004
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V +++A++L   D  G SDP+V   L+S      +  TS+K  TLNP + E     ++
Sbjct: 448 LTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVA 507

Query: 436 -GTVNEDSLCLEVWDFD 483
             +V    L + V D+D
Sbjct: 508 PESVENVGLSIAVVDYD 524


>UniRef50_O94812 Cluster: BAI1-associated protein 3; n=16; Theria|Rep:
            BAI1-associated protein 3 - Homo sapiens (Human)
          Length = 1187

 Score = 49.6 bits (113), Expect = 4e-05
 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 6/62 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEE--HFS 423
            L VEV+ A DL+P D NGLSDPFV + L    +        T VK+ TL+PV++E  +FS
Sbjct: 1027 LAVEVLHAADLLPLDANGLSDPFVIVELGPPHLFPLVRSQRTQVKTRTLHPVYDELFYFS 1086

Query: 424  LP 429
            +P
Sbjct: 1087 VP 1088



 Score = 45.6 bits (103), Expect(2) = 4e-08
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           T VKS TLNPVW+EHF   +   V+ D L L++WD D
Sbjct: 262 TEVKSSTLNPVWKEHFLFEIE-DVSTDQLHLDIWDHD 297



 Score = 33.9 bits (74), Expect(2) = 4e-08
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS 357
           +A    L V V+ A +L+ KDPNG SDP+  + ++  S
Sbjct: 191 KAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGILPAS 228


>UniRef50_UPI0000DB79ED Cluster: PREDICTED: similar to Rabphilin
           CG11556-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to Rabphilin CG11556-PA - Apis mellifera
          Length = 735

 Score = 59.7 bits (138), Expect = 4e-08
 Identities = 32/77 (41%), Positives = 46/77 (59%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L V +  A +L+P D NG SDPFV + L+ N  ++HR  T++K  TLNP W E F+    
Sbjct: 609 LIVTIHRAINLLPMDSNGFSDPFVKLCLIENVTNNHRQRTTIKWKTLNPEWNEEFTFTAR 668

Query: 436 GT-VNEDSLCLEVWDFD 483
            T + + +L L +WD D
Sbjct: 669 LTDLMKLTLYLTIWDKD 685


>UniRef50_Q3Y418 Cluster: Synaptotagmin protein 2; n=4;
           Caenorhabditis|Rep: Synaptotagmin protein 2 -
           Caenorhabditis elegans
          Length = 270

 Score = 59.7 bits (138), Expect = 4e-08
 Identities = 28/76 (36%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMS 435
           L+V +V A+DL   D NG+SDP+V +Y++     ++ T +   TLNP + E   FS+P +
Sbjct: 1   LSVTIVSASDLPAMDRNGMSDPYVKVYVLPERKQKFETRIIRNTLNPTYNETFQFSIPFN 60

Query: 436 GTVNEDSLCLEVWDFD 483
             ++  +L L V+D+D
Sbjct: 61  -ELHSKTLMLVVYDYD 75



 Score = 45.2 bits (102), Expect = 8e-04
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPMS 435
           + + ++EA +L   D  G SDP+V IYL        +  TS K  TLNP + E F   + 
Sbjct: 134 VTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIE 193

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  L + VWD+D
Sbjct: 194 PHMIEKVHLIVSVWDYD 210


>UniRef50_Q872A4 Cluster: Related to phosphatidylserine
           decarboxylase; n=2; Pezizomycotina|Rep: Related to
           phosphatidylserine decarboxylase - Neurospora crassa
          Length = 1062

 Score = 59.3 bits (137), Expect = 5e-08
 Identities = 30/82 (36%), Positives = 48/82 (58%)
 Frame = +1

Query: 238 G*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEH 417
           G R +GL+L+V++++A +L  KD  G SDP++ + L      +Y TS    TL+P+W EH
Sbjct: 36  GRRDTGLVLDVKIIQARNLAAKDRGGTSDPYLVLTL---GDAKYTTSTIPKTLDPIWNEH 92

Query: 418 FSLPMSGTVNEDSLCLEVWDFD 483
           +  P++ +    SL    WD D
Sbjct: 93  YQFPIN-SAQSLSLTGICWDKD 113


>UniRef50_Q6XYQ8 Cluster: Synaptotagmin-10; n=79; Gnathostomata|Rep:
           Synaptotagmin-10 - Homo sapiens (Human)
          Length = 523

 Score = 59.3 bits (137), Expect = 5e-08
 Identities = 28/76 (36%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS- 435
           +L V++++A DL  KD  G SDP+V +YL+ +   ++ T V   TLNP+++E F  P++ 
Sbjct: 247 LLVVKIIKALDLPAKDFTGTSDPYVKMYLLPDRKKKFQTRVHRKTLNPLFDETFQFPVAY 306

Query: 436 GTVNEDSLCLEVWDFD 483
             ++   L   V+DFD
Sbjct: 307 DQLSNRKLHFSVYDFD 322



 Score = 42.7 bits (96), Expect = 0.004
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           + + V++  +L   D  G SDP+V + LM       +  T+ K  TLNPV+ E   F +P
Sbjct: 380 MTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTTTKKNTLNPVYNEAIIFDIP 439

Query: 430 MSGTVNEDSLCLEVWDFD 483
               V++ SL + V D+D
Sbjct: 440 PE-NVDQVSLSIAVMDYD 456


>UniRef50_Q8CF95 Cluster: Synaptotagmin VIIgamma; n=4; Eutheria|Rep:
           Synaptotagmin VIIgamma - Mus musculus (Mouse)
          Length = 518

 Score = 58.8 bits (136), Expect = 6e-08
 Identities = 33/77 (42%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L V+V++A +L  KD +G SDPFV IYL+ +  H+  T VK   LNP W E F     P 
Sbjct: 267 LTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPY 326

Query: 433 SGTVNEDSLCLEVWDFD 483
              V +  L L+V D+D
Sbjct: 327 EKVV-QRVLYLQVLDYD 342


>UniRef50_P13677 Cluster: Protein kinase C, eye isozyme (EC
           2.7.11.13) (PKC) (dPKC53E(EY)); n=5; Eumetazoa|Rep:
           Protein kinase C, eye isozyme (EC 2.7.11.13) (PKC)
           (dPKC53E(EY)) - Drosophila melanogaster (Fruit fly)
          Length = 700

 Score = 58.8 bits (136), Expect = 6e-08
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 2/79 (2%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS--GTLNPVWEEHFSL 426
           G  L V++ EA +L+P D NG SDP++ + +  + S R     K+    LNPV+ E F+ 
Sbjct: 205 GNNLKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTF 264

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            +     +  L +EVWD+D
Sbjct: 265 ELQPQDRDKRLLIEVWDWD 283


>UniRef50_A2EYC8 Cluster: C2 domain containing protein; n=2;
            Trichomonas vaginalis G3|Rep: C2 domain containing
            protein - Trichomonas vaginalis G3
          Length = 2028

 Score = 58.4 bits (135), Expect = 8e-08
 Identities = 31/74 (41%), Positives = 41/74 (55%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L+VEVV+A DL   D N  +DP+V + L    S    T+VK    NPVW E F + +   
Sbjct: 1169 LHVEVVKAVDLPITDLNLGTDPYVVLSLSGKKSEEKKTTVKENNRNPVWNEQFDIRID-D 1227

Query: 442  VNEDSLCLEVWDFD 483
            V +D L + VWD D
Sbjct: 1228 VTKDVLVVTVWDKD 1241



 Score = 44.8 bits (101), Expect = 0.001
 Identities = 19/74 (25%), Positives = 42/74 (56%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L++++V A  L  KD +   DP+   ++  N  +++ + V   + +PVW + ++  +   
Sbjct: 950  LHLDIVGAVGLPAKDLDLSCDPYCVCFIKGNHENKFQSKVIHDSKDPVWNDKYNFELPNK 1009

Query: 442  VNEDSLCLEVWDFD 483
              +D+L L+V+D+D
Sbjct: 1010 -QDDTLVLQVFDYD 1022



 Score = 40.3 bits (90), Expect = 0.023
 Identities = 24/75 (32%), Positives = 38/75 (50%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           + +V+VV A DL   D N  +DP+V I +    S    T V +   +P W EHF + +  
Sbjct: 474 IFHVDVVRAKDLPATDANLSTDPYVIIRVEGQES---KTKVINNNRHPEWNEHFDIHLL- 529

Query: 439 TVNEDSLCLEVWDFD 483
             + D + + V+D D
Sbjct: 530 HASSDKVLVTVYDRD 544


>UniRef50_A7QXA9 Cluster: Chromosome chr19 scaffold_218, whole
           genome shotgun sequence; n=2; Vitis vinifera|Rep:
           Chromosome chr19 scaffold_218, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 524

 Score = 57.6 bits (133), Expect = 1e-07
 Identities = 29/75 (38%), Positives = 43/75 (57%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +  VEV+EA+D+ P D NGL+DP+V   L     +R+ T ++  TL P W E F +P+  
Sbjct: 286 LARVEVLEASDMKPSDLNGLADPYVKGKL---GPYRFTTKIQKKTLTPKWNEEFKIPICS 342

Query: 439 TVNEDSLCLEVWDFD 483
               + L +EV D D
Sbjct: 343 WELPNMLVIEVRDKD 357


>UniRef50_UPI00015B5D82 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 658

 Score = 57.2 bits (132), Expect = 2e-07
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V+V+EA +L  KD +G SDP+V IYL+ +   +Y T V    LNP++ E F   +S  
Sbjct: 216 LVVKVLEARELPVKDVSGSSDPYVKIYLLPDRKKKYQTKVHRKNLNPIFNETFIFSVSHE 275

Query: 439 TVNEDSLCLEVWDFD 483
            + E  L   V+DFD
Sbjct: 276 DLQERYLQFSVYDFD 290



 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L + V++A +L   D  G SDP+V +YL+       +  TSVK G L PV+ E   F +P
Sbjct: 348 LTLTVIKARNLKKMDITGSSDPYVKVYLLCQGKRIKKKKTSVKKGCLCPVYNEALVFDVP 407

Query: 430 MSGTVNEDSLCLEVWDFD 483
            +  V + SL ++V D+D
Sbjct: 408 -AENVEDVSLIIKVIDYD 424


>UniRef50_Q9LPH4 Cluster: T3F20.10 protein; n=6; Arabidopsis
           thaliana|Rep: T3F20.10 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 768

 Score = 57.2 bits (132), Expect = 2e-07
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
           VEV EA+DL P D NGL+DP+V   L    ++R+ T ++  TL+P W E F +P+    +
Sbjct: 286 VEVFEASDLKPSDLNGLADPYVKGKL---GAYRFKTKIQKKTLSPKWHEEFKIPIFTWDS 342

Query: 448 EDSLCLEVWDFD 483
              L +EV D D
Sbjct: 343 PSILNIEVGDKD 354


>UniRef50_A7RFY4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 340

 Score = 57.2 bits (132), Expect = 2e-07
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 3/78 (3%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +L V+V+ A DLVP+D NG SDP+V + L+ +        T  K  TLNPV+ E F   +
Sbjct: 45  LLLVKVIRARDLVPRDLNGKSDPYVVLELVPDRLEEGTKKTRFKQKTLNPVFNEIFQFKV 104

Query: 433 -SGTVNEDSLCLEVWDFD 483
               + +  LC  +WD D
Sbjct: 105 PHNNLTDTKLCATIWDHD 122


>UniRef50_O43581 Cluster: Synaptotagmin-7; n=62; Eumetazoa|Rep:
           Synaptotagmin-7 - Homo sapiens (Human)
          Length = 402

 Score = 57.2 bits (132), Expect = 2e-07
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L +++++A +L  KD +G SDPFV IYL+ +  H+  T VK   LNP W E F     P 
Sbjct: 151 LTLKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLKTKVKRKNLNPHWNETFLFEGFPY 210

Query: 433 SGTVNEDSLCLEVWDFD 483
              V +  L L+V D+D
Sbjct: 211 EKVV-QRILYLQVLDYD 226


>UniRef50_UPI0000F2EC82 Cluster: PREDICTED: similar to synaptotagmin
           VII,, partial; n=1; Monodelphis domestica|Rep:
           PREDICTED: similar to synaptotagmin VII,, partial -
           Monodelphis domestica
          Length = 279

 Score = 56.4 bits (130), Expect = 3e-07
 Identities = 25/53 (47%), Positives = 34/53 (64%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           L V++++A +L  KD +G SDPFV IYL+ +  H+  T VK   LNP W E F
Sbjct: 224 LTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETF 276


>UniRef50_Q9FYD9 Cluster: Calcium lipid binding protein-like; n=3;
           Arabidopsis thaliana|Rep: Calcium lipid binding
           protein-like - Arabidopsis thaliana (Mouse-ear cress)
          Length = 583

 Score = 56.4 bits (130), Expect = 3e-07
 Identities = 29/75 (38%), Positives = 42/75 (56%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V ++ A +L+ KD  G SDP+V + L         T++K   LNP W EHF L +  
Sbjct: 305 LLHVSILRARNLLKKDLLGTSDPYVKLSLTGEKLPAKKTTIKKRNLNPEWNEHFKLIVKD 364

Query: 439 TVNEDSLCLEVWDFD 483
             N   L LEV+D+D
Sbjct: 365 P-NSQVLQLEVFDWD 378


>UniRef50_UPI00006A071C Cluster: BAI1-associated protein 3 (BAP3).;
            n=3; Euteleostomi|Rep: BAI1-associated protein 3 (BAP3).
            - Xenopus tropicalis
          Length = 1173

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 4/62 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHR----YNTSVKSGTLNPVWEEHFSLP 429
            L VEV+ A DL+  D NGLSDPFV I L  +          T VK  TL+PV++E F   
Sbjct: 1014 LYVEVLHAADLIALDANGLSDPFVIIELCPHHIFPLVKCQRTQVKPKTLHPVYDELFYFS 1073

Query: 430  MS 435
            +S
Sbjct: 1074 VS 1075



 Score = 40.7 bits (91), Expect(2) = 4e-07
 Identities = 18/37 (48%), Positives = 23/37 (62%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           T VKS TLNPVW E+F   +   +  D L L++WD D
Sbjct: 244 TEVKSNTLNPVWNENFLFEID-DIFSDQLHLDIWDHD 279



 Score = 35.1 bits (77), Expect(2) = 4e-07
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHR 366
           +A    L V VV+  +L+ KDPNG SDP+  + +M   S +
Sbjct: 167 KAPVFALKVTVVQGRNLLAKDPNGFSDPYCMLGIMIMQSSK 207


>UniRef50_Q5RG04 Cluster: Novel protein similar to vertebrate
           synaptotagmin X; n=2; Danio rerio|Rep: Novel protein
           similar to vertebrate synaptotagmin X - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 611

 Score = 56.0 bits (129), Expect = 4e-07
 Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A DL  KD  G SDP+V IYL+     ++ T V   TLNP ++E F  P+   
Sbjct: 336 LVVRILKALDLPAKDFTGTSDPYVKIYLLPERKKKFQTRVHRKTLNPTFDEDFRFPVEYS 395

Query: 439 TVNEDSLCLEVWDFD 483
            +    L   V+DFD
Sbjct: 396 ELCNRKLHFSVYDFD 410



 Score = 41.5 bits (93), Expect = 0.010
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           + + V++  +L   D  G SDP+V + L+ +     +  T+ K  TLNPV+ E   F +P
Sbjct: 468 MTLTVIKCRNLKAMDITGYSDPYVKVALICDGRRLKKRKTTTKKNTLNPVYNEAIIFDIP 527

Query: 430 MSGTVNEDSLCLEVWDFD 483
               V + SL + V D+D
Sbjct: 528 PE-NVEQVSLSITVMDYD 544


>UniRef50_Q0JP57 Cluster: Os01g0242600 protein; n=4; Oryza
           sativa|Rep: Os01g0242600 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 736

 Score = 55.6 bits (128), Expect = 6e-07
 Identities = 26/74 (35%), Positives = 44/74 (59%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + +E++E +D+ P D NGLSDP+V   L      ++ T ++  TL+P W E F +P++  
Sbjct: 349 VKLEILEGSDMKPSDMNGLSDPYVKGRL---GPFKFQTQIQKKTLSPKWFEEFKIPITSW 405

Query: 442 VNEDSLCLEVWDFD 483
            + + L +EV D D
Sbjct: 406 ESLNELAMEVCDKD 419


>UniRef50_Q6NN63 Cluster: RH64806p; n=7; Endopterygota|Rep: RH64806p -
            Drosophila melanogaster (Fruit fly)
          Length = 1120

 Score = 55.6 bits (128), Expect = 6e-07
 Identities = 34/81 (41%), Positives = 46/81 (56%), Gaps = 7/81 (8%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRY----NTSVKSGTLNPVWEE--HFS 423
            L VEV+ A D+VP DPNG SDPFV I L+      +     T+V   TLNPV++E   FS
Sbjct: 963  LCVEVLHARDVVPLDPNGFSDPFVVIELLPRRVFLHCMEQQTNVHKRTLNPVFDECFEFS 1022

Query: 424  LPMSGTVNEDS-LCLEVWDFD 483
            + +   + E + +C  V D D
Sbjct: 1023 VTLEQCLTEGAMICFTVMDHD 1043



 Score = 36.7 bits (81), Expect = 0.29
 Identities = 16/42 (38%), Positives = 22/42 (52%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFDPAETV 498
           TS+K  TL P W E F   +   +N D+  L++WD D    V
Sbjct: 199 TSIKPHTLTPKWNEKFKFDID-DINTDTFHLDIWDHDDESCV 239


>UniRef50_UPI0000660ADD Cluster: Synaptotagmin-2 (Synaptotagmin II)
           (SytII).; n=1; Takifugu rubripes|Rep: Synaptotagmin-2
           (Synaptotagmin II) (SytII). - Takifugu rubripes
          Length = 391

 Score = 55.2 bits (127), Expect = 8e-07
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A DL+  D  G SDP+V + L+ +   +Y+T V   TLNPV+ E F   +   
Sbjct: 133 LTVGILQAADLISMDSGGTSDPYVKVLLLPDKKKKYDTKVHKKTLNPVFNETFVFKVPYE 192

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + V+D+D
Sbjct: 193 ELGGKTLVMSVYDYD 207



 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS--LP 429
           L V ++EA +L   D  GLSDP+V I L+       +  T+VK  TLNP + E FS  +P
Sbjct: 263 LTVCILEAKNLKKMDACGLSDPYVKIQLLQGGKRLKKKKTTVKKNTLNPYYNESFSFEIP 322

Query: 430 MSGTVNEDSLCLEVWDFD 483
           +   + +  + + V+D+D
Sbjct: 323 LE-QMQKIIVVVTVFDYD 339


>UniRef50_Q9W2R9 Cluster: CG11556-PA; n=4; Sophophora|Rep:
           CG11556-PA - Drosophila melanogaster (Fruit fly)
          Length = 638

 Score = 55.2 bits (127), Expect = 8e-07
 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L V V +  +L+  D NG SDPFV I L   ++ + ++ TSVK  TLNP++ E F    S
Sbjct: 513 LVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEAS 572

Query: 436 -GTVNEDSLCLEVWDFD 483
              +N++ L L VWD D
Sbjct: 573 PHDLNKEMLILTVWDKD 589


>UniRef50_O43374 Cluster: Ras GTPase-activating protein 4; n=65;
           Eumetazoa|Rep: Ras GTPase-activating protein 4 - Homo
           sapiens (Human)
          Length = 803

 Score = 55.2 bits (127), Expect = 8e-07
 Identities = 30/79 (37%), Positives = 39/79 (49%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A    L   V+EA DL PKD NG SDPFV +     +     TS+   +  P W E F  
Sbjct: 130 ARACRLRCSVLEARDLAPKDRNGTSDPFVRVRYKGRTR---ETSIVKKSCYPRWNETFEF 186

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            +     E +LC+E WD+D
Sbjct: 187 ELQEGAME-ALCVEAWDWD 204


>UniRef50_Q9ESN1 Cluster: Double C2-like domain-containing protein
           gamma; n=8; Theria|Rep: Double C2-like domain-containing
           protein gamma - Mus musculus (Mouse)
          Length = 387

 Score = 55.2 bits (127), Expect = 8e-07
 Identities = 31/77 (40%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYL--MSNSSHRYNTSVKSGTLNPVW-EEHFSLPM 432
           L V V+    L P D NG SDPFV ++L   S    +Y TSV+  TLNP + EE F    
Sbjct: 260 LLVGVLRCVHLAPMDANGYSDPFVRLFLHPSSGKKSKYKTSVRRKTLNPEFNEEFFYAGH 319

Query: 433 SGTVNEDSLCLEVWDFD 483
              + + +L + VWD+D
Sbjct: 320 REELAQKALLVSVWDYD 336


>UniRef50_A2CE77 Cluster: Novel protein similar to vertebrate RAS
           p21 protein activator 4; n=9; Euteleostomi|Rep: Novel
           protein similar to vertebrate RAS p21 protein activator
           4 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 800

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 27/71 (38%), Positives = 38/71 (53%)
 Frame = +1

Query: 271 EVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNE 450
           +V+EA DL  KD NG SDPFV +     +   Y +SV   +  P W E F   +   + +
Sbjct: 139 QVLEARDLAKKDRNGASDPFVRVRYNGKT---YESSVVKKSCYPRWNESFEFELDEALTD 195

Query: 451 DSLCLEVWDFD 483
             L +EVWD+D
Sbjct: 196 SLLSVEVWDWD 206



 Score = 32.3 bits (70), Expect = 6.2
 Identities = 18/55 (32%), Positives = 30/55 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           L + +VE  +L  KD  G SDP+  + + + +  R  T  K  TL+P W E +++
Sbjct: 7   LFIRIVEGKNLPIKDITGSSDPYCIVKIDNEAIIRTATIWK--TLSPFWGEEYTV 59


>UniRef50_Q86J14 Cluster: Similar to Dictyostelium discoideum (Slime
           mold). R2005 protein; n=2; Dictyostelium discoideum|Rep:
           Similar to Dictyostelium discoideum (Slime mold). R2005
           protein - Dictyostelium discoideum (Slime mold)
          Length = 320

 Score = 54.4 bits (125), Expect = 1e-06
 Identities = 25/72 (34%), Positives = 42/72 (58%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
           ++++ A +L+  D  G SDP+V I   + +   Y T   S +LNP+W E F++ +   VN
Sbjct: 114 IKILSARNLIAADVGGTSDPYVKIKTPATNGKDYKTRHISKSLNPIWNETFNIDLGNCVN 173

Query: 448 EDSLCLEVWDFD 483
            D + +EV+D D
Sbjct: 174 -DLVIIEVYDHD 184


>UniRef50_O96997 Cluster: Protein kinase C; n=2;
           Tetractinomorpha|Rep: Protein kinase C - Geodia cydonium
           (Sponge)
          Length = 677

 Score = 54.4 bits (125), Expect = 1e-06
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 5/81 (6%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFS 423
           + L++ +++  +L P D NG +DP+V + L+  +S+  +  T  ++ TL+PVWEE   F 
Sbjct: 168 IRLHIGIIQGANLPPMDANGYADPYVKLRLLPEASNAAKQKTERQTKTLSPVWEETFFFD 227

Query: 424 LPMSGTVNEDS-LCLEVWDFD 483
           +  + T  E S L +EVWD+D
Sbjct: 228 VNKADTSFELSRLVIEVWDWD 248


>UniRef50_UPI00015B4343 Cluster: PREDICTED: similar to CG2381-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG2381-PA - Nasonia vitripennis
          Length = 476

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L + +++  DL  KD +G SDP+V + L+ +  HR  T +K  TLNP W E F     P+
Sbjct: 224 LILRIIQGKDLPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPI 283

Query: 433 SGTVNEDSLCLEVWDFD 483
              +    L L V+D+D
Sbjct: 284 Q-KLQSRVLHLHVFDYD 299



 Score = 48.4 bits (110), Expect = 9e-05
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 3/81 (3%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           S  +L + V++A +L  KD NG SDP+V ++L        +  T +   TLNPV+ E FS
Sbjct: 349 SNSVLTLTVLKARNLKAKDINGKSDPYVKVWLQFGDKRIEKRKTEIYKCTLNPVFNEPFS 408

Query: 424 LPMS-GTVNEDSLCLEVWDFD 483
             +    + E SL + V DFD
Sbjct: 409 FNVPWEKIRECSLDVMVMDFD 429


>UniRef50_UPI0000EBC5BC Cluster: PREDICTED: similar to
           Synaptotagmin-6 (Synaptotagmin VI) (SytVI); n=1; Bos
           taurus|Rep: PREDICTED: similar to Synaptotagmin-6
           (Synaptotagmin VI) (SytVI) - Bos taurus
          Length = 547

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A DL  KD  G SDP+V IYL+ +   +  T V   TLNP ++E+F  P+   
Sbjct: 197 LIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYE 256

Query: 439 TVNEDSLCLEVWDFD 483
            + +  L L V+DFD
Sbjct: 257 ELADRKLHLSVFDFD 271



 Score = 43.6 bits (98), Expect = 0.003
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L + V++  +L   D  G SDP+V + L+ +     +  T++K  TLNPV+ E   F +P
Sbjct: 329 LTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIP 388

Query: 430 MSGTVNEDSLCLEVWDFD 483
               +++ SL + V D+D
Sbjct: 389 PE-NMDQVSLLISVMDYD 405


>UniRef50_UPI0000E4A632 Cluster: PREDICTED: similar to Syt7 protein;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to Syt7 protein - Strongylocentrotus purpuratus
          Length = 404

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 30/76 (39%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMS 435
           L + +V+A  L  KD +G SDPFV I L+ +   +  T VK   LNP+W E  HF     
Sbjct: 151 LVLRIVKANHLPAKDFSGTSDPFVKIMLLPDKKVKMETKVKRKNLNPIWNESFHFEGYPY 210

Query: 436 GTVNEDSLCLEVWDFD 483
             + E  L L+V D+D
Sbjct: 211 SKIQERVLHLQVLDYD 226



 Score = 40.3 bits (90), Expect = 0.023
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           + + V++  +L  KD  G SDP+V I+ M       +  T +K  TLNPV+ E   F++P
Sbjct: 282 ITITVLKCQNLAAKDITGKSDPYVKIWHMHKDKRVEKKKTVIKYHTLNPVYNESFVFNIP 341

Query: 430 MSGTVNEDSLCLEVWDFD 483
           +   + + +  + V D D
Sbjct: 342 LD-RIRDTTFVVSVLDKD 358


>UniRef50_UPI0000EB28DE Cluster: Synaptotagmin-6 (Synaptotagmin VI)
           (SytVI).; n=5; Deuterostomia|Rep: Synaptotagmin-6
           (Synaptotagmin VI) (SytVI). - Canis familiaris
          Length = 531

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A DL  KD  G SDP+V IYL+ +   +  T V   TLNP ++E+F  P+   
Sbjct: 260 LIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYE 319

Query: 439 TVNEDSLCLEVWDFD 483
            + +  L L V+DFD
Sbjct: 320 ELADRKLHLSVFDFD 334



 Score = 43.6 bits (98), Expect = 0.003
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L + V++  +L   D  G SDP+V + L+ +     +  T++K  TLNPV+ E   F +P
Sbjct: 392 LTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIP 451

Query: 430 MSGTVNEDSLCLEVWDFD 483
               +++ SL + V D+D
Sbjct: 452 PE-NMDQVSLLISVMDYD 468


>UniRef50_Q3UY13 Cluster: Adult male olfactory brain cDNA, RIKEN
           full-length enriched library, clone:6430558G17
           product:synaptotagmin 6, full insert sequence; n=4;
           Euteleostomi|Rep: Adult male olfactory brain cDNA, RIKEN
           full-length enriched library, clone:6430558G17
           product:synaptotagmin 6, full insert sequence - Mus
           musculus (Mouse)
          Length = 342

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A DL  KD  G SDP+V IYL+ +   +  T V   TLNP ++E+F  P+   
Sbjct: 162 LIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYE 221

Query: 439 TVNEDSLCLEVWDFD 483
            + +  L L V+DFD
Sbjct: 222 ELADRKLHLSVFDFD 236


>UniRef50_Q6Z8U1 Cluster: C2 domain/GRAM domain-containing
           protein-like; n=2; Oryza sativa|Rep: C2 domain/GRAM
           domain-containing protein-like - Oryza sativa subsp.
           japonica (Rice)
          Length = 1081

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 32/76 (42%), Positives = 42/76 (55%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           + LNV V+EA +L   D NG SDP+V + L      R+ T V    LNP W++ FS  + 
Sbjct: 1   MRLNVRVIEARNLRAMDSNGFSDPYVKLQL---GKQRFKTKVVKKNLNPAWDQEFSFSV- 56

Query: 436 GTVNEDSLCLEVWDFD 483
           G V  D L L V+D D
Sbjct: 57  GDV-RDVLKLYVYDED 71


>UniRef50_Q9I7M6 Cluster: CG5559-PA; n=4; Diptera|Rep: CG5559-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 494

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 24/78 (30%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           G +LNV ++EA +L P+  +G +DP+  + L+ +  + + T +   TLNPV++E F   +
Sbjct: 222 GGLLNVRLLEAQNLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEV 281

Query: 433 -SGTVNEDSLCLEVWDFD 483
            +G +++ ++ + ++DFD
Sbjct: 282 TAGVIDKRTVEILLYDFD 299



 Score = 32.3 bits (70), Expect = 6.2
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 4/55 (7%)
 Frame = +1

Query: 262 LNVEVVEATDL-VPKDPNGLSDPFVTIYLMSNSSHRYN---TSVKSGTLNPVWEE 414
           L V +++A +L +  D    SDP+V + L+     +     T V+ GTLNPV+ E
Sbjct: 357 LMVVLIKARNLRIVDDARNSSDPYVKVTLLGPGGKKIKKRKTGVQRGTLNPVYNE 411


>UniRef50_A2E8X1 Cluster: C2 domain containing protein; n=4;
            Trichomonas vaginalis G3|Rep: C2 domain containing
            protein - Trichomonas vaginalis G3
          Length = 1271

 Score = 53.6 bits (123), Expect = 2e-06
 Identities = 25/80 (31%), Positives = 44/80 (55%)
 Frame = +1

Query: 244  RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
            +A  ++L+  VV+  +L   D  G SDPFV +  ++     Y T +    LNP+W + F+
Sbjct: 991  KADPIVLHCTVVDGVELPAMDITGFSDPFVRL-TVNGQGKPYTTGIVMRELNPIWNQEFN 1049

Query: 424  LPMSGTVNEDSLCLEVWDFD 483
            +P+    N+D L +  +D+D
Sbjct: 1050 IPIDNQ-NKDKLYITCYDWD 1068



 Score = 53.2 bits (122), Expect = 3e-06
 Identities = 26/76 (34%), Positives = 43/76 (56%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           ++LN  V++A DL   D +G +DPF  I  ++    ++ T V    LNPVW   F++P++
Sbjct: 396 IVLNATVIDARDLPAMDADGQADPFC-ILTVNGKGEQFKTRVIKNNLNPVWNHAFNIPIN 454

Query: 436 GTVNEDSLCLEVWDFD 483
                D+L + + DFD
Sbjct: 455 NQFT-DTLYVNLIDFD 469



 Score = 52.4 bits (120), Expect = 5e-06
 Identities = 26/79 (32%), Positives = 44/79 (55%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A+ ++++  VV+A DL   D NG +DPF  +  ++     Y T V     NP W + F++
Sbjct: 692 ATPIVVHCTVVDAKDLPAMDINGKADPFCQL-TVNGKGQEYKTEVVMKNKNPTWNQSFNI 750

Query: 427 PMSGTVNEDSLCLEVWDFD 483
           P+    N+D L + ++DFD
Sbjct: 751 PVEDQ-NKDHLYVTLFDFD 768



 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 29/75 (38%), Positives = 41/75 (54%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            +L+  VV A DLVP D NG SDP+V + L  N   +  T VK+ +LNP   E+F   +  
Sbjct: 1144 LLDATVVNARDLVPMDKNGKSDPYVILKLNRNGIPQQTTVVKA-SLNPDINENFDFTLID 1202

Query: 439  TVNEDSLCLEVWDFD 483
                D L +  +D+D
Sbjct: 1203 P-KTDVLLVYCYDWD 1216



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 25/74 (33%), Positives = 39/74 (52%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           ++ +V+ AT LV  D NG SDP+V +    +   +  T +   TLNP W + F+  +   
Sbjct: 541 VDCKVISATKLVAMDSNGKSDPYVVLKYNKDGEPQ-KTEICKKTLNPEWNQDFTFTVV-Q 598

Query: 442 VNEDSLCLEVWDFD 483
              D L +E WD+D
Sbjct: 599 KKTDILYVECWDWD 612



 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL-PMSG 438
            L+  VV A++LV  D +GLSDP+V +  ++       T V    LNP W + F   P+  
Sbjct: 846  LDCTVVSASNLVKMDKHGLSDPYV-VLKVNKDGEPQKTEVVKQNLNPEWNQEFHFTPVDK 904

Query: 439  TVNEDSLCLEVWDFD 483
            T  +D L +E +D+D
Sbjct: 905  T--KDVLVVECYDWD 917


>UniRef50_Q59EZ0 Cluster: Protein kinase C, gamma variant; n=5;
           Euteleostomi|Rep: Protein kinase C, gamma variant - Homo
           sapiens (Human)
          Length = 239

 Score = 53.6 bits (123), Expect = 2e-06
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSL 426
           ++V V EA +L+P DPNGLSDP+V + L+ +  +  +  T     TLNPVW E F L
Sbjct: 183 IHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVL 239


>UniRef50_Q0UEG6 Cluster: Putative uncharacterized protein; n=1;
            Phaeosphaeria nodorum|Rep: Putative uncharacterized
            protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1461

 Score = 53.6 bits (123), Expect = 2e-06
 Identities = 26/74 (35%), Positives = 39/74 (52%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L V++++A DL   D NG SDP+     M N    Y T  +  TL+P W E+F +P+   
Sbjct: 1072 LRVDILDAADLPAADRNGFSDPYCK--FMLNDKEVYKTKTQKKTLHPAWNEYFEVPVRSR 1129

Query: 442  VNEDSLCLEVWDFD 483
               D   + V+D+D
Sbjct: 1130 TAAD-FVVNVYDWD 1142



 Score = 33.9 bits (74), Expect = 2.0
 Identities = 29/85 (34%), Positives = 38/85 (44%)
 Frame = +1

Query: 223 SYQSGG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNP 402
           S  SGG      ++ +    A DL   +  G SDP+V + L      R  T      LNP
Sbjct: 680 SLASGGYLTPIGVMRLHFQSARDLRNLEKLGKSDPYVRVLLSGVEKGR--TVTFKNNLNP 737

Query: 403 VWEEHFSLPMSGTVNEDSLCLEVWD 477
            W+E   +P+  TV E  L LEV D
Sbjct: 738 DWDEVVYVPVH-TVRE-KLTLEVMD 760


>UniRef50_UPI0000D565A6 Cluster: PREDICTED: similar to CG11556-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG11556-PA - Tribolium castaneum
          Length = 550

 Score = 53.2 bits (122), Expect = 3e-06
 Identities = 31/76 (40%), Positives = 42/76 (55%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHR-YNTSVKSGTLNPVWEEHFSLPMSG 438
           L V V    +L+P D NG SDPFV + L  +  HR + TS+K   LNPV+ E F+     
Sbjct: 426 LLVMVCRCANLLPMDNNGFSDPFVKLQLRPDPCHRKHKTSIKWKNLNPVYNEEFAFETRP 485

Query: 439 T-VNEDSLCLEVWDFD 483
           T +   SL + V+D D
Sbjct: 486 TELATQSLYITVYDKD 501



 Score = 39.5 bits (88), Expect = 0.041
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFS 423
           L+  V  A +L+P D NGLSDPF  + ++ N+  S R  T     T NP + E+ +
Sbjct: 278 LHCTVYRAKNLIPMDINGLSDPFCKLNILPNAKPSTRLRTKTVHKTRNPEFNENLT 333


>UniRef50_A7QTN2 Cluster: Chromosome chr11 scaffold_170, whole
           genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome chr11 scaffold_170, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 583

 Score = 53.2 bits (122), Expect = 3e-06
 Identities = 28/75 (37%), Positives = 43/75 (57%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L++ V+ A DL   D  G +DP+V + ++  S  R  T V + +LNPVW + F   +  
Sbjct: 458 VLSITVISAEDLPVVDLMGKADPYVVL-ILKKSEIRNKTRVVNDSLNPVWNQTFDFVVED 516

Query: 439 TVNEDSLCLEVWDFD 483
            ++ D L LEVWD D
Sbjct: 517 GLH-DMLILEVWDHD 530



 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 23/72 (31%), Positives = 38/72 (52%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V++V+A +L  KD  G SDPF  +Y+    +    +   +  LNPVW EHF   +   
Sbjct: 280 LEVKLVQAKELTNKDIIGKSDPFAVLYVRPLPNRMKTSKTINNQLNPVWNEHFEFIVE-D 338

Query: 442 VNEDSLCLEVWD 477
            +   L ++++D
Sbjct: 339 ASTQHLVVKIYD 350


>UniRef50_A5APY9 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 295

 Score = 53.2 bits (122), Expect = 3e-06
 Identities = 28/75 (37%), Positives = 43/75 (57%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L++ V+ A DL   D  G +DP+V + ++  S  R  T V + +LNPVW + F   +  
Sbjct: 170 VLSITVISAEDLPVVDLMGKADPYVVL-ILKKSEIRNKTRVVNDSLNPVWNQTFDFVVED 228

Query: 439 TVNEDSLCLEVWDFD 483
            ++ D L LEVWD D
Sbjct: 229 GLH-DMLILEVWDHD 242


>UniRef50_Q55F06 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1414

 Score = 53.2 bits (122), Expect = 3e-06
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 4/74 (5%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLS-DPFVTIYLMSNSSHRYNT---SVKSGTLNPVWEEHFSLPMS 435
           ++VV A DL+ K+   +  + FV +  +SNSS  +N    + K  +LNP+W+EHFS  ++
Sbjct: 464 IKVVSARDLIQKESQSIKPESFVEVEFISNSSKDFNKKKRTKKINSLNPIWKEHFSFQIT 523

Query: 436 GTVNEDSLCLEVWD 477
                D + L +WD
Sbjct: 524 KQQLNDEIELTIWD 537


>UniRef50_Q32P40 Cluster: PCLO protein; n=7; Tetrapoda|Rep: PCLO
           protein - Homo sapiens (Human)
          Length = 423

 Score = 53.2 bits (122), Expect = 3e-06
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVK--SGTLNPVWEE---HFSL 426
           L + +++A +LVP+D NG SDPFV +YL+      Y    K    +LNP W +   + S+
Sbjct: 206 LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGAEYKRRTKHVQKSLNPEWNQTVIYKSI 265

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            M   + + +L + VWD+D
Sbjct: 266 SME-QLKKKTLEVTVWDYD 283


>UniRef50_P21579 Cluster: Synaptotagmin-1; n=84; Eumetazoa|Rep:
           Synaptotagmin-1 - Homo sapiens (Human)
          Length = 422

 Score = 53.2 bits (122), Expect = 3e-06
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A +L   D  G SDP+V ++L+ +   ++ T V   TLNPV+ E F+  +   
Sbjct: 159 LLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYS 218

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + V+DFD
Sbjct: 219 ELGGKTLVMAVYDFD 233



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I+LM N     +  T++K  TLNP + E FS  + 
Sbjct: 290 LTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVP 349

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  + + V D+D
Sbjct: 350 FEQIQKVQVVVTVLDYD 366


>UniRef50_Q9Y6V0 Cluster: Protein piccolo; n=17; Amniota|Rep: Protein
            piccolo - Homo sapiens (Human)
          Length = 5183

 Score = 53.2 bits (122), Expect = 3e-06
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVK--SGTLNPVWEE---HFSL 426
            L + +++A +LVP+D NG SDPFV +YL+      Y    K    +LNP W +   + S+
Sbjct: 4580 LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGAEYKRRTKHVQKSLNPEWNQTVIYKSI 4639

Query: 427  PMSGTVNEDSLCLEVWDFD 483
             M   + + +L + VWD+D
Sbjct: 4640 SME-QLKKKTLEVTVWDYD 4657


>UniRef50_UPI00015556CD Cluster: PREDICTED: hypothetical protein;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein - Ornithorhynchus anatinus
          Length = 622

 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A DL   D  G SDP+V ++L+ +   ++ T V   TLNP++ E FS  +   
Sbjct: 268 LMVGVLQAADLAALDIGGTSDPYVKVFLLPDKKKKHETKVHRKTLNPIFGETFSFKIPYA 327

Query: 439 TVNEDSLCLEVWDFD 483
            +    L + V+DFD
Sbjct: 328 ELGGKVLVMAVYDFD 342


>UniRef50_UPI00005883FB Cluster: PREDICTED: similar to B/K protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to B/K protein - Strongylocentrotus purpuratus
          Length = 487

 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPMS 435
           LNV+V++A  L+  D  G SDPFV + ++S         TS K  TL+PV+ E FS  ++
Sbjct: 351 LNVDVIKAKQLLQTDIVGGSDPFVKLQMISGQKVIKTKKTSTKKNTLDPVFNETFSFHVT 410

Query: 436 -GTVNEDSLCLEVWDFD 483
             ++++ SL + +WD++
Sbjct: 411 PSSLSDVSLLVSIWDYN 427



 Score = 38.7 bits (86), Expect = 0.072
 Identities = 28/82 (34%), Positives = 38/82 (46%), Gaps = 8/82 (9%)
 Frame = +1

Query: 262 LNVEVVEATDLVP-------KDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           LNV +++A DL P       K     S+P+V + L+ +      TSVK  T NP +EE F
Sbjct: 214 LNVRIIKARDLPPPMFYDSSKQDLSHSNPYVKVCLLPDQKDARQTSVKRKTQNPNFEESF 273

Query: 421 SLPM-SGTVNEDSLCLEVWDFD 483
              +         L L V DFD
Sbjct: 274 CFNIPHQEAQRRMLLLSVQDFD 295


>UniRef50_Q965S5 Cluster: Synaptotagmin protein 3; n=2;
           Caenorhabditis|Rep: Synaptotagmin protein 3 -
           Caenorhabditis elegans
          Length = 452

 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A +L   D  G SDP+V ++L+ +   +  T V+  +LNPV+ E F+  +   
Sbjct: 32  LTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFN 91

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L L V+DFD
Sbjct: 92  EIGGQTLVLNVFDFD 106



 Score = 48.4 bits (110), Expect = 9e-05
 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPM- 432
           L+V V+E  +L   D  GLSDP+V IYLM  +    +  T++K  TLNP + E FS  + 
Sbjct: 160 LSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVT 219

Query: 433 SGTVNEDSLCLEVWDFD 483
           S  +    L + V D+D
Sbjct: 220 SEKMQRVHLHVTVSDYD 236


>UniRef50_A7SG63 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 1162

 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 29/74 (39%), Positives = 41/74 (55%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V V+   +LV  D  G SDPFVT  +      ++ + V   TLNPVW E  S+ +S  
Sbjct: 733 IQVSVLRGRNLVAMDITGKSDPFVTFRV--GDQEKFRSRVHQKTLNPVWME--SVALSLP 788

Query: 442 VNEDSLCLEVWDFD 483
            ++D L L+VWD D
Sbjct: 789 ADDDKLYLDVWDKD 802



 Score = 40.3 bits (90), Expect = 0.023
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +1

Query: 292 LVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           ++P D NGLSDP+  +Y  +N +    T V   TL+PVW      P++
Sbjct: 484 MIPMDKNGLSDPYCVVY--ANRNLVKKTEVAKETLDPVWNAMVEFPVA 529


>UniRef50_A2FZS0 Cluster: C2 domain containing protein; n=3;
           Trichomonas vaginalis G3|Rep: C2 domain containing
           protein - Trichomonas vaginalis G3
          Length = 1284

 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 26/76 (34%), Positives = 39/76 (51%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+L + VV AT L   D  G SDP+  + + +    +Y T V     +P W + F +P+ 
Sbjct: 94  LLLKLTVVNATKLAAMDKGGKSDPYCVLTI-NGEGQQYKTEVVKENRSPEWNQDFQIPLK 152

Query: 436 GTVNEDSLCLEVWDFD 483
              N D LCL  +D+D
Sbjct: 153 SHEN-DKLCLACYDWD 167



 Score = 50.4 bits (115), Expect = 2e-05
 Identities = 28/80 (35%), Positives = 42/80 (52%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           ++L+  VV+A DL   D NG SDP+V + +  N + +  T V   T NP W + F L + 
Sbjct: 582 VILDCTVVDAKDLAAMDLNGKSDPYVIVKINKNGAPQ-KTEVIKKTKNPAWNQEFHLDLV 640

Query: 436 GTVNEDSLCLEVWDFDPAET 495
                D L +E +D+D   T
Sbjct: 641 DK-KTDVLVVECYDWDEKNT 659



 Score = 50.0 bits (114), Expect = 3e-05
 Identities = 28/76 (36%), Positives = 41/76 (53%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            ++L+  VV+A DL   D NG SDP+V + L  N   +  T V   T NPVW + F+  + 
Sbjct: 919  VLLDATVVDAKDLAAMDLNGKSDPYVILKLNKNGQPQ-KTEVIKKTKNPVWNQTFNFELV 977

Query: 436  GTVNEDSLCLEVWDFD 483
                 D L +E +D+D
Sbjct: 978  DK-KTDVLIVECYDWD 992


>UniRef50_Q9FY55 Cluster: CLB1-like protein; n=15;
           Magnoliophyta|Rep: CLB1-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 574

 Score = 52.4 bits (120), Expect = 5e-06
 Identities = 26/72 (36%), Positives = 39/72 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L+V+VV+A DL  KD  G SDP+  +++         T   S +LNP+W EHF   +   
Sbjct: 273 LDVKVVQAKDLANKDMIGKSDPYAIVFIRPLPDRTKKTKTISNSLNPIWNEHFEFIVE-D 331

Query: 442 VNEDSLCLEVWD 477
           V+   L + V+D
Sbjct: 332 VSTQHLTVRVFD 343



 Score = 50.4 bits (115), Expect = 2e-05
 Identities = 31/75 (41%), Positives = 40/75 (53%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V VV A DL   D  G +D FV I L   S  +  T V   +LNPVW + F   +  
Sbjct: 449 VLSVTVVAAEDLPAVDFMGKADAFVVITL-KKSETKSKTRVVPDSLNPVWNQTFDFVVED 507

Query: 439 TVNEDSLCLEVWDFD 483
            ++ D L LEVWD D
Sbjct: 508 ALH-DLLTLEVWDHD 521


>UniRef50_Q9V4C4 Cluster: CG2381-PA, isoform A; n=6;
           Endopterygota|Rep: CG2381-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 416

 Score = 52.4 bits (120), Expect = 5e-06
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L ++V++  +L  KD +G SDP+V + L+ +  HR  T +K  TLNP W E F     P+
Sbjct: 164 LILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPI 223

Query: 433 SGTVNEDSLCLEVWDFD 483
              +    L L V+D+D
Sbjct: 224 Q-KLQSRVLHLHVFDYD 239



 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           S  +L + +++A +L  KD NG SDP+V ++L        +  T + + TLNPV+ E FS
Sbjct: 289 SNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFS 348

Query: 424 LPMS-GTVNEDSLCLEVWDFD 483
             +    + E SL + V DFD
Sbjct: 349 FNVPWEKIRECSLDVMVMDFD 369


>UniRef50_UPI00015B4FEC Cluster: PREDICTED: similar to CG15078-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG15078-PA - Nasonia vitripennis
          Length = 940

 Score = 52.0 bits (119), Expect = 7e-06
 Identities = 29/76 (38%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM-S 435
           ++ + +VEA +L+P D +GLSDP+V   L    + +Y + V + TLNPVW E F L +  
Sbjct: 395 VVTIVLVEAKNLLPMDIDGLSDPYVKFRL---GTEKYKSKVANKTLNPVWLEQFDLHLYE 451

Query: 436 GTVNEDSLCLEVWDFD 483
                  L + VWD D
Sbjct: 452 DPYLGQELEVTVWDRD 467



 Score = 39.9 bits (89), Expect = 0.031
 Identities = 24/74 (32%), Positives = 36/74 (48%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L + +    +LV  D  G SDP+V I       H+  T  +   LNPVW+E  +LP+   
Sbjct: 244 LRLHIRRGANLVAMDRCGASDPYVKIKCSGRLLHKSRTVHRE--LNPVWDESVTLPIEDP 301

Query: 442 VNEDSLCLEVWDFD 483
                L  +V+D+D
Sbjct: 302 F--QPLNFKVFDYD 313


>UniRef50_UPI00015A4B3C Cluster: UPI00015A4B3C related cluster; n=2;
           Danio rerio|Rep: UPI00015A4B3C UniRef100 entry - Danio
           rerio
          Length = 653

 Score = 52.0 bits (119), Expect = 7e-06
 Identities = 26/66 (39%), Positives = 40/66 (60%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+  +++A  L P D NGL+DP+V ++L+  ++ S++  T     TLNPVW E  +L   
Sbjct: 365 LHCNIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRTTLNPVWNE--TLVYH 422

Query: 436 GTVNED 453
           G  NED
Sbjct: 423 GITNED 428



 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 31/84 (36%), Positives = 42/84 (50%), Gaps = 10/84 (11%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHR--YNTSVKSGTLNPVWEEH------ 417
           L V VV    L   D NG SDPFV I L  +   +  Y T +K  TLNP + E+      
Sbjct: 519 LIVGVVRCAHLAAMDSNGYSDPFVKICLKPDMGKKAKYKTQIKKKTLNPEFNENIFVDTG 578

Query: 418 -FSLPMS-GTVNEDSLCLEVWDFD 483
            FS  +  G + + +L + VWD+D
Sbjct: 579 EFSYEIKHGELAKKTLDVSVWDYD 602


>UniRef50_Q9JM89 Cluster: Synaptotagmin II; n=3; Mammalia|Rep:
           Synaptotagmin II - Mus musculus (Mouse)
          Length = 270

 Score = 52.0 bits (119), Expect = 7e-06
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A +L   D  G SDP+V ++L+ +   +Y T V   TLNP + E F+  +   
Sbjct: 159 LTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQ 218

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + ++DFD
Sbjct: 219 ELGGKTLVMAIYDFD 233


>UniRef50_A2FDM6 Cluster: C2 domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: C2 domain containing
           protein - Trichomonas vaginalis G3
          Length = 1783

 Score = 52.0 bits (119), Expect = 7e-06
 Identities = 29/76 (38%), Positives = 43/76 (56%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+L+V VV+ATDL   D NG SDP+V + L  N +  + T V     NP W + F+L + 
Sbjct: 561 LLLDVTVVKATDLAAMDLNGKSDPYVILSL--NDTEEFKTEVVKKNKNPEWNQTFTLKVV 618

Query: 436 GTVNEDSLCLEVWDFD 483
              + D L ++  D+D
Sbjct: 619 DQ-SSDKLHVKCMDWD 633



 Score = 49.2 bits (112), Expect = 5e-05
 Identities = 28/75 (37%), Positives = 41/75 (54%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L++ VV A +L  KD  G SDP+  + L + SS  Y T V    LNP W + F +P   
Sbjct: 736 VLDITVVSAKELARKDVLGKSDPYCKLSL-NGSSEVYQTEVIKNDLNPKWNQEFHIPFED 794

Query: 439 TVNEDSLCLEVWDFD 483
             ++D L + V+D D
Sbjct: 795 K-SKDVLHVIVFDHD 808



 Score = 48.8 bits (111), Expect = 7e-05
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 6/80 (7%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L+++V++A DL   D  G +DP+  +YL      +  T + +   +PVW+EHF    +  
Sbjct: 1337 LDLDVIKAEDLPQVDILGGADPYALVYLSETEEFKKQTKIINNNRSPVWDEHFDFDFNDP 1396

Query: 442  VNEDS------LCLEVWDFD 483
              +D+      L +EV+D+D
Sbjct: 1397 KIDDNTPKGRKLHVEVYDYD 1416



 Score = 46.4 bits (105), Expect = 4e-04
 Identities = 26/74 (35%), Positives = 39/74 (52%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L+V VV A  LV  D NGL+DP+  I  ++    +  T V   TL P W + F   ++  
Sbjct: 208 LDVTVVSAKGLVKMDKNGLADPY-CILTINGEGEQLETKVIKETLEPQWNQEFHFEINDK 266

Query: 442 VNEDSLCLEVWDFD 483
            N D+L +  +D+D
Sbjct: 267 SN-DTLYVTCYDWD 279



 Score = 46.4 bits (105), Expect = 4e-04
 Identities = 31/74 (41%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L V VV A DLV  D NG SDP+V + L  N S    T V     NPVW E F   +   
Sbjct: 880  LVVNVVNAIDLVAMDTNGKSDPYVLLKL--NDSEE-KTDVIKVNKNPVWNEEFEFDVKDQ 936

Query: 442  VNEDSLCLEVWDFD 483
               D L + V D+D
Sbjct: 937  -KSDVLYVTVMDWD 949



 Score = 45.2 bits (102), Expect = 8e-04
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 1/77 (1%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS-LPM 432
           ++L+V VV A DL   D NG +DPF  + + +     Y T V     NP W + F+ +P+
Sbjct: 386 IVLDVTVVNAKDLPMMDANGKADPFCVLTI-NGEGKEYKTDVIKKNKNPEWNQSFNGIPI 444

Query: 433 SGTVNEDSLCLEVWDFD 483
           +   ++D L +  +D+D
Sbjct: 445 ADK-SKDKLHITCYDWD 460



 Score = 44.0 bits (99), Expect = 0.002
 Identities = 24/74 (32%), Positives = 39/74 (52%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L + ++   +L P D NG +DP+  + + S+S     T +    LNPVW E F++    +
Sbjct: 8   LEITILSGQNLTPTDVNGKADPYCNLKVSSHSKGD-KTKIIENDLNPVWNETFTIKKVDS 66

Query: 442 VNEDSLCLEVWDFD 483
             +D L L+V D D
Sbjct: 67  -EKDYLELKVMDDD 79



 Score = 40.7 bits (91), Expect = 0.018
 Identities = 23/74 (31%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L V V++A DL   D +   DP+  + L ++    Y T V      P W + FS+P+   
Sbjct: 1044 LEVIVIDAKDLPVMDIDMSCDPYCVLKL-NDEGEEYKTDVIENDRTPAWNKDFSIPIKDK 1102

Query: 442  VNEDSLCLEVWDFD 483
             + D L ++V+D D
Sbjct: 1103 -DSDVLHIKVYDHD 1115


>UniRef50_Q8N9I0 Cluster: Synaptotagmin-2; n=18; Tetrapoda|Rep:
           Synaptotagmin-2 - Homo sapiens (Human)
          Length = 419

 Score = 52.0 bits (119), Expect = 7e-06
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A +L   D  G SDP+V ++L+ +   +Y T V   TLNP + E F+  +   
Sbjct: 156 LTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQ 215

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + ++DFD
Sbjct: 216 ELGGKTLVMAIYDFD 230



 Score = 50.0 bits (114), Expect = 3e-05
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I+LM N     +  T+VK  TLNP + E FS  + 
Sbjct: 287 LTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIP 346

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  + + V D+D
Sbjct: 347 FEQIQKVQVVVTVLDYD 363


>UniRef50_A6SCP3 Cluster: Putative uncharacterized protein; n=2;
            Sclerotiniaceae|Rep: Putative uncharacterized protein -
            Botryotinia fuckeliana B05.10
          Length = 1489

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L V+V++A+DL   D NG SDP+       NS   + T V+  TL+P W E F L +   
Sbjct: 1082 LRVDVLDASDLPSADRNGYSDPYCKFEFNGNSV--FKTKVQKKTLHPAWNEFFELDVPSR 1139

Query: 442  VNEDSLC-LEVWDF 480
               + +C +  WDF
Sbjct: 1140 TAANFICNVMDWDF 1153


>UniRef50_UPI0000D55D8D Cluster: PREDICTED: similar to synaptotagmin
           10; n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           synaptotagmin 10 - Tribolium castaneum
          Length = 485

 Score = 51.2 bits (117), Expect = 1e-05
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEH--FSLPMS 435
           L V V E  DL  KD  G SDP++ +YL+ +   ++ T V    LNPV+ E   FS+P  
Sbjct: 212 LVVRVFEGRDLPIKDSTGSSDPYIKLYLLPDRKKKFQTKVHRKNLNPVFNETFIFSVPYE 271

Query: 436 GTVNEDSLCLEVWDFD 483
             + +  L   V+DFD
Sbjct: 272 -ELRQRYLQFSVYDFD 286



 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L + +++   L   D  G SDP+V +YL+       +  TSVK  TLNPV+ E   F +P
Sbjct: 344 LTITIIKGRSLKAMDITGKSDPYVKVYLLCQGKRIKKKKTSVKKNTLNPVYNEALVFDVP 403

Query: 430 MSGTVNEDSLCLEVWDFD 483
            +  + + SL ++V D+D
Sbjct: 404 -AENIEDVSLIVKVIDYD 420


>UniRef50_Q4S9W0 Cluster: Chromosome undetermined SCAF14694, whole
           genome shotgun sequence; n=4; Clupeocephala|Rep:
           Chromosome undetermined SCAF14694, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 874

 Score = 51.2 bits (117), Expect = 1e-05
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS----SHRYNTSVKSGTLNPVWEEHFSLP 429
           L++EV+ A DL+P D NGLSDPFV + L  N         +T VKS  LNP+++E F   
Sbjct: 710 LHIEVLNAVDLLPMDSNGLSDPFVQLTLEPNHVFPVVETRSTQVKSCDLNPLFDEVFEFM 769

Query: 430 MS 435
           +S
Sbjct: 770 VS 771


>UniRef50_A7EYQ9 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1035

 Score = 51.2 bits (117), Expect = 1e-05
 Identities = 32/88 (36%), Positives = 45/88 (51%)
 Frame = +1

Query: 220 TSYQSGG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLN 399
           +S    G +A+GL+L V V++A +L  KD +G SDP++ + L    S    T     TLN
Sbjct: 49  SSPDGNGVKANGLILKVVVLKARNLAAKDKSGTSDPYLVLTLGDEKS---TTHTIQKTLN 105

Query: 400 PVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           P W     LP++G  N   L    WD D
Sbjct: 106 PEWNVILQLPVTGP-NSLLLDCVCWDKD 132


>UniRef50_UPI0000E481BD Cluster: PREDICTED: similar to Transmembrane
           protein 24, partial; n=3; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to Transmembrane
           protein 24, partial - Strongylocentrotus purpuratus
          Length = 345

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 26/72 (36%), Positives = 39/72 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V+V++A  L+ +     SDP+  I ++ +   RY T+    T NP W+EHF   ++G 
Sbjct: 129 LLVKVIKANGLLVRSGGSSSDPYC-IAMLDHPPQRYKTNTIVNTTNPFWDEHFLFQLNG- 186

Query: 442 VNEDSLCLEVWD 477
            N   L  EVWD
Sbjct: 187 -NSRELRFEVWD 197


>UniRef50_Q9LEX1 Cluster: CaLB protein; n=9; Magnoliophyta|Rep: CaLB
           protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 510

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 30/74 (40%), Positives = 42/74 (56%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V VV+AT+L  K+  G SDP+ TIY+      +Y T      LNPVW++ F L ++  
Sbjct: 265 LIVTVVKATNLKNKELIGKSDPYATIYI--RPVFKYKTKAIENNLNPVWDQTFEL-IAED 321

Query: 442 VNEDSLCLEVWDFD 483
               SL +EV+D D
Sbjct: 322 KETQSLTVEVFDKD 335


>UniRef50_A2D7F1 Cluster: C2 domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: C2 domain containing
           protein - Trichomonas vaginalis G3
          Length = 134

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 29/76 (38%), Positives = 39/76 (51%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           + LN++++EA ++   D  G  D +V +      S RY T VK  TLNPVW E F  P+ 
Sbjct: 1   MQLNIKIIEAKNVPKMDIIGSCDAYVALTF---GSKRYKTGVKENTLNPVWNETFQFPIQ 57

Query: 436 GTVNEDSLCLEVWDFD 483
                D L L V D D
Sbjct: 58  N--QNDILTLIVSDRD 71


>UniRef50_Q6C3Y8 Cluster: Similar to wi|NCU03263.1 Neurospora crassa
            NCU03263.1; n=1; Yarrowia lipolytica|Rep: Similar to
            wi|NCU03263.1 Neurospora crassa NCU03263.1 - Yarrowia
            lipolytica (Candida lipolytica)
          Length = 1895

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 38/74 (51%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L V V++A DL   D +G SDP+    L       + T  +  TL+PVW E F + +S  
Sbjct: 1334 LKVSVLDAHDLPAADRSGKSDPYAVFDL--EGKRVFKTKTQKKTLDPVWNEFFEMAISSL 1391

Query: 442  VNEDSLCLEVWDFD 483
            +  D   + VWD+D
Sbjct: 1392 IKAD-FTVNVWDWD 1404



 Score = 34.3 bits (75), Expect = 1.5
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
            +L   +++ATDL   +  G  DP+V I  +     R  T   +  L+PVW+E+   P+
Sbjct: 879  VLRFHIIKATDLRNLETVGKVDPYVRI--LVGGYARCRTRTITANLDPVWDEYIYAPV 934


>UniRef50_A0JJX1 Cluster: NtermTM-C2Type1.2 protein; n=2;
           Physcomitrella patens|Rep: NtermTM-C2Type1.2 protein -
           Physcomitrella patens (Moss)
          Length = 538

 Score = 50.4 bits (115), Expect = 2e-05
 Identities = 27/75 (36%), Positives = 45/75 (60%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ++ V+++ AT+L+ KD  G +DP+V I L+ N+     T  K  TLNP W + F L +  
Sbjct: 261 VVEVKIIRATNLMKKDFMGKADPYVKIQLV-NTMLSKTTRAKMNTLNPEWNQTFKLSVQ- 318

Query: 439 TVNEDSLCLEVWDFD 483
            +   SL L+V+D++
Sbjct: 319 DLKSQSLELQVFDWE 333


>UniRef50_Q66KE5 Cluster: MGC86555 protein; n=9; Euteleostomi|Rep:
           MGC86555 protein - Xenopus laevis (African clawed frog)
          Length = 396

 Score = 50.0 bits (114), Expect = 3e-05
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V + +A  L   D  G SDP+  +Y+ +++  +Y T V   TLNPV+ E F   ++  
Sbjct: 122 LTVSIKQAASLKAMDLGGTSDPYAIVYVSNDTRKKYETKVNRKTLNPVFNESFVFKVTQE 181

Query: 439 TVNEDSLCLEVWDFD 483
            V+  +  ++++DF+
Sbjct: 182 EVSRTTAVVQIYDFN 196


>UniRef50_A7TNP3 Cluster: Putative uncharacterized protein; n=1;
            Vanderwaltozyma polyspora DSM 70294|Rep: Putative
            uncharacterized protein - Vanderwaltozyma polyspora DSM
            70294
          Length = 1482

 Score = 50.0 bits (114), Expect = 3e-05
 Identities = 26/77 (33%), Positives = 42/77 (54%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ML + ++  T+L+  D NG SDP+V I +  N+   + T +   TLNPVW E   +P+  
Sbjct: 1106 MLKLGIISGTNLLASDRNGKSDPYVDILV--NNHKVFTTEIIKKTLNPVWNETAMIPIPS 1163

Query: 439  TVNEDSLCLEVWDFDPA 489
                  +  +V+D+D A
Sbjct: 1164 R-KYTKIIADVYDWDRA 1179


>UniRef50_UPI0000E47252 Cluster: PREDICTED: similar to
           ENSANGP00000010096; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to ENSANGP00000010096
           - Strongylocentrotus purpuratus
          Length = 347

 Score = 49.6 bits (113), Expect = 4e-05
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 2/74 (2%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTS-VKSGTLNPVWEEHFSLPMS-GT 441
           ++VVEA  L   D  G SDP+V I L  +   +   S V+  TLNPVW E F  P +   
Sbjct: 188 IKVVEADHLPAMDIGGSSDPYVKISLEPDEERKIKQSVVQRRTLNPVWNEIFKFPTTYEE 247

Query: 442 VNEDSLCLEVWDFD 483
           + E ++   V+DFD
Sbjct: 248 LQEKTVRFSVFDFD 261


>UniRef50_Q4RUZ4 Cluster: Chromosome 12 SCAF14993, whole genome
            shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 12
            SCAF14993, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1978

 Score = 49.6 bits (113), Expect = 4e-05
 Identities = 28/72 (38%), Positives = 36/72 (50%)
 Frame = +1

Query: 268  VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
            + VV A  L  KD  G SDP+VTI +      +  T    G LNP+WEE F+       +
Sbjct: 862  INVVSAQGLQAKDRTGSSDPYVTIQV---GKTKKRTKTIYGNLNPIWEEKFNFECHN--S 916

Query: 448  EDSLCLEVWDFD 483
             D + L VWD D
Sbjct: 917  SDRIKLRVWDED 928


>UniRef50_Q259Q9 Cluster: Glutathione peroxidase; n=5;
           Magnoliophyta|Rep: Glutathione peroxidase - Oryza sativa
           (Rice)
          Length = 1063

 Score = 49.6 bits (113), Expect = 4e-05
 Identities = 27/74 (36%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L VEV  A DL+PKD  G +   V +        R+ T++K   LNPVW E F   +S  
Sbjct: 6   LGVEVASAHDLMPKDGQGSASACVELTF---DGQRFRTAIKDKDLNPVWNERFYFNVSDP 62

Query: 442 VNEDSLCLEVWDFD 483
            N   L LE + ++
Sbjct: 63  SNLPELALEAYVYN 76


>UniRef50_Q7RUV0 Cluster: Putative uncharacterized protein B14D6.520;
            n=5; Pezizomycotina|Rep: Putative uncharacterized protein
            B14D6.520 - Neurospora crassa
          Length = 1421

 Score = 49.6 bits (113), Expect = 4e-05
 Identities = 25/80 (31%), Positives = 40/80 (50%)
 Frame = +1

Query: 244  RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
            +A   +  +++VEA DL   DP G SDP+V +           T +    LNP W+E   
Sbjct: 913  KAGKYVFTIKIVEAEDLKACDPGGYSDPYV-VLCDEYQKRLAKTRIIMRNLNPRWDESID 971

Query: 424  LPMSGTVNEDSLCLEVWDFD 483
            + +SG +N   +   +WD+D
Sbjct: 972  ITVSGPLN---IIATIWDYD 988


>UniRef50_A4RHF5 Cluster: Putative uncharacterized protein; n=2;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 1138

 Score = 49.6 bits (113), Expect = 4e-05
 Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 2/84 (2%)
 Frame = +1

Query: 238 G*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEH 417
           G R +GL+LN+ ++   +L  KD +G SDP++   +++    ++ T+  S +LNP W E 
Sbjct: 41  GRRETGLVLNIVILRGRNLAAKDRSGTSDPYL---VLNCGDSKHVTATVSKSLNPEWNEQ 97

Query: 418 FSLPMSGTVNEDSLCLEV--WDFD 483
              P++G      L L+V  WD D
Sbjct: 98  CEFPINGA---QHLLLDVCAWDKD 118


>UniRef50_Q03640 Cluster: Tricalbin-3; n=2; Saccharomyces
            cerevisiae|Rep: Tricalbin-3 - Saccharomyces cerevisiae
            (Baker's yeast)
          Length = 1545

 Score = 49.6 bits (113), Expect = 4e-05
 Identities = 25/76 (32%), Positives = 43/76 (56%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            LN++++    L   D NG SDPFV I++  N    + +++K  TL+PVW E   +P+   
Sbjct: 1136 LNIKLISGHGLKSADRNGYSDPFVHIFV--NDKKVFKSNIKKKTLDPVWNEDAKIPILSR 1193

Query: 442  VNEDSLCLEVWDFDPA 489
             +++ +   V D+D A
Sbjct: 1194 -SKNQVIFNVLDWDRA 1208


>UniRef50_Q1EC12 Cluster: IP11216p; n=5; Endopterygota|Rep: IP11216p
           - Drosophila melanogaster (Fruit fly)
          Length = 316

 Score = 49.2 bits (112), Expect = 5e-05
 Identities = 27/76 (35%), Positives = 41/76 (53%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L L V +   +DLV  D NGLSDP+V   +     H+  T  +   LNPVW+E F +P+ 
Sbjct: 41  LQLRVHLKSGSDLVAMDKNGLSDPYVKFKVGGRLLHKSRTIHRD--LNPVWDEVFIVPIE 98

Query: 436 GTVNEDSLCLEVWDFD 483
                  + ++V+D+D
Sbjct: 99  DPF--QPIIVKVFDYD 112


>UniRef50_A7RQE8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 767

 Score = 49.2 bits (112), Expect = 5e-05
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 4/81 (4%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKD----PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           +L V+VVEA DLV KD      G SDP+  + +    + ++ T VK   LNP W E F  
Sbjct: 296 VLRVKVVEARDLVAKDFGVVKKGKSDPYAILEI---GAQKFRTKVKKNDLNPTWNETFEA 352

Query: 427 PMSGTVNEDSLCLEVWDFDPA 489
            +  +  +D + + +WD D A
Sbjct: 353 FVDNSEGQD-IDMFLWDEDKA 372


>UniRef50_A2EZF8 Cluster: C2 domain containing protein; n=2;
           Trichomonas vaginalis G3|Rep: C2 domain containing
           protein - Trichomonas vaginalis G3
          Length = 338

 Score = 49.2 bits (112), Expect = 5e-05
 Identities = 26/55 (47%), Positives = 33/55 (60%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           L+L+V VV+ATDL   D NG S P+V + L  N+S  + T V   T NP W E F
Sbjct: 242 LLLDVTVVKATDLASMDLNGRSGPYVVLSL--NNSEDFKTEVVKKTKNPKWNETF 294


>UniRef50_A2QU82 Cluster: Catalytic activity: Phosphatidyl-L-serine
           = Phosphatidylethanolamine + CO2; n=1; Aspergillus
           niger|Rep: Catalytic activity: Phosphatidyl-L-serine =
           Phosphatidylethanolamine + CO2 - Aspergillus niger
          Length = 1036

 Score = 49.2 bits (112), Expect = 5e-05
 Identities = 27/76 (35%), Positives = 37/76 (48%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+L V V+   DL  KD  G SDP++ + L      R +T     TLNP W   F +P+ 
Sbjct: 40  LILKVSVIRGRDLAAKDRGGTSDPYLVVTL---GDARQSTPTIPKTLNPEWNVTFEMPVV 96

Query: 436 GTVNEDSLCLEVWDFD 483
           G    + +C   WD D
Sbjct: 97  GVPLLECIC---WDHD 109


>UniRef50_Q9UT00 Cluster: Uncharacterized protein PYUK71.03c; n=2;
            Schizosaccharomyces pombe|Rep: Uncharacterized protein
            PYUK71.03c - Schizosaccharomyces pombe (Fission yeast)
          Length = 1225

 Score = 49.2 bits (112), Expect = 5e-05
 Identities = 30/75 (40%), Positives = 37/75 (49%), Gaps = 2/75 (2%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF--SLPMS 435
            + V+V++ATDL   D NG SDPFV   L       Y T     TLNP + E F   LP  
Sbjct: 1039 MTVDVIKATDLPAADSNGKSDPFVVFELQGEEV--YRTKTHKRTLNPTFNESFEVELPCK 1096

Query: 436  GTVNEDSLCLEVWDF 480
             T N  +   + WDF
Sbjct: 1097 QTCNFVANVFD-WDF 1110



 Score = 32.3 bits (70), Expect = 6.2
 Identities = 18/74 (24%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + +  A +L  K P    D +  I  MS+++ ++ T V +  +NP W+E+   P+   
Sbjct: 706 IRIHLRSANNLHSKIPGKKCDSYARI--MSHNTKQFRTVVIASNVNPFWDEYMYAPV--I 761

Query: 442 VNEDSLCLEVWDFD 483
              D   L+V +++
Sbjct: 762 TKHDIFFLQVMNYN 775


>UniRef50_Q12466 Cluster: Tricalbin-1; n=6; Saccharomycetaceae|Rep:
            Tricalbin-1 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 1186

 Score = 49.2 bits (112), Expect = 5e-05
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +1

Query: 283  ATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLC 462
            A +L+  D NG SDP++  Y+ +     Y T V   TLNP W +  ++ ++  +N D L 
Sbjct: 1001 AENLIASDLNGYSDPYLKYYINNEEDCAYKTKVVKKTLNPKWNDEGTIQINNRLN-DVLR 1059

Query: 463  LEVWDFD 483
            ++V D+D
Sbjct: 1060 IKVMDWD 1066



 Score = 32.3 bits (70), Expect = 6.2
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V + +A DL   +  G  DP+  + +   S  R  T  KS TLNPVW +   + ++  
Sbjct: 660 IRVFIEKANDLRNLEKFGTIDPYCKVLVNGLSKGR--TDFKSQTLNPVWNQVIYVAVTSP 717

Query: 442 VNEDSL-CLEV 471
               +L C++V
Sbjct: 718 NQRITLQCMDV 728


>UniRef50_O00445 Cluster: Synaptotagmin-5; n=35; Bilateria|Rep:
           Synaptotagmin-5 - Homo sapiens (Human)
          Length = 386

 Score = 49.2 bits (112), Expect = 5e-05
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           SG +L V +++A  L   D  G SDP+V +YL+ +   RY T V   TLNP + E F+  
Sbjct: 122 SGQLL-VGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFK 180

Query: 430 MSGT-VNEDSLCLEVWDFD 483
           +    +    L + V+DFD
Sbjct: 181 VPYVELGGRVLVMAVYDFD 199



 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPM- 432
           L V V+EA +L   D  GLSDP+V ++L+       +  T++K  TLNP + E FS  + 
Sbjct: 256 LTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVP 315

Query: 433 SGTVNEDSLCLEVWDFD 483
              V +  + L V D+D
Sbjct: 316 CDQVQKVQVELTVLDYD 332


>UniRef50_UPI00015B587F Cluster: PREDICTED: similar to GA15723-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           GA15723-PA - Nasonia vitripennis
          Length = 727

 Score = 48.8 bits (111), Expect = 7e-05
 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN-SSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           LNV ++EA +L   D  G +DP+V + L     + +  T +     NPV+++ F  P+S 
Sbjct: 462 LNVHLIEANELAGSDAGGFNDPYVKLSLSPEVDARKRQTPIHRNEPNPVFDQQFKFPVSH 521

Query: 439 TVNED-SLCLEVWDFD 483
              +D +L L+V D+D
Sbjct: 522 EELQDRTLLLQVLDYD 537


>UniRef50_UPI0000E81A79 Cluster: PREDICTED: hypothetical protein
           LOC431454; n=2; Gallus gallus|Rep: PREDICTED:
           hypothetical protein LOC431454 - Gallus gallus
          Length = 189

 Score = 48.8 bits (111), Expect = 7e-05
 Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +1

Query: 289 DLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDS-LCL 465
           DL P+DP+G SDPFV +   S   H   T+V   T  P W+E     ++     DS L +
Sbjct: 77  DLAPRDPSGTSDPFVRV---SCCGHTQETAVIKKTRFPHWDEVLEFELAQDEPGDSMLSV 133

Query: 466 EVWDFD 483
           EVWD+D
Sbjct: 134 EVWDWD 139


>UniRef50_UPI00005A11E3 Cluster: PREDICTED: similar to
           BAI1-associated protein 3; n=1; Canis lupus
           familiaris|Rep: PREDICTED: similar to BAI1-associated
           protein 3 - Canis familiaris
          Length = 1092

 Score = 48.8 bits (111), Expect = 7e-05
 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 28/108 (25%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM----------SNSSHRYN------- 372
           +A    L V VV A +L+ KDPNG SDP+  + ++          S+   R++       
Sbjct: 156 KAPTYALKVSVVRAKNLLAKDPNGFSDPYCMLGILPASGTPREPGSHKEQRFSFRKGSKR 215

Query: 373 -----------TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
                      T VKS TLNPVW+E+F   +   V+ D L L++WD D
Sbjct: 216 GGPLPAKCIQVTEVKSSTLNPVWKENFLFEIE-DVSMDQLHLDIWDHD 262



 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 29/62 (46%), Positives = 37/62 (59%), Gaps = 6/62 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEE--HFS 423
            L VEV+ A DL   D NGLSDPFV + L    +        T VKS TL+PV++E  +FS
Sbjct: 932  LVVEVLHAADLPALDANGLSDPFVIVELGPPHLFPLVRSQRTQVKSRTLHPVYDELFYFS 991

Query: 424  LP 429
            +P
Sbjct: 992  VP 993


>UniRef50_A4S8P5 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 117

 Score = 48.8 bits (111), Expect = 7e-05
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 3/78 (3%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYL--MSNSSHRYN-TSVKSGTLNPVWEEHFSLP 429
           ML V+VV A  +   D +GLSDP+V + L  ++ S+ +   T     TL+PVW E F   
Sbjct: 19  MLRVKVVSAHGIKGSDLSGLSDPYVVVKLHRVNESTAKIKATETVKKTLDPVWNETFEFE 78

Query: 430 MSGTVNEDSLCLEVWDFD 483
                +E  +  E+WD D
Sbjct: 79  RVDRGSESYVTFELWDHD 96


>UniRef50_A2FRX6 Cluster: C2 domain containing protein; n=5;
           Trichomonas vaginalis G3|Rep: C2 domain containing
           protein - Trichomonas vaginalis G3
          Length = 259

 Score = 48.8 bits (111), Expect = 7e-05
 Identities = 23/59 (38%), Positives = 35/59 (59%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           + L++ VVEA D+  +D  G  DP+V I++    S  Y T V   T NPVW E +++P+
Sbjct: 1   MQLHIRVVEARDMPKEDAFGKCDPYVEIHV---GSTLYKTRVCKNTYNPVWNESYTIPL 56


>UniRef50_Q9UUY6 Cluster: Transmembrane protein; n=3;
            Pezizomycotina|Rep: Transmembrane protein - Erysiphe pisi
            (Pea powdery mildew)
          Length = 1475

 Score = 48.8 bits (111), Expect = 7e-05
 Identities = 28/74 (37%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP-MSG 438
            L V+V++A+ L   D NG SDPF    L  N    + T V+  TL+PVW E F +  +S 
Sbjct: 1077 LRVDVLDASHLPSADRNGYSDPFCRFEL--NGKDIFKTKVQKKTLHPVWNEFFEVDIVSR 1134

Query: 439  TVNEDSLCLEVWDF 480
            T  +    +  WDF
Sbjct: 1135 TAAQFKCTVFDWDF 1148


>UniRef50_Q8NB66 Cluster: Protein unc-13 homolog C; n=28;
            Euteleostomi|Rep: Protein unc-13 homolog C - Homo sapiens
            (Human)
          Length = 2214

 Score = 48.8 bits (111), Expect = 7e-05
 Identities = 27/74 (36%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + VV A  L  KD  G SDP+VT+ +  N   +  T    G LNPVW+E F      +
Sbjct: 1222 ITITVVSAQGLQAKDKTGSSDPYVTVQVGKN---KRRTKTIFGNLNPVWDEKFYFECHNS 1278

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 1279 T--DRIKVRVWDED 1290


>UniRef50_Q9NZM3 Cluster: Intersectin-2; n=40; Euteleostomi|Rep:
            Intersectin-2 - Homo sapiens (Human)
          Length = 1696

 Score = 48.8 bits (111), Expect = 7e-05
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 223  SYQSGG*RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLN 399
            +YQ+   + SG+  L V V+EAT+L    PNG S+P+  I   S  S  Y T     TLN
Sbjct: 1556 AYQARSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEI---SMGSQSYTTRTIQDTLN 1612

Query: 400  PVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
            P W  +    +   + +D LCL ++D D
Sbjct: 1613 PKWNFNCQFFIK-DLYQDVLCLTLFDRD 1639


>UniRef50_UPI0000F1E4F7 Cluster: PREDICTED: similar to Multiple C2
           domains, transmembrane 2; n=1; Danio rerio|Rep:
           PREDICTED: similar to Multiple C2 domains, transmembrane
           2 - Danio rerio
          Length = 796

 Score = 48.4 bits (110), Expect = 9e-05
 Identities = 32/74 (43%), Positives = 44/74 (59%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V+V++ATDL+  D NG SDPF  + L  NS  + +T  K  TLNP W + F+ P+   
Sbjct: 459 LQVKVIKATDLISADLNGKSDPFCVLEL-GNSRLQTHTIYK--TLNPEWNKVFTFPVK-D 514

Query: 442 VNEDSLCLEVWDFD 483
           ++E    LEV  FD
Sbjct: 515 IHE---VLEVTVFD 525


>UniRef50_UPI000069E2B8 Cluster: Fer-1-like 4 (C. elegans); n=5;
            Xenopus tropicalis|Rep: Fer-1-like 4 (C. elegans) -
            Xenopus tropicalis
          Length = 1750

 Score = 48.4 bits (110), Expect = 9e-05
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 3/79 (3%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYL---MSNSSHRYNTSVKSGTLNPVWEEHFSL 426
            +++ + +V+AT+L P DPNG +DP+V + +     NS  RY        LNPV+ E F +
Sbjct: 1247 VLVRIYIVKATELSPTDPNGKADPYVVVKVGEQEKNSKERYIPK----QLNPVFGEVFEM 1302

Query: 427  PMSGTVNEDSLCLEVWDFD 483
             +S  + E  L ++V+D D
Sbjct: 1303 TISFPI-ETELLIQVFDHD 1320



 Score = 37.1 bits (82), Expect = 0.22
 Identities = 18/51 (35%), Positives = 26/51 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L   + +A  ++P D NGLSDPF  +      +    T V + TL P+W E
Sbjct: 820 LRAHLYQARGILPADDNGLSDPFARVVF---GNQCLTTQVMNETLAPMWNE 867


>UniRef50_Q9VUJ3 Cluster: CG3020-PA; n=3; Sophophora|Rep: CG3020-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 602

 Score = 48.4 bits (110), Expect = 9e-05
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN-SSHRYNTSVKSGTLNPVWEEHFSLPMS- 435
           L V ++EA +L P +  G  DP+V + L     S +  T +  G  NP +++HF  P+S 
Sbjct: 357 LTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIHRGESNPYFDQHFKFPVSR 416

Query: 436 GTVNEDSLCLEVWDFD 483
             +    L L+V D+D
Sbjct: 417 DQLQGKELILQVLDYD 432


>UniRef50_A2DBY2 Cluster: XYPPX repeat family protein; n=1;
           Trichomonas vaginalis G3|Rep: XYPPX repeat family
           protein - Trichomonas vaginalis G3
          Length = 383

 Score = 48.4 bits (110), Expect = 9e-05
 Identities = 23/57 (40%), Positives = 33/57 (57%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           LN+ V+EA D+  +D  G  DPF+ IY+  ++ H   T     T NP W+E F LP+
Sbjct: 3   LNLRVIEAKDMPKEDLFGKCDPFIEIYI--DNKHVKKTKYVKNTYNPRWDETFYLPL 57


>UniRef50_Q6BUH3 Cluster: Similar to tr|Q12466 Saccharomyces
            cerevisiae YOR086C; n=6; Saccharomycetales|Rep: Similar
            to tr|Q12466 Saccharomyces cerevisiae YOR086C -
            Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 1201

 Score = 48.4 bits (110), Expect = 9e-05
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 1/77 (1%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++++EV  A +L+  D NG SDP+V +YL ++    + T     TL PVW+E  S  ++ 
Sbjct: 1010 VVSIEVSNAENLISADRNGKSDPYVALYLNTDKDSFFKTKKIKRTLEPVWKETGSTKVAN 1069

Query: 439  TVNE-DSLCLEVWDFDP 486
              +    +    WD  P
Sbjct: 1070 MYDSVVKVVCNDWDIGP 1086



 Score = 33.9 bits (74), Expect = 2.0
 Identities = 21/75 (28%), Positives = 33/75 (44%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ++ + +  A D+   +  G  DP+  +  M N   R  T+    TLNP W E   + +S 
Sbjct: 666 VVRISIDRAEDIRNLERIGKVDPYARV--MVNGFQRCRTAAADSTLNPTWNEIHYVTVSS 723

Query: 439 TVNEDSLCLEVWDFD 483
                 L LEV D +
Sbjct: 724 A--NQKLTLEVMDVE 736


>UniRef50_O14795 Cluster: Protein unc-13 homolog B; n=48;
           Eumetazoa|Rep: Protein unc-13 homolog B - Homo sapiens
           (Human)
          Length = 1591

 Score = 48.4 bits (110), Expect = 9e-05
 Identities = 28/74 (37%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +   S  +  T    G LNPVWEE F       
Sbjct: 602 ITITVVCAQGLQAKDKTGSSDPYVTVQV---SKTKKRTKTIFGNLNPVWEEKFHFECHN- 657

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 658 -SSDRIKVRVWDED 670


>UniRef50_Q14183 Cluster: Double C2-like domain-containing protein
           alpha; n=35; Euteleostomi|Rep: Double C2-like
           domain-containing protein alpha - Homo sapiens (Human)
          Length = 400

 Score = 48.4 bits (110), Expect = 9e-05
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+  ++ A  L P D NGL+DP+V ++L+  +  +++  T  +  TLNPVW E   L  S
Sbjct: 106 LHCSILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNE--DLTYS 163

Query: 436 GTVNED 453
           G  ++D
Sbjct: 164 GITDDD 169


>UniRef50_UPI000155C669 Cluster: PREDICTED: similar to munc 13-1;
           n=2; Mammalia|Rep: PREDICTED: similar to munc 13-1 -
           Ornithorhynchus anatinus
          Length = 964

 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 27/74 (36%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           +++ VV A  L  KD  G SDP+VT+ +      +  T    G LNPVWEE+F       
Sbjct: 700 ISITVVCAQGLQAKDKTGSSDPYVTVQV---GKTKKRTKTIYGNLNPVWEENFHFECHN- 755

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 756 -SSDRIKVRVWDED 768


>UniRef50_Q4SUJ8 Cluster: Chromosome undetermined SCAF13899, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF13899, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 462

 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 2/72 (2%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEH 417
           +A G   ++ V +A  L P D NGL+DP+V ++L+  +  +++  T     TLNPVW E 
Sbjct: 153 QALGFCRDMIVTDAAGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTVRNTLNPVWNE- 211

Query: 418 FSLPMSGTVNED 453
            +L   G   ED
Sbjct: 212 -TLTYCGITEED 222


>UniRef50_A2F388 Cluster: C2 domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: C2 domain containing
           protein - Trichomonas vaginalis G3
          Length = 846

 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 3/78 (3%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIY-LMSNSSHRYN-TSVKSGTLNPVWEEHFSLPM 432
           ML   V +AT L   D NG SDPF  +Y ++ +  +++  T +    LNPVW+E+  +P 
Sbjct: 1   MLTAYVQKATGLPVADSNGYSDPFCMLYGVVGSYFYQFGETKIIERNLNPVWDENCQIPF 60

Query: 433 S-GTVNEDSLCLEVWDFD 483
                    L ++VWD D
Sbjct: 61  HISFARISKLRVDVWDHD 78


>UniRef50_Q4WAM6 Cluster: Membrane bound C2 domain protein (Vp115),
            putative; n=11; Pezizomycotina|Rep: Membrane bound C2
            domain protein (Vp115), putative - Aspergillus fumigatus
            (Sartorya fumigata)
          Length = 1538

 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 24/74 (32%), Positives = 39/74 (52%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L V V++A +L   D NG SDP+    L  +    + T V+  TL+P W E F +P+   
Sbjct: 1136 LRVNVLDAAELPSADRNGFSDPYCKFRL--DDKEVFKTKVQKKTLHPAWNEFFEVPIKSR 1193

Query: 442  VNEDSLCLEVWDFD 483
            +      ++V+D+D
Sbjct: 1194 IGA-KFRVDVYDWD 1206



 Score = 34.3 bits (75), Expect = 1.5
 Identities = 23/65 (35%), Positives = 31/65 (47%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLC 462
           ATDL   +  G SDP+V + L   +  R  T      LNP W+E   +P+      + L 
Sbjct: 768 ATDLRNLEKMGKSDPYVRVLLSGITKGR--TVTFRNNLNPEWDEVVYVPIHSA--REKLT 823

Query: 463 LEVWD 477
           LEV D
Sbjct: 824 LEVMD 828


>UniRef50_Q2UC55 Cluster: Phosphatidylserine decarboxylase; n=5;
           Pezizomycotina|Rep: Phosphatidylserine decarboxylase -
           Aspergillus oryzae
          Length = 1097

 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 28/79 (35%), Positives = 39/79 (49%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A  L+L V V+    L  KD NG SDP++ + L      R +T +   TLNP W   F +
Sbjct: 37  AKPLVLKVVVLRGRCLAAKDRNGTSDPYLVVTL---GDARQSTPMVPKTLNPEWNVTFEM 93

Query: 427 PMSGTVNEDSLCLEVWDFD 483
           P+ G    + +C   WD D
Sbjct: 94  PIVGVPLLECIC---WDHD 109


>UniRef50_A4RK65 Cluster: Putative uncharacterized protein; n=1;
            Magnaporthe grisea|Rep: Putative uncharacterized protein
            - Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 1392

 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 38/80 (47%)
 Frame = +1

Query: 244  RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
            + S     +++VEA DL   DP G SDP+V +           T +    LNP W+E   
Sbjct: 929  KTSRYTFTIKIVEAEDLKACDPTGTSDPYV-VLCDEYQKRLAKTRIVMRNLNPRWDESVD 987

Query: 424  LPMSGTVNEDSLCLEVWDFD 483
            + + G +N   L   +WD+D
Sbjct: 988  IDVQGPLN---LIATIWDYD 1004


>UniRef50_Q9UPW8 Cluster: Protein unc-13 homolog A; n=15;
           Euteleostomi|Rep: Protein unc-13 homolog A - Homo
           sapiens (Human)
          Length = 1703

 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 27/74 (36%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           +++ VV A  L  KD  G SDP+VT+ +      +  T    G LNPVWEE+F       
Sbjct: 678 ISITVVCAQGLQAKDKTGSSDPYVTVQV---GKTKKRTKTIYGNLNPVWEENFHFECHN- 733

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 734 -SSDRIKVRVWDED 746


>UniRef50_Q4T435 Cluster: Chromosome undetermined SCAF9838, whole
           genome shotgun sequence; n=4; Clupeocephala|Rep:
           Chromosome undetermined SCAF9838, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 118

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 24/63 (38%), Positives = 34/63 (53%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V V++AT L PK  N  +D +  I +      +Y+TSV   TLNPVW E  S  + G 
Sbjct: 15  VQVTVLQATSLQPKGKNSTNDAYTIIQM---GKEKYSTSVAEKTLNPVWREEASFELPGL 71

Query: 442 VNE 450
           + E
Sbjct: 72  LME 74


>UniRef50_Q0E927 Cluster: CG15078-PC, isoform C; n=7; Diptera|Rep:
           CG15078-PC, isoform C - Drosophila melanogaster (Fruit
           fly)
          Length = 940

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 26/74 (35%), Positives = 40/74 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V +   +DLV  D NGLSDP+V   +     H+  T  +   LNPVW+E F +P+   
Sbjct: 255 LRVHLKSGSDLVAMDKNGLSDPYVKFKVGGRLLHKSRTIHRD--LNPVWDEVFIVPIEDP 312

Query: 442 VNEDSLCLEVWDFD 483
                + ++V+D+D
Sbjct: 313 F--QPIIVKVFDYD 324


>UniRef50_A7RQE7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 758

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIY-LMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           +L VEV+EA DL+  D   LS P    Y ++   + +Y T  K    +PVW+E F   + 
Sbjct: 287 VLRVEVIEAKDLIAADMALLSKPTSDPYCIVEVGAQKYRTKTKKSNCDPVWKETFEAFID 346

Query: 436 GTVNEDSLCLEVWDFDPA 489
            T  ++  C +V+D D A
Sbjct: 347 NTEGQELFC-KVYDEDIA 363


>UniRef50_A2EVN2 Cluster: XYPPX repeat family protein; n=1;
           Trichomonas vaginalis G3|Rep: XYPPX repeat family
           protein - Trichomonas vaginalis G3
          Length = 231

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 23/58 (39%), Positives = 34/58 (58%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+V+V+EA +L   D  G SDP+  + L S ++    T  K  T +P W E FSLP++
Sbjct: 5   LHVQVIEARNLAKMDTFGKSDPYAVLQL-SGTNRILKTGYKDNTCDPRWNEQFSLPVN 61


>UniRef50_Q6BSE5 Cluster: Similar to CA3124|IPF5353.3 Candida albicans
            IPF5353.3; n=5; Saccharomycetales|Rep: Similar to
            CA3124|IPF5353.3 Candida albicans IPF5353.3 -
            Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 1457

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 25/72 (34%), Positives = 40/72 (55%)
 Frame = +1

Query: 268  VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
            ++++ A  L   D NG SDPF+++ L  +    Y T  K  TL+PVW E   +P+    +
Sbjct: 1003 LDILSAEGLKSVDSNGKSDPFLSVKL--DGVEIYKTDKKRKTLDPVWNESVDIPLMSR-S 1059

Query: 448  EDSLCLEVWDFD 483
               + LEV+D+D
Sbjct: 1060 RQIVLLEVYDWD 1071


>UniRef50_Q9USG8 Cluster: Meiotically up-regulated gene 190 protein;
           n=1; Schizosaccharomyces pombe|Rep: Meiotically
           up-regulated gene 190 protein - Schizosaccharomyces
           pombe (Fission yeast)
          Length = 1188

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM--SGT 441
           V +  A DL  +D NGLSD ++T+         Y T V    LNP+W E+  +P+     
Sbjct: 473 VHINRAEDLSKQDVNGLSDAYITVGFHKFGKPLYCTRVVKQDLNPIWNEYAFIPVFPDQV 532

Query: 442 VNEDSLCLEVWDFD 483
              + + +E+WD D
Sbjct: 533 KAGEKISIELWDSD 546


>UniRef50_UPI0000E4A5D1 Cluster: PREDICTED: similar to mKIAA0734
           protein; n=3; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to mKIAA0734 protein -
           Strongylocentrotus purpuratus
          Length = 792

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 4/57 (7%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN----SSHRYNTSVKSGTLNPVWEEHF 420
           L V V+ AT + P D NGLSDP+V +YL  +     +H   T V   TL+P+++E F
Sbjct: 498 LRVRVMNATQIRPMDDNGLSDPYVIVYLQPHHVFPQTHFQKTQVIKKTLHPLFDETF 554


>UniRef50_UPI000065FF01 Cluster: Homolog of Homo sapiens "Rabphilin
           3A homolog (mouse); n=1; Takifugu rubripes|Rep: Homolog
           of Homo sapiens "Rabphilin 3A homolog (mouse) - Takifugu
           rubripes
          Length = 582

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+  +++A  L P D NGL+DP+V ++L+  +N S +  T     T NP+W E  +L   
Sbjct: 272 LHCSILKAKGLKPMDSNGLADPYVKLHLLPGANKSTKLRTKTLRNTRNPLWNE--TLTYH 329

Query: 436 GTVNED 453
           G   ED
Sbjct: 330 GLTEED 335


>UniRef50_Q55DS5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1546

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKD-PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLP 429
           +L V ++E  DL   D  + L+D FV I    N   +  T ++  TLNPVW +   F  P
Sbjct: 4   ILKVRIIEGRDLPIMDRSSALADAFVEIRCGQNDPQK--TDIQKKTLNPVWNQDFRFDFP 61

Query: 430 MSGTVNEDSLCLEVWDFD 483
               + ++ L + VWD+D
Sbjct: 62  NDVDIQDNPLDIRVWDYD 79


>UniRef50_A2FNQ6 Cluster: XYPPX repeat family protein; n=1;
           Trichomonas vaginalis G3|Rep: XYPPX repeat family
           protein - Trichomonas vaginalis G3
          Length = 238

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 26/75 (34%), Positives = 40/75 (53%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L  N++V+EA DL   D  G  DP+V I L    + +  T V   + NPVW E FS+P++
Sbjct: 3   LTFNIKVIEAKDLPKVDTFGKVDPYVQIQL---GNEKCKTKVIKKSYNPVWNETFSIPVT 59

Query: 436 GTVNEDSLCLEVWDF 480
                 ++ +  +DF
Sbjct: 60  NPKAPLNITVVDYDF 74


>UniRef50_Q6CDF0 Cluster: Similar to DEHA0F10824g Debaryomyces
            hansenii IPF 8282.1; n=1; Yarrowia lipolytica|Rep:
            Similar to DEHA0F10824g Debaryomyces hansenii IPF 8282.1
            - Yarrowia lipolytica (Candida lipolytica)
          Length = 1226

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 26/75 (34%), Positives = 36/75 (48%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            +  + +V+A +L   D NGLSDP+VT+   +       T      LNPVW+E F +   G
Sbjct: 813  LFTIRIVQAENLKACDMNGLSDPYVTLVDQATRKQIGKTRTIFEELNPVWDETFEIATGG 872

Query: 439  TVNEDSLCLEVWDFD 483
                  L   VWD D
Sbjct: 873  ---PSWLTATVWDED 884


>UniRef50_A6R438 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 1182

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 26/80 (32%), Positives = 41/80 (51%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           + +  +  V++VEA DL   D +GLSDP+V+  L   S   + T +    LNP W++   
Sbjct: 730 KVTNYVFTVKIVEAEDLKGCDMDGLSDPYVS--LADESQRIFKTRIIYDNLNPRWDDSVD 787

Query: 424 LPMSGTVNEDSLCLEVWDFD 483
           +   G  N   +   VWD+D
Sbjct: 788 IITKGPQN---IIATVWDWD 804


>UniRef50_Q9Y2J0 Cluster: Rabphilin-3A; n=48; Deuterostomia|Rep:
           Rabphilin-3A - Homo sapiens (Human)
          Length = 694

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L   +++A  L P D NGL+DP+V ++L+  ++ S++  T     T NP+W E  +L   
Sbjct: 409 LQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNE--TLVYH 466

Query: 436 GTVNED 453
           G  +ED
Sbjct: 467 GITDED 472


>UniRef50_UPI00015B593D Cluster: PREDICTED: similar to bitesize; n=1;
            Nasonia vitripennis|Rep: PREDICTED: similar to bitesize -
            Nasonia vitripennis
          Length = 2536

 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 4/80 (5%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKD-PNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSL 426
            L   V V +  DL P D     SDP+V +YL+ + S   +  T VK  TLNPV++E    
Sbjct: 2228 LTFEVHVTQCRDLAPVDVKRNRSDPYVKVYLLPDKSKSGKRKTKVKKHTLNPVFDETLKF 2287

Query: 427  PMS-GTVNEDSLCLEVWDFD 483
              S  ++   +L L VW  D
Sbjct: 2288 HTSLNSLESRTLWLTVWHSD 2307


>UniRef50_A7PT45 Cluster: Chromosome chr8 scaffold_29, whole genome
           shotgun sequence; n=8; Magnoliophyta|Rep: Chromosome
           chr8 scaffold_29, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 547

 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 27/75 (36%), Positives = 41/75 (54%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V+VV A  L+  D  G SDP+V + L         TS+K  TL+P W E F L +  
Sbjct: 264 LLHVKVVRARKLLKMDILGASDPYVKLSLSGERLPAKKTSIKMKTLDPEWNEDFKLIVKD 323

Query: 439 TVNEDSLCLEVWDFD 483
             ++  L L V+D++
Sbjct: 324 PKSQ-VLQLHVYDWE 337


>UniRef50_Q0IFK0 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 1038

 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 25/74 (33%), Positives = 44/74 (59%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L VE+VEA         G  +PFV +YL ++ + +  +++   T +PVW++ FS+P +  
Sbjct: 68  LRVELVEAKLNERPSVQGALNPFVIMYLQTDLTSKEKSTICKTTNHPVWKQCFSIPAAEN 127

Query: 442 VNEDSLCLEVWDFD 483
            NE +L +EV+ +D
Sbjct: 128 SNE-NLIVEVYHWD 140


>UniRef50_Q4PAR4 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1382

 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 5/55 (9%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN--SSHRYN---TSVKSGTLNPVWE 411
           L V+V+   +L  KD NG SDPFV + L  +  SSH  N   T+VK  TL+PVW+
Sbjct: 26  LRVQVLSGNNLAAKDRNGKSDPFVAVSLPGSAASSHHANNSHTTVKPKTLDPVWK 80


>UniRef50_Q9QYX7 Cluster: Protein piccolo; n=22; cellular
            organisms|Rep: Protein piccolo - Mus musculus (Mouse)
          Length = 5038

 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 30/88 (34%), Positives = 48/88 (54%), Gaps = 14/88 (15%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLM---------SNSSHRYNTSVK--SGTLNPVW 408
            L + +++A +LVP+D NG SDPFV +YL+          N+S  Y    K    +LNP W
Sbjct: 4607 LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASVEYKRRTKYVQKSLNPEW 4666

Query: 409  EE---HFSLPMSGTVNEDSLCLEVWDFD 483
             +   + S+ M   + + +L + VWD+D
Sbjct: 4667 NQTVIYKSISMEQLMKK-TLEVTVWDYD 4693


>UniRef50_UPI00003C022B Cluster: PREDICTED: similar to Synaptotagmin
           IV CG10047-PA; n=2; Endopterygota|Rep: PREDICTED:
           similar to Synaptotagmin IV CG10047-PA - Apis mellifera
          Length = 447

 Score = 46.4 bits (105), Expect = 4e-04
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 2/55 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHF 420
           L V V++A +L   D  GL+DP+V IYL+ NS    +  T VK  TL+PV+ E F
Sbjct: 324 LTVVVLKAQNLPKMDVTGLADPYVKIYLLYNSQRIAKRKTRVKKRTLSPVFNESF 378



 Score = 41.5 bits (93), Expect = 0.010
 Identities = 19/54 (35%), Positives = 30/54 (55%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           L V VV    L  ++ N  SDP+V + L+ +  H+  T V   T +PV++E F+
Sbjct: 186 LGVTVVNCKGLPAREQNATSDPYVKLKLLPDKQHQAKTRVLRNTRDPVYDEDFT 239


>UniRef50_Q17IK9 Cluster: Putative uncharacterized protein; n=1; Aedes
            aegypti|Rep: Putative uncharacterized protein - Aedes
            aegypti (Yellowfever mosquito)
          Length = 2350

 Score = 46.4 bits (105), Expect = 4e-04
 Identities = 25/74 (33%), Positives = 38/74 (51%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD +G SDP+VT+ +   S  +  T      LNPVW E F+      
Sbjct: 1358 IGITVICAQGLIAKDKSGTSDPYVTVQV---SKVKKRTRTMPQELNPVWNEKFNFECHN- 1413

Query: 442  VNEDSLCLEVWDFD 483
             + D + + VWD D
Sbjct: 1414 -SSDRIKVRVWDED 1426


>UniRef50_A7T2P9 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 309

 Score = 46.4 bits (105), Expect = 4e-04
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 4/80 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEH--FSLP 429
           L+V ++EA +L  KD +G+SDPF  I L+       R+ T++   TLNP W+ +  +   
Sbjct: 181 LHVHIMEAKNLPGKDADGMSDPFCKITLLPDKKGKTRHKTAIIKRTLNPSWDYNLIYEEL 240

Query: 430 MSGTVNEDSLCLEVWDFDPA 489
               + +  L + +WD D A
Sbjct: 241 SQEELRQRVLEISIWDHDIA 260


>UniRef50_Q6CWE6 Cluster: Similar to sp|Q03640 Saccharomyces
            cerevisiae YML072c; n=1; Kluyveromyces lactis|Rep:
            Similar to sp|Q03640 Saccharomyces cerevisiae YML072c -
            Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 1490

 Score = 46.4 bits (105), Expect = 4e-04
 Identities = 23/77 (29%), Positives = 42/77 (54%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            +L+   + A D+   D NG SDP + + +  +    + ++V   TLNPVW E   LP+  
Sbjct: 1098 ILDTTFISADDVPSHDRNGKSDPMIIVRI--DGEKIFQSAVVKKTLNPVWNEKVKLPVPS 1155

Query: 439  TVNEDSLCLEVWDFDPA 489
              + + + ++V+D+D A
Sbjct: 1156 R-SRNKIAVQVYDWDRA 1171


>UniRef50_Q7L804 Cluster: Rab11 family-interacting protein 2; n=23;
           Euteleostomi|Rep: Rab11 family-interacting protein 2 -
           Homo sapiens (Human)
          Length = 512

 Score = 46.4 bits (105), Expect = 4e-04
 Identities = 24/65 (36%), Positives = 36/65 (55%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V V++A DL PK  +G +D +  I L      +Y+TSV   TL PVW+E  S  + G 
Sbjct: 15  VQVTVLQAKDLKPKGKSGTNDTYTIIQL---GKEKYSTSVAEKTLEPVWKEEASFELPGL 71

Query: 442 VNEDS 456
           + + S
Sbjct: 72  LIQGS 76


>UniRef50_UPI000155C868 Cluster: PREDICTED: hypothetical protein;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein - Ornithorhynchus anatinus
          Length = 317

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 23/59 (38%), Positives = 34/59 (57%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           + V V++A DL PK  +G +D +  I L      +Y+TSV   TL+PVW+E  S  + G
Sbjct: 15  VQVTVLQAKDLKPKGKSGTNDTYTIIQL---GKEKYSTSVAEKTLDPVWKEEASFELPG 70


>UniRef50_UPI0000E4A2C5 Cluster: PREDICTED: similar to otoferlin,
            partial; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to otoferlin, partial -
            Strongylocentrotus purpuratus
          Length = 1142

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 24/77 (31%), Positives = 45/77 (58%)
 Frame = +1

Query: 253  GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
            G+++ V +++A DL P D NG +DP+V I+L  + ++     V S  LNP + + F    
Sbjct: 925  GVLVRVYIIKAIDLHPTDVNGKADPYVQIHLGKHKTNDKENYV-SKNLNPTFGKCFEFEA 983

Query: 433  SGTVNEDSLCLEVWDFD 483
            +  + E  L ++++D+D
Sbjct: 984  TFPM-ESKLAIQIYDWD 999



 Score = 35.9 bits (79), Expect = 0.51
 Identities = 18/51 (35%), Positives = 25/51 (49%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L   + +A  L+  D +GLSDPF  + L         T V   TL+P W+E
Sbjct: 272 LRCHIYQARSLIGSDSSGLSDPFARVVLRDEVK---QTRVIQETLSPTWDE 319


>UniRef50_Q4S4L6 Cluster: Chromosome 2 SCAF14738, whole genome shotgun
            sequence; n=3; Euteleostomi|Rep: Chromosome 2 SCAF14738,
            whole genome shotgun sequence - Tetraodon nigroviridis
            (Green puffer)
          Length = 2202

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 27/75 (36%), Positives = 41/75 (54%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++ V V++ATDL PKD NG  DP++ I L  NS    +  + + T NPV+   F +    
Sbjct: 1632 LVRVYVIQATDLQPKDNNGRCDPYIKISLGRNSVDDRDHYIPN-TTNPVFGRMFEMTCF- 1689

Query: 439  TVNEDSLCLEVWDFD 483
               E  L + V+D+D
Sbjct: 1690 LPQEKDLKISVYDYD 1704



 Score = 37.1 bits (82), Expect = 0.22
 Identities = 22/71 (30%), Positives = 33/71 (46%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V VVE+   +PK   G  DP  ++        +  T V    +NPVW E     + G
Sbjct: 1   MLRV-VVESAKGLPKKKVGSPDPVTSVTF---KDEKKKTKVIDSEVNPVWNEVLEFDLKG 56

Query: 439 TVNEDSLCLEV 471
           T  + + C++V
Sbjct: 57  TPLDSASCIDV 67


>UniRef50_Q6XK19 Cluster: Bitesize isoform 2; n=6; Diptera|Rep:
            Bitesize isoform 2 - Drosophila melanogaster (Fruit fly)
          Length = 2645

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSL 426
            L V VV   DL   D     SDP+V +YL+ + S   +  T VK  TLNP+++E   F  
Sbjct: 2324 LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT 2383

Query: 427  PMSGTVNEDSLCLEVWDFD 483
            P+S ++   +L L VW  D
Sbjct: 2384 PIS-SLESRTLWLTVWHSD 2401


>UniRef50_Q59DX2 Cluster: CG33555-PA, isoform A; n=4; Coelomata|Rep:
            CG33555-PA, isoform A - Drosophila melanogaster (Fruit
            fly)
          Length = 1357

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSL 426
            L V VV   DL   D     SDP+V +YL+ + S   +  T VK  TLNP+++E   F  
Sbjct: 1036 LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT 1095

Query: 427  PMSGTVNEDSLCLEVWDFD 483
            P+S ++   +L L VW  D
Sbjct: 1096 PIS-SLESRTLWLTVWHSD 1113


>UniRef50_A7RZG6 Cluster: Predicted protein; n=2; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1854

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 25/75 (33%), Positives = 41/75 (54%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++ V ++ A DL P+DP GL+DP+V + L            K  TLNP++ + F L    
Sbjct: 1361 VVRVYILSAIDLQPQDPGGLADPYVVVQLGKKKLDN-KDQYKPNTLNPIFGKMFELDAVI 1419

Query: 439  TVNEDSLCLEVWDFD 483
             V++D L + + D+D
Sbjct: 1420 PVHKD-LKITLMDYD 1433


>UniRef50_A7RS41 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 662

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 25/74 (33%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L++E+ E  DL  +D  G SDP+V     ++    Y +   S  LNP W E F +P+   
Sbjct: 4   LDIELKEGKDLAARDKTGTSDPYVKF--KADGRQIYKSRTISKNLNPQWNEKFCVPIEDI 61

Query: 442 VNEDSLCLEVWDFD 483
                + L+V+DFD
Sbjct: 62  T--VPMVLKVFDFD 73



 Score = 42.3 bits (95), Expect = 0.006
 Identities = 19/58 (32%), Positives = 31/58 (53%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           ++++ +VE   ++P D +G SDP+    L    + +Y +     TLNP W E F L M
Sbjct: 158 IVSIILVEGKKMIPMDDSGFSDPYCRFRL---GNEKYKSKACKETLNPQWSEQFDLKM 212



 Score = 34.7 bits (76), Expect = 1.2
 Identities = 24/74 (32%), Positives = 36/74 (48%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V++  A  L   D  G SDPF  I +   ++ R  T+    TLNP W + + +P+   
Sbjct: 306 LQVKLHRAVGLASADLGGASDPFAVIEV---NNQRLVTNTIYKTLNPNWNKIYEMPVWDI 362

Query: 442 VNEDSLCLEVWDFD 483
              D L + V+D D
Sbjct: 363 --HDVLDITVFDED 374


>UniRef50_A2FZR9 Cluster: C2 domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: C2 domain containing
           protein - Trichomonas vaginalis G3
          Length = 431

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 27/76 (35%), Positives = 37/76 (48%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           ++L   VV A DL   D NG SDP+V + L +N      T V     NPVW + F+  + 
Sbjct: 321 VILEFSVVYAKDLAAMDLNGKSDPYVILKL-NNDGPEQKTEVVKKNKNPVWNQDFTFELK 379

Query: 436 GTVNEDSLCLEVWDFD 483
                D L L  +D+D
Sbjct: 380 DK-QTDILHLSCYDWD 394


>UniRef50_A2F8Y1 Cluster: C2 domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: C2 domain containing
           protein - Trichomonas vaginalis G3
          Length = 414

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L ++V+EA +L   D    SDP+  I ++ +   ++ T V    LNPVW E F +P+   
Sbjct: 3   LKLKVIEAKELRAADIGLSSDPYCEISIV-DKEQKFKTKVIEKNLNPVWNEEFIIPIDNQ 61

Query: 442 VNEDSLCLEVWDFD 483
              D+L ++V D D
Sbjct: 62  -ETDALSIQVLDED 74


>UniRef50_Q756V3 Cluster: AER148Wp; n=1; Eremothecium gossypii|Rep:
            AER148Wp - Ashbya gossypii (Yeast) (Eremothecium
            gossypii)
          Length = 1502

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L ++VV A D+   D NGLSDPF  I +  + +  + + V   TL PVW    ++P+   
Sbjct: 1081 LELQVVSAEDVPSHDRNGLSDPFTIIKV--DGTKIFKSEVIKKTLTPVWNARTNIPIPSR 1138

Query: 442  VNEDSLCLEVWDFD 483
                 + +EV+D+D
Sbjct: 1139 -TRSKVDIEVYDWD 1151


>UniRef50_UPI00015B5F3B Cluster: PREDICTED: similar to
           ENSANGP00000018546; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000018546 - Nasonia
           vitripennis
          Length = 457

 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L V V++A +L   D  GL+DP+V IYL+ N+    +  T VK  TLNP++ E   F +P
Sbjct: 334 LTVVVLKARNLPKMDVTGLADPYVKIYLLYNNQRIAKRKTHVKKRTLNPIFNESIVFEIP 393

Query: 430 MSGTVNEDSLCLE 468
            +G      + LE
Sbjct: 394 -NGAEGLSKISLE 405



 Score = 36.3 bits (80), Expect = 0.38
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +1

Query: 310 NGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           N  SDP+V + L+ +  HR  T V   T +PV++E F+
Sbjct: 212 NASSDPYVKLQLLPDKQHRTKTRVLRNTRDPVYDEDFT 249


>UniRef50_UPI00015B563B Cluster: PREDICTED: similar to
           ENSANGP00000005071; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000005071 - Nasonia
           vitripennis
          Length = 478

 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +LNV++VEA DL  +D +  +DP+  I L+ + S    T +   TLNP ++E F   ++ 
Sbjct: 206 ILNVKLVEARDLRARDLSETADPYAKIRLLPDRSTVKQTRIHKKTLNPEFDEDFVFQVAP 265

Query: 439 TVNEDSLCLEV--WDFD 483
                   LEV  +DFD
Sbjct: 266 NCQLAERTLEVLLYDFD 282


>UniRef50_UPI00006D0DBC Cluster: C2 domain containing protein; n=1;
            Tetrahymena thermophila SB210|Rep: C2 domain containing
            protein - Tetrahymena thermophila SB210
          Length = 4263

 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-- 435
            L V ++   +L   D  G SDP+VT+YL +N      T      LNPVW     +P++  
Sbjct: 1835 LQVNIISGANLKNTDTIGKSDPYVTVYLSNNQKQPLKTKPLKDDLNPVWNFTGVIPINML 1894

Query: 436  -GTVNEDSLCLEVWDFD 483
               + +  L L+V+D D
Sbjct: 1895 RCQLKQAELYLDVYDED 1911



 Score = 39.1 bits (87), Expect = 0.054
 Identities = 24/53 (45%), Positives = 29/53 (54%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
            L V++V A +L   D NG SDP+V I    N   +  TS  S TLNP W E F
Sbjct: 1354 LKVKIVHARELRKADRNG-SDPYVQINFPGNVEVK--TSTISNTLNPQWNEVF 1403



 Score = 34.3 bits (75), Expect = 1.5
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 3/78 (3%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTI-YLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            +L V +V A DL   D    SDP+V + Y   +      + VK  T+NP W +   L +S
Sbjct: 1190 ILKVLLVRAKDLRGDDAVDSSDPYVILKYQNYDKVIEAKSKVKKYTVNPAWYQILQLKVS 1249

Query: 436  GTVN--EDSLCLEVWDFD 483
               +     L +E+WD D
Sbjct: 1250 FYKDGIVPPLKVEIWDQD 1267


>UniRef50_Q7QEM8 Cluster: ENSANGP00000004715; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000004715 - Anopheles gambiae
           str. PEST
          Length = 1056

 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 25/72 (34%), Positives = 37/72 (51%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
           + V+ A  L+ KD +G SDP+VT+ +   S  +  T      LNPVW E F+       +
Sbjct: 202 ITVICAQGLIAKDKSGTSDPYVTVQV---SKVKKRTRTMPQELNPVWNEKFNFECHN--S 256

Query: 448 EDSLCLEVWDFD 483
            D + + VWD D
Sbjct: 257 SDRIKVRVWDED 268


>UniRef50_Q54PM1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 623

 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 25/73 (34%), Positives = 36/73 (49%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V V+E  DLV  D NG SD + T+ L      +  T +   +LNP W E F + +S 
Sbjct: 3   ILQVNVIEGRDLVASDSNGFSDCYATLIL---GQQKKKTKIIKKSLNPKWGETFLMRISP 59

Query: 439 TVNEDSLCLEVWD 477
                 + L+ WD
Sbjct: 60  LDETLHVLLQDWD 72


>UniRef50_Q1RL36 Cluster: Zinc finger protein; n=1; Ciona
            intestinalis|Rep: Zinc finger protein - Ciona
            intestinalis (Transparent sea squirt)
          Length = 946

 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
            L V V++A DL+P++   L +P++ +YL+   S +S R + + K  TLNP W + F    
Sbjct: 784  LYVTVLQAIDLLPREGGMLRNPYIKMYLLPDRSEASKRRSKTAKK-TLNPSWHQSFVYGP 842

Query: 433  SGTVNEDSLCLEV--WDFD 483
                +  S+ LEV  WD D
Sbjct: 843  IRRQDLGSMALEVSLWDLD 861


>UniRef50_Q6FNW3 Cluster: Candida glabrata strain CBS138 chromosome J
            complete sequence; n=1; Candida glabrata|Rep: Candida
            glabrata strain CBS138 chromosome J complete sequence -
            Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 1196

 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 26/76 (34%), Positives = 35/76 (46%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L +    A +L+  D NG SDPF+  Y        + T     TLNP W E   + +   
Sbjct: 1013 LTIIAKNAENLLSADTNGYSDPFLKFYYNDEDDACFKTKTIKKTLNPTWNEKGVIEVRNR 1072

Query: 442  VNEDSLCLEVWDFDPA 489
            V  D L L+V D+D A
Sbjct: 1073 V-YDVLYLKVMDWDAA 1087


>UniRef50_A1CL98 Cluster: Phosphatidylserine decarboxylase; n=5;
           Pezizomycotina|Rep: Phosphatidylserine decarboxylase -
           Aspergillus clavatus
          Length = 1077

 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 25/76 (32%), Positives = 37/76 (48%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+L V  ++  +L  KD  G SDP++ + L      R +T     TLNP W   F +P+ 
Sbjct: 41  LVLKVTAIKGRNLAAKDRGGTSDPYLIVTL---GESRQSTPTIPKTLNPEWNVTFEMPVV 97

Query: 436 GTVNEDSLCLEVWDFD 483
           G    + +C   WD D
Sbjct: 98  GVPLLECIC---WDHD 110


>UniRef50_Q9HAU4 Cluster: E3 ubiquitin-protein ligase SMURF2; n=73;
           Coelomata|Rep: E3 ubiquitin-protein ligase SMURF2 - Homo
           sapiens (Human)
          Length = 748

 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +1

Query: 235 GG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           GG R   + L + V+ A +LV KD   L DPF  + ++  S   ++T     TL+P W +
Sbjct: 5   GGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKV-VVDGSGQCHSTDTVKNTLDPKWNQ 63

Query: 415 HFSLPMSGTVNEDSLCLEVWD 477
           H+ L +      DS+ + VW+
Sbjct: 64  HYDLYIG---KSDSVTISVWN 81


>UniRef50_Q9HC10 Cluster: Otoferlin; n=33; Euteleostomi|Rep: Otoferlin
            - Homo sapiens (Human)
          Length = 1997

 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 28/76 (36%), Positives = 43/76 (56%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            +++ V VV ATDL P D NG +DP++ I L   +  R   +  S  LNPV+ + F +  S
Sbjct: 1492 VLVRVYVVRATDLHPADINGKADPYIAIRL-GKTDIRDKENYISKQLNPVFGKSFDIEAS 1550

Query: 436  GTVNEDSLCLEVWDFD 483
              + E  L + V+D+D
Sbjct: 1551 FPM-ESMLTVAVYDWD 1565



 Score = 35.1 bits (77), Expect = 0.88
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = +1

Query: 244  RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            +     L   + +A  L   D +GLSDPF  ++ ++ S     T V + TL P W++
Sbjct: 956  KKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQ---CTEVLNETLCPTWDQ 1009


>UniRef50_UPI0000500DEB Cluster: Double C2-like domain-containing
           protein beta (Doc2-beta).; n=3; Eutheria|Rep: Double
           C2-like domain-containing protein beta (Doc2-beta). -
           Rattus norvegicus
          Length = 412

 Score = 45.2 bits (102), Expect = 8e-04
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 2/68 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+  + +A  L P D NGL+DP+V ++L+  +S  ++  T     TLNP W E  +L   
Sbjct: 146 LHCTISKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPSWNE--TLTYY 203

Query: 436 GTVNEDSL 459
           G  +ED +
Sbjct: 204 GITDEDMI 211


>UniRef50_Q95Q59 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 890

 Score = 45.2 bits (102), Expect = 8e-04
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L++ V +    DL  KD +G SDP+V      N  ++  T  K+  LNP W+E F +   
Sbjct: 143 LLMEVRLKNGEDLPVKDASGSSDPYVKFRYKDNIVYKSGTIFKN--LNPSWDEEFQM--- 197

Query: 436 GTVNEDSLC---LEVWDFD 483
             + +D  C   LEV+DFD
Sbjct: 198 --IVDDVTCPIRLEVFDFD 214



 Score = 39.1 bits (87), Expect = 0.054
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 2/78 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           + N  V  A DLV KD  G SDPF  + L+ N+  + NT  K  TL+P W + ++     
Sbjct: 532 LFNCLVFGAEDLVAKDFGGKSDPFAVLELV-NTRVQTNTIYK--TLSPSWNKIYTF---- 584

Query: 439 TVNEDSLCLEV--WDFDP 486
            V +   CL+V  +D DP
Sbjct: 585 AVKDIHTCLQVTIYDEDP 602


>UniRef50_Q55A55 Cluster: Ankyrin repeat-containing protein; n=2;
           Dictyostelium discoideum|Rep: Ankyrin repeat-containing
           protein - Dictyostelium discoideum AX4
          Length = 986

 Score = 45.2 bits (102), Expect = 8e-04
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + +EV+E  +LVP D NG+SDP+  + +      +  T     TL P WE          
Sbjct: 8   VRIEVLEGRNLVPMDSNGMSDPYGVVIV---GDKKKKTKAIKHTLFPKWESDNCFEFDID 64

Query: 442 VNEDSLCLEVWDFD 483
           VN  ++ +EV+D+D
Sbjct: 65  VNLLAITVEVYDWD 78


>UniRef50_Q4RHB4 Cluster: Chromosome 3 SCAF15050, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 3
           SCAF15050, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 1302

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 20/37 (54%), Positives = 24/37 (64%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           T VK  TLNPVW+EHF   +   VN D L L++WD D
Sbjct: 170 TEVKPETLNPVWDEHFVFEID-DVNNDLLHLDIWDHD 205



 Score = 44.8 bits (101), Expect = 0.001
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN----SSHRYNTSVKSGTLNPVWEEHFSLP 429
            L VE++ A D++  D NGLSDPFV + L  +     +    T VK  TL+PV++E F   
Sbjct: 1113 LTVEILHAADIMALDANGLSDPFVIVELCPHHLFPMAKSQRTQVKLKTLHPVFDELFYFH 1172

Query: 430  MS 435
            +S
Sbjct: 1173 VS 1174


>UniRef50_Q3U4B9 Cluster: NOD-derived CD11c +ve dendritic cells
           cDNA, RIKEN full-length enriched library,
           clone:F630020E13 product:hypothetical C2
           domain/C2-domain profile/C2 calcium/lipid-binding
           domain, CaLB containing protein, full insert sequence;
           n=2; Mus musculus|Rep: NOD-derived CD11c +ve dendritic
           cells cDNA, RIKEN full-length enriched library,
           clone:F630020E13 product:hypothetical C2
           domain/C2-domain profile/C2 calcium/lipid-binding
           domain, CaLB containing protein, full insert sequence -
           Mus musculus (Mouse)
          Length = 319

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           ++++ ++E  DL   D NGLSDP+V   L      +Y + +   TLNP W E F
Sbjct: 190 IVSITLIEGRDLKAMDSNGLSDPYVKFRL---GQQKYKSKIMPKTLNPQWREQF 240



 Score = 33.1 bits (72), Expect = 3.6
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L++ +     L  +D  G SDP+V   +       + + +    LNPVWEE   + +   
Sbjct: 41  LDITLRRGQSLAARDRGGTSDPYVKFKI--GRKEVFRSKIIHKNLNPVWEEKACVLIDHL 98

Query: 442 VNEDSLCLEVWDFD 483
              + L ++V+D+D
Sbjct: 99  --REPLYIKVFDYD 110


>UniRef50_Q9SSF7 Cluster: F25A4.30 protein; n=23; Magnoliophyta|Rep:
           F25A4.30 protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 1276

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 2/74 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L VEVVEA +++PKD  G S  +V +      + +  TS K   LNP+W E     +S  
Sbjct: 19  LVVEVVEARNILPKDGQGSSSAYVVV---DFDAQKKRTSTKFRDLNPIWNEMLDFAVSDP 75

Query: 442 VN--EDSLCLEVWD 477
            N   D L +EV++
Sbjct: 76  KNMDYDELDIEVYN 89


>UniRef50_A7PI32 Cluster: Chromosome chr13 scaffold_17, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr13 scaffold_17, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 519

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 28/75 (37%), Positives = 38/75 (50%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V+VV A  L+  D  G SDP+V + L         T+VK   LNP W E F L +  
Sbjct: 262 ILHVKVVRALKLLKMDFLGASDPYVKLSLSGERLPAKKTTVKRKNLNPEWNEKFKLIVRD 321

Query: 439 TVNEDSLCLEVWDFD 483
                 L L V+D+D
Sbjct: 322 P-QAQVLQLYVYDWD 335


>UniRef50_A4RYC5 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 974

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 6/84 (7%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS-----SHRYNTSVKSGTLNPVWEE 414
           SGL + V V   + L+  D    SDP+V + +++++        + T  +  T NPVW E
Sbjct: 238 SGLFIRVNVESGSGLLAMDAGETSDPYVKVSIVNSAGLAVDGQVHRTGYRPKTTNPVWNE 297

Query: 415 HFSLPMSGTVNED-SLCLEVWDFD 483
            F +       +D SL  EV+DFD
Sbjct: 298 SFYMGSEKLRYKDCSLKFEVYDFD 321


>UniRef50_Q8IM86 Cluster: CG2999-PB, isoform B; n=5; Eumetazoa|Rep:
            CG2999-PB, isoform B - Drosophila melanogaster (Fruit
            fly)
          Length = 3183

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 25/72 (34%), Positives = 36/72 (50%)
 Frame = +1

Query: 268  VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
            + V+ A  L+ KD +G SDP+VT+ +   S  +  T      LNPVW E F        +
Sbjct: 2161 ITVICAQGLIAKDKSGTSDPYVTVQV---SKVKKRTRTMPQELNPVWNEKFHFECHN--S 2215

Query: 448  EDSLCLEVWDFD 483
             D + + VWD D
Sbjct: 2216 SDRIKVRVWDED 2227



 Score = 36.7 bits (81), Expect = 0.29
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
            +NV+VV A DL  + P+G+  PFV I L    +     ++ T  KS   +P + E FS  
Sbjct: 3030 VNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFT 3089

Query: 430  MSGTVNEDSL 459
            +    NE+ L
Sbjct: 3090 IG---NEEQL 3096


>UniRef50_Q7PRZ3 Cluster: ENSANGP00000007487; n=6; Bilateria|Rep:
            ENSANGP00000007487 - Anopheles gambiae str. PEST
          Length = 1743

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 1/77 (1%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            +++ V VV+ATDL P D NG +DP+V + L S      +  V S  LNPV+ + F +   
Sbjct: 1238 VLVRVYVVKATDLHPMDLNGKADPYVVLQLGSKRVSDKDNYV-SKQLNPVFGKCFEI--E 1294

Query: 436  GTVNEDS-LCLEVWDFD 483
             T  +DS L ++++D+D
Sbjct: 1295 ATFPQDSMLTVQIFDWD 1311



 Score = 43.6 bits (98), Expect = 0.003
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L   + +A  L+  D +GLSDP+ T+Y+   + H   T V   TL+P W+E
Sbjct: 715 LRAHIYQARSLIGSDASGLSDPYATVYV---TEHAKTTQVIEETLSPTWDE 762


>UniRef50_O95294 Cluster: RasGAP-activating-like protein 1; n=25;
           Euteleostomi|Rep: RasGAP-activating-like protein 1 -
           Homo sapiens (Human)
          Length = 804

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 1/78 (1%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL-P 429
           G  L   V++A DL P+D +G SDPF  ++  S S     TS    T  P W+E   L  
Sbjct: 132 GRCLRCHVLQARDLAPRDISGTSDPFARVFWGSQS---LETSTIKKTRFPHWDEVLELRE 188

Query: 430 MSGTVNEDSLCLEVWDFD 483
           M G      L +E+WD+D
Sbjct: 189 MPGA--PSPLRVELWDWD 204



 Score = 33.9 bits (74), Expect = 2.0
 Identities = 21/60 (35%), Positives = 29/60 (48%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A    LNV VVE   L  KD +G SDP+  + +      R  T  +S  L P W E +++
Sbjct: 2   AKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRS--LGPFWGEEYTV 59


>UniRef50_UPI0000D556EA Cluster: PREDICTED: similar to CG33555-PC,
            isoform C; n=1; Tribolium castaneum|Rep: PREDICTED:
            similar to CG33555-PC, isoform C - Tribolium castaneum
          Length = 2116

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKD-PNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSL 426
            L + + +  DL P D     SDP+V +YL+ + S   +  T VK  TLNPV++E   F +
Sbjct: 1827 LEILIKQCKDLAPVDVKRNRSDPYVKVYLLPDKSKSGKRKTKVKKHTLNPVFDETLKFHI 1886

Query: 427  PMSGTVNEDSLCLEVWDFD 483
             ++G +   +L L VW  D
Sbjct: 1887 SLNG-LETRTLWLTVWHSD 1904



 Score = 44.4 bits (100), Expect = 0.001
 Identities = 33/86 (38%), Positives = 39/86 (45%), Gaps = 4/86 (4%)
 Frame = +1

Query: 238  G*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWE 411
            G R+ G  L+V V EA  L     NG SDPF   YL+ +   S +  T V   T+NPVW 
Sbjct: 1968 GKRSRGT-LHVLVKEAKCLTAVKANGTSDPFCKSYLLPDKGRSSKQKTPVAKRTVNPVWN 2026

Query: 412  EHFSLPMSGTVNEDSLCLE--VWDFD 483
              F             CLE  VWD D
Sbjct: 2027 HTFVYDDVTLQELAERCLELTVWDHD 2052


>UniRef50_Q4SDC9 Cluster: Chromosome 1 SCAF14640, whole genome
           shotgun sequence; n=4; Euteleostomi|Rep: Chromosome 1
           SCAF14640, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 1709

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 26/70 (37%), Positives = 35/70 (50%)
 Frame = +1

Query: 274 VVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNED 453
           V+ A  L  KD  G SDP+VT+ +      +  T    G LNPVWEE F+       + D
Sbjct: 764 VLCAQGLQAKDKTGSSDPYVTVQV---GKTKKRTKTIYGNLNPVWEETFNFECHN--SSD 818

Query: 454 SLCLEVWDFD 483
            + + VWD D
Sbjct: 819 RIKVRVWDED 828


>UniRef50_Q4S0W7 Cluster: Chromosome 5 SCAF14773, whole genome
           shotgun sequence; n=4; Deuterostomia|Rep: Chromosome 5
           SCAF14773, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 168

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L + +++A +L   D  G SDP+V + LM       +  TS K  TLNP++ E   F +P
Sbjct: 47  LTITMIKARNLKAMDITGASDPYVKVSLMCEGRRLKKRKTSTKRNTLNPIYNEAIVFDVP 106

Query: 430 MSGTVNEDSLCLEVWDFD 483
               + + SL + V D+D
Sbjct: 107 PE-NIEQISLLIAVMDYD 123


>UniRef50_A2YKH2 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 589

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 28/74 (37%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V VV+AT L  K+  G SDP+V +Y+      +  T V    LNP W E F L +   
Sbjct: 338 LTVTVVKATSLKNKELIGKSDPYVILYV--RPMFKVKTKVIDDNLNPEWNETFPLIVEDK 395

Query: 442 VNEDSLCLEVWDFD 483
             + S+  EV+D D
Sbjct: 396 ETQ-SVIFEVYDED 408


>UniRef50_Q9TZL3 Cluster: Synaptotagmin protein 6; n=2;
           Caenorhabditis|Rep: Synaptotagmin protein 6 -
           Caenorhabditis elegans
          Length = 373

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL--PMS 435
           L+V ++EA DL  KD  G SDP+V  +L+ +      + V    LNP + E  S      
Sbjct: 118 LHVHLMEAVDLPVKDFTGSSDPYVRAFLLQDPGQSERSKVHRRNLNPTFNETLSFRGHSM 177

Query: 436 GTVNEDSLCLEVWDFD 483
             +++ +L L+V D+D
Sbjct: 178 KKLHDMTLVLQVMDYD 193


>UniRef50_Q86AY8 Cluster: Similar to Dictyostelium discoideum (Slime
           mold). R2005 protein; n=2; Dictyostelium discoideum|Rep:
           Similar to Dictyostelium discoideum (Slime mold). R2005
           protein - Dictyostelium discoideum (Slime mold)
          Length = 637

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 22/74 (29%), Positives = 42/74 (56%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + ++ A++L  KD NG SDP++ +   S +S +  T + +  LNPVW+E   + +   
Sbjct: 423 IRIRLISASNLEAKDTNGKSDPYIKLKSTSIASSQV-TKIINCNLNPVWDEELIVEID-Q 480

Query: 442 VNEDSLCLEVWDFD 483
           V  + +  +V+D D
Sbjct: 481 VAREVMIFDVYDHD 494


>UniRef50_Q16F96 Cluster: Otoferlin; n=1; Aedes aegypti|Rep:
           Otoferlin - Aedes aegypti (Yellowfever mosquito)
          Length = 855

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           +++ V +V+ATDL P D NG +DP+V + L S         V S  LNPV+ + F +   
Sbjct: 416 VLVRVYIVKATDLHPMDLNGKADPYVVLQLGSKRISDKENYV-SKQLNPVFGKCFEI--E 472

Query: 436 GTVNEDS-LCLEVWDFD 483
            T  +DS L ++++D+D
Sbjct: 473 ATFPQDSMLTVQIYDWD 489



 Score = 41.5 bits (93), Expect = 0.010
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L   V +A  L+  D +GLSDP+ T+Y+   S     T V   TL+P W+E
Sbjct: 5   LRAHVYQARSLIGSDASGLSDPYATVYITEFSR---TTQVIEETLSPTWDE 52


>UniRef50_Q9H448 Cluster: Fer-1-like 4; n=22; Tetrapoda|Rep:
            Fer-1-like 4 - Homo sapiens (Human)
          Length = 1794

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 2/78 (2%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVK--SGTLNPVWEEHFSLP 429
            L++ V VV+AT+L P DPNG +DP+V +   S    R +T  +     LNP++ E   L 
Sbjct: 1249 LLVRVYVVKATNLAPADPNGKADPYVVV---SAGRERQDTKERYIPKQLNPIFGEILELS 1305

Query: 430  MSGTVNEDSLCLEVWDFD 483
            +S    E  L + V+D D
Sbjct: 1306 IS-LPAETELTVAVFDHD 1322



 Score = 35.1 bits (77), Expect = 0.88
 Identities = 18/55 (32%), Positives = 29/55 (52%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           S   L   + +A  ++  D +GLSDPF  + +   S+    T V   TL+P+W+E
Sbjct: 759 SYFQLRAHLYQARGVLAADDSGLSDPFARVLI---STQCQTTRVLEQTLSPLWDE 810


>UniRef50_Q5KKG1 Cluster: Transmembrane protein, putative; n=4;
            Eukaryota|Rep: Transmembrane protein, putative -
            Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 1545

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 26/79 (32%), Positives = 39/79 (49%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            +L V+V++A  L   D +G SDP+V   L  N    + +  K  TL+PVW E F   +  
Sbjct: 1133 ILRVDVIDAKALHGADRSGKSDPYVVFSL--NDMKVFKSETKKKTLHPVWNESFETMVPS 1190

Query: 439  TVNEDSLCLEVWDFDPAET 495
             V       E++D+D   T
Sbjct: 1191 RV-AAKFAFEIFDWDRVGT 1208



 Score = 32.3 bits (70), Expect = 6.2
 Identities = 19/56 (33%), Positives = 28/56 (50%)
 Frame = +1

Query: 313 GLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDF 480
           G SDP+V I  M N+     T V +  LNP W++   +P+      +   LEV D+
Sbjct: 769 GKSDPYVRI--MGNNRIMARTEVINNNLNPEWDQIIYVPVHSI--REHFMLEVMDY 820


>UniRef50_Q4PA47 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1258

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE-HFSL-PMSGT 441
           V +  ATDL  +D  G SDP+ T+ L       Y+T V    L+P WEE H  L      
Sbjct: 561 VFIHSATDLEKQDLRGSSDPYCTLSLAKVGKILYSTRVVLNELSPRWEERHVMLITRENL 620

Query: 442 VNEDSLCLEVWDFD 483
            ++D + + +WD D
Sbjct: 621 ESDDKVSIALWDSD 634


>UniRef50_P41885 Cluster: Rabphilin-1; n=6; Caenorhabditis|Rep:
            Rabphilin-1 - Caenorhabditis elegans
          Length = 1106

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL--MSNSSHRYNTSVKSGTLNPVWEE--HFSLP 429
            L + +    +LV  D  G SDP+  + L  +++ +HR  TS K  TLNP W E   F +P
Sbjct: 984  LFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVP 1043

Query: 430  MSGTVNEDSLCLEVWDFD 483
                + + +L + V+D D
Sbjct: 1044 FK-DLPKKTLQIGVYDHD 1060



 Score = 39.1 bits (87), Expect = 0.054
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS--GTLNPVWEEHFS 423
            L + ++ A +L   D NG SDP+V  +L+  ++     + K+   TLNP W E  S
Sbjct: 844  LKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMS 899


>UniRef50_Q6DN14 Cluster: Multiple C2 and transmembrane
           domain-containing protein 1; n=54; Euteleostomi|Rep:
           Multiple C2 and transmembrane domain-containing protein
           1 - Homo sapiens (Human)
          Length = 999

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           ++++ ++E  DL   D NGLSDP+V   L      +Y + +   TLNP W E F
Sbjct: 471 IVSITLIEGRDLKAMDSNGLSDPYVKFRL---GHQKYKSKIMPKTLNPQWREQF 521



 Score = 33.9 bits (74), Expect = 2.0
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L++ +     L  +D  G SDP+V   +       + + +    LNPVWEE   + +   
Sbjct: 263 LDITLRRGQSLAARDRGGTSDPYVKFKI--GGKEVFRSKIIHKNLNPVWEEKACILVDHL 320

Query: 442 VNEDSLCLEVWDFD 483
              + L ++V+D+D
Sbjct: 321 --REPLYIKVFDYD 332


>UniRef50_UPI0000D56250 Cluster: PREDICTED: similar to CG6643-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG6643-PA, isoform A - Tribolium castaneum
          Length = 736

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 31/80 (38%), Positives = 41/80 (51%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           R  G+ L V VVEA +LV +D  G SDP+V   ++S  S R  T V    LNP W+   +
Sbjct: 287 RTEGI-LRVHVVEAKNLVNRDLIGKSDPYV---VLSCGSIRVETPVVENCLNPKWDFWTN 342

Query: 424 LPMSGTVNEDSLCLEVWDFD 483
             +        L +EVWD D
Sbjct: 343 FEIE---PNSELKIEVWDKD 359


>UniRef50_UPI0000ECAF25 Cluster: Unc-13 homolog C (Munc13-3); n=6;
            Euteleostomi|Rep: Unc-13 homolog C (Munc13-3) - Gallus
            gallus
          Length = 2167

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L  KD  G SDP+VT+ +      +  T    G LNPVW+E F      +
Sbjct: 1177 ITITVLCAQGLQAKDKTGSSDPYVTVQV---GKTKRRTKTIFGNLNPVWDEKFYFECHNS 1233

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 1234 T--DRIKVRVWDED 1245


>UniRef50_Q4TBR0 Cluster: Chromosome undetermined SCAF7099, whole
            genome shotgun sequence; n=2; Tetraodontidae|Rep:
            Chromosome undetermined SCAF7099, whole genome shotgun
            sequence - Tetraodon nigroviridis (Green puffer)
          Length = 1944

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 27/70 (38%), Positives = 33/70 (47%)
 Frame = +1

Query: 274  VVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNED 453
            VV A  L  KD  G SDP+VT+ +      +  T    G LNPVWEE F          D
Sbjct: 892  VVCAQGLQAKDKTGSSDPYVTVQV---GKTKKRTKTIYGNLNPVWEEKFHFECHNF--SD 946

Query: 454  SLCLEVWDFD 483
             + + VWD D
Sbjct: 947  RIKVRVWDED 956


>UniRef50_A2DBY3 Cluster: C2 domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: C2 domain containing
           protein - Trichomonas vaginalis G3
          Length = 312

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 21/57 (36%), Positives = 32/57 (56%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           LN+  +EA D+  +D  G  DPF+ I++ S    +  T V   T NP W+E F +P+
Sbjct: 3   LNLRAIEAKDMPKEDLFGKCDPFIEIFIDSKQVEK--TKVIKKTYNPKWDETFYIPL 57


>UniRef50_Q4PCK2 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1162

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE-HFSLPMS 435
           +L VE+     L  +D NG SDP+V +         Y++ +    LNPVW+E  F L   
Sbjct: 574 VLVVEIEYGEGLSAQDANGKSDPYVVLAFAKFGRPLYSSRIIFEDLNPVWQETAFLLVSK 633

Query: 436 GTVN-EDSLCLEVWDFD 483
             +   +SL +++WD D
Sbjct: 634 DDIRANESLSIQLWDSD 650


>UniRef50_Q4S8E6 Cluster: Chromosome undetermined SCAF14706, whole
           genome shotgun sequence; n=3; Tetraodontidae|Rep:
           Chromosome undetermined SCAF14706, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 841

 Score = 43.6 bits (98), Expect = 0.003
 Identities = 25/75 (33%), Positives = 38/75 (50%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L + + E  +LV +D  G SDPFV   +   +   Y + V    LNP W E FSLP+  
Sbjct: 255 LLTIHLKEGRNLVIRDRCGTSDPFVKFKMEGKTF--YKSKVVYKDLNPTWNETFSLPLKD 312

Query: 439 TVNEDSLCLEVWDFD 483
                 + ++V+D D
Sbjct: 313 L--SQKMYIKVYDRD 325



 Score = 39.9 bits (89), Expect = 0.031
 Identities = 24/55 (43%), Positives = 33/55 (60%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           L V+V++ATDL+  D NG SDPF  + L  +     +T  KS  LNP W + F+L
Sbjct: 583 LQVKVLKATDLLAADLNGKSDPFCVLEL-GHDRLLSHTVYKS--LNPEWNQVFAL 634


>UniRef50_Q9SKR2 Cluster: Expressed protein; n=12;
           Magnoliophyta|Rep: Expressed protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 541

 Score = 43.6 bits (98), Expect = 0.003
 Identities = 23/54 (42%), Positives = 30/54 (55%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           +++V+VV A  L  KD  G +DPFV I L  +      T+VK   LNP W E F
Sbjct: 261 IVHVKVVRAVGLRKKDLMGGADPFVKIKLSEDKIPSKKTTVKHKNLNPEWNEEF 314


>UniRef50_Q9U6P7 Cluster: Synaptotagmin IV; n=6; Diptera|Rep:
           Synaptotagmin IV - Drosophila melanogaster (Fruit fly)
          Length = 474

 Score = 43.6 bits (98), Expect = 0.003
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           L V +++A +L   D  GL+DP+V IYL+ N     +  T VK  TL+PV+ E F+
Sbjct: 348 LTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSPVFNESFA 403



 Score = 34.7 bits (76), Expect = 1.2
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           +DP+V + L+ +  H+  T V   T NPV++E F+
Sbjct: 230 TDPYVKLQLLPDKQHKVKTRVVRNTRNPVYDEDFT 264


>UniRef50_Q61D00 Cluster: Putative uncharacterized protein CBG12689;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG12689 - Caenorhabditis
           briggsae
          Length = 800

 Score = 43.6 bits (98), Expect = 0.003
 Identities = 26/76 (34%), Positives = 39/76 (51%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+L V +    DL  KD +G SDP+V         ++  T  K+  LNP W+E F + + 
Sbjct: 134 LLLEVRLNNGEDLPVKDASGSSDPYVKFRYKDAIVYKSGTIFKN--LNPSWDEEFQMIVD 191

Query: 436 GTVNEDSLCLEVWDFD 483
              +   + LEV+DFD
Sbjct: 192 DVTS--PIRLEVFDFD 205



 Score = 37.5 bits (83), Expect = 0.17
 Identities = 26/75 (34%), Positives = 40/75 (53%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V++  A DLV KD  G SDPF  + L+ N+  + NT  K  TL+P W + ++  +   
Sbjct: 444 LTVKLFGAEDLVAKDFGGKSDPFAILELV-NTRVQTNTIYK--TLSPSWNKIYTFAVKDI 500

Query: 442 VNEDSLCLEVWDFDP 486
                L + ++D DP
Sbjct: 501 --HTYLQVTIFDEDP 513


>UniRef50_Q55ZK4 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 1175

 Score = 43.6 bits (98), Expect = 0.003
 Identities = 28/85 (32%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = +1

Query: 235 GG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           G  RA G+ L + +   T L  +D NG SDP+V +         Y+T +    LNPV+EE
Sbjct: 565 GDTRAIGVFL-ITIHHCTGLSSQDNNGSSDPYVVLAYAKFGKPLYSTRIILEDLNPVFEE 623

Query: 415 H--FSLPMSGTVNEDSLCLEVWDFD 483
                L M    +++ L   +WD D
Sbjct: 624 TCVLLLTMDEVKSKEDLAAMLWDSD 648


>UniRef50_UPI00015B605D Cluster: PREDICTED: similar to IP14914p;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           IP14914p - Nasonia vitripennis
          Length = 920

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 28/72 (38%), Positives = 37/72 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V+VV A DL    P    +P+  + L      R+ TSVK  T NPVW+E F   +S  
Sbjct: 460 LLVKVVRAADLA--GPLECKEPYCVVEL-DEPPQRHQTSVKKDTKNPVWDEAFLFDISQN 516

Query: 442 VNEDSLCLEVWD 477
             E  + LEV+D
Sbjct: 517 TTE--VMLEVYD 526


>UniRef50_UPI0000E813D9 Cluster: PREDICTED: similar to brain
            otoferlin; n=3; Euteleostomi|Rep: PREDICTED: similar to
            brain otoferlin - Gallus gallus
          Length = 2104

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 25/76 (32%), Positives = 41/76 (53%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            +++ V +V+AT+L P DPNG +DP+V + +           +    LNPV+ E   L +S
Sbjct: 1590 VLVRVYIVKATNLSPADPNGKADPYVVVTVGKEQKDTKERYIPK-QLNPVFGEVVELTVS 1648

Query: 436  GTVNEDSLCLEVWDFD 483
              + E  L + V+D D
Sbjct: 1649 FPM-ESELTVAVFDHD 1663



 Score = 42.3 bits (95), Expect = 0.006
 Identities = 21/55 (38%), Positives = 29/55 (52%)
 Frame = +1

Query: 250  SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            S   L   + +A  ++P D NGLSDPFV +     S+H   T     TL+P+W E
Sbjct: 1075 SYFQLRAHLYQARGILPADDNGLSDPFVRVVF---STHCQTTRTVEETLSPMWNE 1126


>UniRef50_UPI0000E4A388 Cluster: PREDICTED: similar to mFLJ00175
           protein, partial; n=3; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to mFLJ00175 protein,
           partial - Strongylocentrotus purpuratus
          Length = 1048

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 8/82 (9%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWE--------EH 417
           L   + +A DL+  D +  SDPF  +  ++ S  + + ++K+ TL+P W+        E 
Sbjct: 751 LRAYIYQARDLIASDSDSFSDPFAYVSFLNRS--QQSETIKT-TLSPTWDQTLIFDEIEI 807

Query: 418 FSLPMSGTVNEDSLCLEVWDFD 483
           F  P     N   +C+EV+DFD
Sbjct: 808 FGDPQIIAANPPEICIEVFDFD 829


>UniRef50_UPI0000D575D9 Cluster: PREDICTED: similar to CG2999-PC,
            isoform C; n=2; Coelomata|Rep: PREDICTED: similar to
            CG2999-PC, isoform C - Tribolium castaneum
          Length = 2512

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 24/72 (33%), Positives = 35/72 (48%)
 Frame = +1

Query: 268  VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
            + V  A  L+ KD +G SDP+VT+ +      +  T      LNPVW+E F        +
Sbjct: 1491 ITVKSAQGLIAKDKSGTSDPYVTVQV---GKVKKRTRTMPQELNPVWDEKFYFECHN--S 1545

Query: 448  EDSLCLEVWDFD 483
             D + + VWD D
Sbjct: 1546 SDRIKVRVWDED 1557


>UniRef50_UPI0000ECD473 Cluster: Synaptotagmin-like protein 5.; n=1;
           Gallus gallus|Rep: Synaptotagmin-like protein 5. -
           Gallus gallus
          Length = 695

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 4/80 (5%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFS 423
           SG +L V + EA +L      G SD FV  YL+   N + ++ T +    +NP W   F+
Sbjct: 548 SGGILEVVIKEAKNLTAVKSGGTSDTFVKGYLLPDDNKATKHKTPIVKKNVNPQWNHTFA 607

Query: 424 LPMSGTVNEDSLCLE--VWD 477
                + +  ++CLE  VWD
Sbjct: 608 FSGLNSRDIRNVCLELTVWD 627


>UniRef50_Q66VB0 Cluster: No pollen; n=6; Oryza sativa|Rep: No
           pollen - Oryza sativa subsp. japonica (Rice)
          Length = 1086

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 27/69 (39%), Positives = 36/69 (52%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A+ + L V VVEA  L     +G SDPFV + L      R  T+V   TL P W+E FS 
Sbjct: 19  AAPMKLQVRVVEARGLPAVRVDGTSDPFVKLQL---GKRRAKTAVARRTLAPAWDEEFSF 75

Query: 427 PMSGTVNED 453
            + G + E+
Sbjct: 76  -LVGDIAEE 83


>UniRef50_Q00VK1 Cluster: Ca2+-dependent lipid-binding protein
           CLB1/vesicle protein vp115/Granuphilin A, contains C2
           domain; n=2; Ostreococcus|Rep: Ca2+-dependent
           lipid-binding protein CLB1/vesicle protein
           vp115/Granuphilin A, contains C2 domain - Ostreococcus
           tauri
          Length = 1530

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTI-YLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTV 444
           V VV A D+   D +G SD +V   +  +    RY T V   T  P+W + F + +    
Sbjct: 282 VNVVSARDIFASDASGTSDAYVKCGFDTAPIERRYKTQVVKRTRYPMWNDRFLMRIEPGG 341

Query: 445 NEDSLCLEVWDFD 483
           +E ++   VWD D
Sbjct: 342 DEHAIVFTVWDKD 354


>UniRef50_A7Q1H3 Cluster: Chromosome chr7 scaffold_44, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr7 scaffold_44, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 1029

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 24/51 (47%), Positives = 28/51 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L VEVV A +L+PKD  G   PFV +      + R  T VK   LNPVW E
Sbjct: 47  LVVEVVAAHNLMPKDGEGSCSPFVEVEF---ENQRLRTQVKYKDLNPVWSE 94


>UniRef50_O15755 Cluster: R2005 protein; n=4; Dictyostelium
           discoideum|Rep: R2005 protein - Dictyostelium discoideum
           (Slime mold)
          Length = 425

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V ++ A +L+  D  G SDP+V I      S +  T +    LNPVWEE  ++ +   
Sbjct: 218 LKVRIISAGNLIAADIGGTSDPYVKIKSSCLKSFKA-TRIVDKCLNPVWEETLAVEID-C 275

Query: 442 VNEDSLCLEVWDFD 483
           V  + L  +++D D
Sbjct: 276 VERELLMFDIYDHD 289


>UniRef50_A7STM9 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 762

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 2/60 (3%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHF 420
           + G  L V  ++A DL+P D +GL+DP++  Y++   + S+R  T +   TL+P ++E F
Sbjct: 642 SQGSKLIVTDMKARDLMPCDSDGLADPYMRSYVLPDKSKSNRRRTDIAKNTLSPSFDEKF 701



 Score = 42.7 bits (96), Expect = 0.004
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 4/81 (4%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKD----PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           +L +EV EA DLV KD      G SDP+  + +    +  + T  K  TLNP W E F +
Sbjct: 317 VLRIEVTEAKDLVAKDIAVFKKGTSDPYAMVKV---GAQTFRTETKKETLNPKWNEVFEV 373

Query: 427 PMSGTVNEDSLCLEVWDFDPA 489
            +  +  +  + ++++D D A
Sbjct: 374 FVDNSQGQ-KIKIQLFDEDRA 393


>UniRef50_Q6DN12 Cluster: Multiple C2 and transmembrane
           domain-containing protein 2; n=23; Amniota|Rep: Multiple
           C2 and transmembrane domain-containing protein 2 - Homo
           sapiens (Human)
          Length = 878

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L + + E  +LV +D  G SDP+V   L  N    Y + V    LNPVW+E   LP+  
Sbjct: 195 LLTIHLKEGRNLVVRDRCGTSDPYVKFKL--NGKTLYKSKVIYKNLNPVWDEIVVLPIQS 252

Query: 439 TVNEDSLCLEVWDFD 483
              +  L ++V+D D
Sbjct: 253 L--DQKLRVKVYDRD 265



 Score = 40.3 bits (90), Expect = 0.023
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V+V++A DL+  D +G SDPF  + L    + R  T      LNP W + F+ P+  
Sbjct: 510 ILQVKVLKAADLLAADFSGKSDPFCLLEL---GNDRLQTHTVYKNLNPEWNKVFTFPIKD 566

Query: 439 TVNEDSLCLEVWDFD 483
               D L + V+D D
Sbjct: 567 I--HDVLEVTVFDED 579


>UniRef50_Q7SZV6 Cluster: Novel protein; n=3; Euteleostomi|Rep:
           Novel protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 421

 Score = 42.7 bits (96), Expect = 0.004
 Identities = 29/74 (39%), Positives = 39/74 (52%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V+++ ATDL   D +G SDPF T+ L  NS  + +T  K  TLNP W    + P+   
Sbjct: 77  LQVKLIRATDLPSTDISGKSDPFCTLEL-GNSKLQTHTICK--TLNPEWRTALTFPIRDI 133

Query: 442 VNEDSLCLEVWDFD 483
              D L L V+  D
Sbjct: 134 --HDVLVLTVYHED 145


>UniRef50_Q4RRT5 Cluster: Chromosome 16 SCAF15002, whole genome
           shotgun sequence; n=9; Euteleostomi|Rep: Chromosome 16
           SCAF15002, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 351

 Score = 42.7 bits (96), Expect = 0.004
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 4/77 (5%)
 Frame = +1

Query: 265 NVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           ++ V +  DL   DP  G SDP+V  YL+ ++S+  +  TSVK  TLNP + E     ++
Sbjct: 67  HIFVAKCQDLATADPKKGRSDPYVKSYLVPDNSNLGKRKTSVKKKTLNPTFNEILRYRVN 126

Query: 436 -GTVNEDSLCLEVWDFD 483
              +   +L L VW  D
Sbjct: 127 MEYLRTQTLILSVWHHD 143


>UniRef50_A2EWW5 Cluster: C2 domain containing protein; n=2;
           Trichomonas vaginalis G3|Rep: C2 domain containing
           protein - Trichomonas vaginalis G3
          Length = 223

 Score = 42.7 bits (96), Expect = 0.004
 Identities = 26/74 (35%), Positives = 35/74 (47%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L +EV+EA  L P D NG +DP   +YL      +  T     TLNP W + F    +  
Sbjct: 6   LVIEVLEARSLSPSDINGWADPLAVVYLGKKKIGK--TKFIPRTLNPEWNQRFEKEDADI 63

Query: 442 VNEDSLCLEVWDFD 483
              D + +EV D D
Sbjct: 64  --SDDIRIEVCDHD 75


>UniRef50_A7TMU3 Cluster: Putative uncharacterized protein; n=1;
            Vanderwaltozyma polyspora DSM 70294|Rep: Putative
            uncharacterized protein - Vanderwaltozyma polyspora DSM
            70294
          Length = 1295

 Score = 42.7 bits (96), Expect = 0.004
 Identities = 22/57 (38%), Positives = 31/57 (54%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
            L+ ++ VV A +L P   N + D FV+I     S     T++ S T NPVW+E F L
Sbjct: 847  LIYSLRVVAAENLKPLKMNEIPDVFVSIVNTDESKEISKTNIISKTYNPVWDEEFEL 903


>UniRef50_UPI0000DB7557 Cluster: PREDICTED: similar to SMAD specific
           E3 ubiquitin protein ligase 2; n=1; Apis mellifera|Rep:
           PREDICTED: similar to SMAD specific E3 ubiquitin protein
           ligase 2 - Apis mellifera
          Length = 779

 Score = 42.3 bits (95), Expect = 0.006
 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +1

Query: 235 GG*RASGLM-LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWE 411
           GG + +G M + + ++ A +L  KD   L DPF  I  +  S   ++T     TL+P+W 
Sbjct: 5   GGSKRNGAMKIRLTILCARNLARKDLFRLPDPFAKI-TVDGSGQCHSTHTCKATLDPMWN 63

Query: 412 EHFSLPMSGTVNEDSLCLEVWD 477
           +H+ L +     +D + + VW+
Sbjct: 64  QHYDLYIG---KDDGITISVWN 82


>UniRef50_UPI000065F386 Cluster: Homolog of Homo sapiens "Intersectin
            2 (SH3 domain-containing protein 1B) (SH3P18)
            (SH3P18-like WASP associated protein). SPLICE ISOFORM 2;
            n=1; Takifugu rubripes|Rep: Homolog of Homo sapiens
            "Intersectin 2 (SH3 domain-containing protein 1B)
            (SH3P18) (SH3P18-like WASP associated protein). SPLICE
            ISOFORM 2 - Takifugu rubripes
          Length = 1529

 Score = 42.3 bits (95), Expect = 0.006
 Identities = 24/88 (27%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
 Frame = +1

Query: 223  SYQSGG*RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLN 399
            +YQ+   +A+G+  L V ++EAT+L    PNG S+P+  + +    +  + +   + TLN
Sbjct: 1395 AYQARSVKATGIGRLLVTILEATELKAAKPNGKSNPYCEVTM---GAQIFTSRTLNDTLN 1451

Query: 400  PVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
            P W  +    +   + +D LC+ +++ D
Sbjct: 1452 PKWNFNCQFHIK-DIYQDVLCITIFERD 1478


>UniRef50_Q4SKC0 Cluster: Chromosome 13 SCAF14566, whole genome
            shotgun sequence; n=2; Euteleostei|Rep: Chromosome 13
            SCAF14566, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1249

 Score = 42.3 bits (95), Expect = 0.006
 Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSV-KSGTLNPVWEEHFSLPMS 435
            M++V ++ A  L PK    ++ PFV + L  ++  ++ T+V +   LNPVW+   + PM+
Sbjct: 1069 MMDVRIIAARHL-PKPGRSIASPFVEVELCGHTDEKFKTAVYRDNGLNPVWKAP-AEPMT 1126

Query: 436  GTVNEDSL 459
             TV+E  L
Sbjct: 1127 FTVHEHEL 1134


>UniRef50_Q4RZQ9 Cluster: Chromosome 18 SCAF14786, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 18 SCAF14786, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 645

 Score = 42.3 bits (95), Expect = 0.006
 Identities = 25/65 (38%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEHFS 423
           SG  L V V E  +L+P DPNGLSDP+V + L  +  S  +  T      LNP  E    
Sbjct: 108 SGDNLQVTVGEGKNLIPMDPNGLSDPYVKLKLTPDPRSETKKKTKTIRSNLNPQMERDLY 167

Query: 424 LPMSG 438
               G
Sbjct: 168 FQAEG 172


>UniRef50_Q4RF05 Cluster: Chromosome 13 SCAF15122, whole genome
            shotgun sequence; n=3; Euteleostomi|Rep: Chromosome 13
            SCAF15122, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 2421

 Score = 42.3 bits (95), Expect = 0.006
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEH--FSLP 429
            L V V++A +L  +D +  SDPFV +YL+    + ++  T     TLNP W +   +   
Sbjct: 1861 LIVHVLQARNLASRDNDSYSDPFVKVYLLPGRGADNKRRTRYAQKTLNPEWNQTVIYKNI 1920

Query: 430  MSGTVNEDSLCLEVWDFD 483
                + + +L + VWD+D
Sbjct: 1921 HLEQLKKKTLEVTVWDYD 1938


>UniRef50_Q7PSY9 Cluster: ENSANGP00000019593; n=1; Anopheles gambiae
            str. PEST|Rep: ENSANGP00000019593 - Anopheles gambiae
            str. PEST
          Length = 1439

 Score = 42.3 bits (95), Expect = 0.006
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPM 432
            L + V +  DL   D     SDP+V +YL+ + S   +  T VK  TLNPV++E     M
Sbjct: 1119 LEIHVKQCKDLAAVDTKRNRSDPYVKVYLLPDKSKSGKRKTKVKKHTLNPVFDEVLRFHM 1178

Query: 433  S-GTVNEDSLCLEVWDFD 483
            S  ++   ++ + VW  D
Sbjct: 1179 SLNSLQTRTIWITVWHSD 1196


>UniRef50_Q9HCH3 Cluster: Copine-5; n=22; Euteleostomi|Rep: Copine-5
           - Homo sapiens (Human)
          Length = 593

 Score = 42.3 bits (95), Expect = 0.006
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 7/74 (9%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHRYN----TSVKSGTLNPVWEEHFSLPMSGTVNE 450
           A  L  KD  G SDPF+  Y  SN    +     T V   TLNPVW+  FS+P+    N 
Sbjct: 185 ANKLDKKDFFGKSDPFLVFY-RSNEDGTFTICHKTEVMKNTLNPVWQT-FSIPVRALCNG 242

Query: 451 D---SLCLEVWDFD 483
           D   ++ +EV+D+D
Sbjct: 243 DYDRTIKVEVYDWD 256


>UniRef50_O64492 Cluster: F20D22.8 protein; n=7; Magnoliophyta|Rep:
           F20D22.8 protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 1012

 Score = 41.9 bits (94), Expect = 0.008
 Identities = 22/51 (43%), Positives = 28/51 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L VE+V A +L+PKD    S PFV +      + R  T VK   LNP+W E
Sbjct: 13  LVVEIVGAHNLMPKDGEDSSSPFVEVQF---ENQRLRTKVKPKDLNPIWNE 60


>UniRef50_A3BDF6 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 1003

 Score = 41.9 bits (94), Expect = 0.008
 Identities = 26/66 (39%), Positives = 34/66 (51%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           + L V VVEA  L     +G SDPFV + L      R  T+V   TL P W+E FS  + 
Sbjct: 1   MKLQVRVVEARGLPAVRVDGTSDPFVKLQL---GKRRAKTAVARRTLAPAWDEEFSF-LV 56

Query: 436 GTVNED 453
           G + E+
Sbjct: 57  GDIAEE 62


>UniRef50_Q7QE48 Cluster: ENSANGP00000016777; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000016777 - Anopheles gambiae
           str. PEST
          Length = 369

 Score = 41.9 bits (94), Expect = 0.008
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHR-YNTSVKSGTLNPVWEEHFSLPMS- 435
           L V +VEA DL P    G  DP+V +YL  +   R   T+V     +P +++  S P+  
Sbjct: 126 LLVHLVEAQDLTPAGDTGFRDPYVKMYLEPDEEQRTQQTAVHRTETHPYFDQQLSFPLKP 185

Query: 436 GTVNEDSLCLEVWDFD 483
             + + +  L++ D+D
Sbjct: 186 RNLVKSNFVLQLLDYD 201


>UniRef50_Q5DEH7 Cluster: SJCHGC06647 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC06647 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 150

 Score = 41.9 bits (94), Expect = 0.008
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 4/59 (6%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGT----LNPVWEEHFSLPM 432
           V V E   L   D +GLSDP+V +YLM    +  + S K+ T    LNP++EE+F  P+
Sbjct: 33  VIVHECQHLSGVDKDGLSDPYVKLYLMDLHENVVSDSKKTKTVKDNLNPIYEENFQFPI 91


>UniRef50_Q4DCX8 Cluster: Putative uncharacterized protein; n=5;
           Trypanosoma|Rep: Putative uncharacterized protein -
           Trypanosoma cruzi
          Length = 258

 Score = 41.9 bits (94), Expect = 0.008
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V +  A +L      GL DP+  + +     H Y T V + +LNPVW E F   ++  
Sbjct: 4   LQVCICAARNLHDSQVFGLPDPYCRVRM---GDHGYKTKVINNSLNPVWNETFRFQVADE 60

Query: 442 VNEDSLCLEVWD 477
            +   LC+E+W+
Sbjct: 61  -STAQLCVELWN 71


>UniRef50_A0E0J1 Cluster: Chromosome undetermined scaffold_71, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_71, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 2787

 Score = 41.9 bits (94), Expect = 0.008
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
            ++V+++ A+ L   D  G SDPFV   L S+ + +  T +K  TL+P+W+   SL
Sbjct: 1881 IDVKIISASQLYNADITGKSDPFVECGL-SSETKKMQTPIKENTLDPIWDFQGSL 1934



 Score = 33.9 bits (74), Expect = 2.0
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 4/69 (5%)
 Frame = +1

Query: 289  DLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNED----S 456
            +L  KD  GLSDPFV I +   S+  + T+ +   L+  W +           ED     
Sbjct: 2192 NLENKDITGLSDPFVEIKISKGSTTAFKTTTQDDKLDCFWIDCGEYLFKEVTQEDLSLLR 2251

Query: 457  LCLEVWDFD 483
            L + V+D+D
Sbjct: 2252 LYINVFDYD 2260


>UniRef50_UPI0000F2B5FC Cluster: PREDICTED: similar to hCG1810857,;
            n=1; Monodelphis domestica|Rep: PREDICTED: similar to
            hCG1810857, - Monodelphis domestica
          Length = 1287

 Score = 41.5 bits (93), Expect = 0.010
 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 3/78 (3%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYL---MSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
            ++ V VV A +L PKD NGL DP+V + L   +  + H Y    K  T++P++   F L 
Sbjct: 843  LVRVYVVRAFNLQPKDNNGLCDPYVILKLGKTVLGNRHDY----KPNTVDPIFGRMFELK 898

Query: 430  MSGTVNEDSLCLEVWDFD 483
             +  + +D L + ++DFD
Sbjct: 899  CTIPLEKD-LKITLFDFD 915


>UniRef50_UPI0000DB751D Cluster: PREDICTED: similar to bitesize
           CG33555-PD, isoform D; n=2; Apis mellifera|Rep:
           PREDICTED: similar to bitesize CG33555-PD, isoform D -
           Apis mellifera
          Length = 568

 Score = 41.5 bits (93), Expect = 0.010
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 5/81 (6%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKD-PNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEE--HF 420
           L   V V +  +L P D     SDP+V +YL+   + S +  T VK  TLNP + E   F
Sbjct: 257 LTFEVHVTKCKNLAPVDVKRKRSDPYVKVYLLPDKSKSGKRKTKVKKHTLNPEFNETLKF 316

Query: 421 SLPMSGTVNEDSLCLEVWDFD 483
            + +SG +   +L L VW  D
Sbjct: 317 HMSLSG-LETRTLWLTVWHSD 336


>UniRef50_UPI00005A965F Cluster: PREDICTED: similar to B/K protein;
           n=1; Canis lupus familiaris|Rep: PREDICTED: similar to
           B/K protein - Canis familiaris
          Length = 296

 Score = 41.5 bits (93), Expect = 0.010
 Identities = 27/71 (38%), Positives = 35/71 (49%), Gaps = 4/71 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFS--LP 429
           LNV+V+ A  L+  D    SDPFVTI L+          TS   GTL+P + E FS  +P
Sbjct: 162 LNVDVIRAKQLLQTDVTQGSDPFVTIQLVHGLKLVKTKKTSFLRGTLDPFYNESFSFKVP 221

Query: 430 MSGTVNEDSLC 462
                N   +C
Sbjct: 222 QEELENASLVC 232


>UniRef50_Q7SY69 Cluster: LOC398672 protein; n=4; Euteleostomi|Rep:
           LOC398672 protein - Xenopus laevis (African clawed frog)
          Length = 823

 Score = 41.5 bits (93), Expect = 0.010
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 4/79 (5%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFS 423
           SG ++ V + +A +L      G SD FV  YL+  +N S ++ T V   ++NP W   F+
Sbjct: 673 SGGLVEVFIKDAKNLTAMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKSVNPEWNHTFT 732

Query: 424 LPMSGTVNEDSLCLE--VW 474
                T +  ++C+E  VW
Sbjct: 733 FSGLQTSDLSNVCVELTVW 751



 Score = 33.5 bits (73), Expect = 2.7
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDL-VPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPM 432
           LNV V    +L V  +    +DP+V  YL+ + S   +  T +K+ T +P + E     +
Sbjct: 510 LNVVVKSCRNLAVADEKKNRTDPYVKAYLLPDKSRQSKRKTKIKTNTTDPDFNETLKYVI 569

Query: 433 SGTVNED-SLCLEVWDFD 483
           S T  E  +L L VW  D
Sbjct: 570 SHTQLETRTLQLTVWHND 587


>UniRef50_Q4SB00 Cluster: Chromosome undetermined SCAF14678, whole
            genome shotgun sequence; n=8; Bilateria|Rep: Chromosome
            undetermined SCAF14678, whole genome shotgun sequence -
            Tetraodon nigroviridis (Green puffer)
          Length = 2224

 Score = 41.5 bits (93), Expect = 0.010
 Identities = 25/75 (33%), Positives = 42/75 (56%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++ V +V+A  L PKD NG  DP+V I L   + + +   +   TL+P++ + F L  S 
Sbjct: 1615 LVRVYIVQAQGLQPKDTNGKCDPYVKITLGKKTVNDHENYIPC-TLDPIFGKMFELTCSL 1673

Query: 439  TVNEDSLCLEVWDFD 483
             + +D L + V+D D
Sbjct: 1674 PLEKD-LRVMVYDHD 1687


>UniRef50_Q69MT7 Cluster: C2 domain-containing protein-like; n=7;
           Magnoliophyta|Rep: C2 domain-containing protein-like -
           Oryza sativa subsp. japonica (Rice)
          Length = 612

 Score = 41.5 bits (93), Expect = 0.010
 Identities = 25/94 (26%), Positives = 46/94 (48%)
 Frame = +1

Query: 217 ATSYQSGG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTL 396
           A  Y+ G    S  ++ +E++ A +L+  + NG SDP+  I        R+++ V  G+ 
Sbjct: 76  ADKYKGGSSGPSAYVVKLELLAAKNLIAANLNGTSDPYALI--TCGEEKRFSSMVP-GSR 132

Query: 397 NPVWEEHFSLPMSGTVNEDSLCLEVWDFDPAETV 498
           NP+W E F+  +     + ++ +  WD     TV
Sbjct: 133 NPMWGEEFNFFVDSLPVKINVTIYDWDIVWKSTV 166


>UniRef50_P91493 Cluster: Synaptotagmin protein 4; n=2;
           Caenorhabditis|Rep: Synaptotagmin protein 4 -
           Caenorhabditis elegans
          Length = 381

 Score = 41.5 bits (93), Expect = 0.010
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRY---NTSVKSGTLNPVWEEHF 420
           L V V++A  L  ++  G +DPFV +YL   S  R     T V+  TLNPV+ E F
Sbjct: 266 LTVVVLKARGLGGRNDAGTADPFVKLYLRKESGERIVKKRTHVRRSTLNPVYNESF 321



 Score = 38.7 bits (86), Expect = 0.072
 Identities = 16/45 (35%), Positives = 26/45 (57%)
 Frame = +1

Query: 292 LVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           +V +D   L DP+V + L+    HR  T +   T +PV+EE F++
Sbjct: 142 VVSRDGQCLLDPYVKLQLLPEREHRVKTRIVRSTTSPVYEEQFAM 186


>UniRef50_A1CG04 Cluster: C2 domain protein; n=9; Pezizomycotina|Rep:
            C2 domain protein - Aspergillus clavatus
          Length = 1362

 Score = 41.5 bits (93), Expect = 0.010
 Identities = 23/80 (28%), Positives = 39/80 (48%)
 Frame = +1

Query: 244  RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
            +++  +  ++VVEA DL   D NG SDP+V +           T +    LNP W++   
Sbjct: 914  KSTTYVFTIKVVEAEDLKACDMNGGSDPYV-VLTDEYQKRIAKTRIIYNNLNPRWDDAVD 972

Query: 424  LPMSGTVNEDSLCLEVWDFD 483
            +   G +N   +   +WD+D
Sbjct: 973  ITTQGPLN---IIATIWDWD 989


>UniRef50_O75923 Cluster: Dysferlin; n=39; Deuterostomia|Rep:
            Dysferlin - Homo sapiens (Human)
          Length = 2080

 Score = 41.5 bits (93), Expect = 0.010
 Identities = 23/75 (30%), Positives = 41/75 (54%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++ + +V A  L PKDPNG  DP++ I +   S    +  +   TL PV+ + F L  + 
Sbjct: 1579 LVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPC-TLEPVFGKMFELTCTL 1637

Query: 439  TVNEDSLCLEVWDFD 483
             + +D L + ++D+D
Sbjct: 1638 PLEKD-LKITLYDYD 1651



 Score = 34.3 bits (75), Expect = 1.5
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 8/82 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWE--------EH 417
            L   + +A DL   D +  SDP+  +  +  S     T V   TLNP W+        E 
Sbjct: 1154 LRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQ---KTVVVKNTLNPTWDQTLIFYEIEI 1210

Query: 418  FSLPMSGTVNEDSLCLEVWDFD 483
            F  P +      S+ +E++D D
Sbjct: 1211 FGEPATVAEQPPSIVVELYDHD 1232


>UniRef50_UPI000155F647 Cluster: PREDICTED: similar to hCG1810857;
            n=1; Equus caballus|Rep: PREDICTED: similar to hCG1810857
            - Equus caballus
          Length = 2088

 Score = 41.1 bits (92), Expect = 0.013
 Identities = 24/75 (32%), Positives = 43/75 (57%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++ V VV A +L P+D NGL DP+V I  +  ++       +  TL+P++   F L  + 
Sbjct: 1519 LVRVYVVRAINLQPQDLNGLCDPYV-ILKLGKTTCGNRDKYQPNTLDPIFGTMFELSCTI 1577

Query: 439  TVNEDSLCLEVWDFD 483
             + +D L ++++DFD
Sbjct: 1578 PLEKD-LEIQLYDFD 1591


>UniRef50_UPI00006A1671 Cluster: UPI00006A1671 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A1671 UniRef100 entry -
           Xenopus tropicalis
          Length = 980

 Score = 41.1 bits (92), Expect = 0.013
 Identities = 20/55 (36%), Positives = 29/55 (52%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           SG  L   + +A  L+  D +GLSDPF  +  +   SH   T + S TL+P W +
Sbjct: 92  SGFELRAHMYQARGLIAADTSGLSDPFAKVTFL---SHCQTTKIISQTLSPTWNQ 143



 Score = 37.5 bits (83), Expect = 0.17
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 2/78 (2%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYL-MSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +++ V +V   +L P DP+G SDP++ + L  +    R N   K   LNPV+   F   M
Sbjct: 573 VLIRVYIVAGFNLSPADPDGKSDPYIVLRLGKTEIKDRDNYIPKQ--LNPVFGRSFE--M 628

Query: 433 SGTVNEDS-LCLEVWDFD 483
             T  +DS L + ++D D
Sbjct: 629 QATFPKDSILSIVIYDHD 646


>UniRef50_UPI000065FBA3 Cluster: multiple C2-domains with two
           transmembrane regions 2; n=1; Takifugu rubripes|Rep:
           multiple C2-domains with two transmembrane regions 2 -
           Takifugu rubripes
          Length = 672

 Score = 41.1 bits (92), Expect = 0.013
 Identities = 24/55 (43%), Positives = 32/55 (58%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           L V+V+ A DL   D NG S+PF  + L  NS  + +T  K  TLNP W + F+L
Sbjct: 322 LQVKVIRANDLPAMDLNGKSNPFCVVEL-GNSKLQTHTVYK--TLNPEWSKAFTL 373


>UniRef50_A7S352 Cluster: Predicted protein; n=2; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 296

 Score = 41.1 bits (92), Expect = 0.013
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 6/80 (7%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+V + +A  L P D  G SDP+V ++L+  ++ S++  +  K  TLNPV+ E  +L   
Sbjct: 35  LDVVLHDAKGLKPMDHGGTSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNE--TLTYY 92

Query: 436 GTVNED----SLCLEVWDFD 483
           G   E+    +L L+V+D D
Sbjct: 93  GITEEEISSKTLRLQVFDED 112


>UniRef50_A2EUT8 Cluster: C2 domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: C2 domain containing
           protein - Trichomonas vaginalis G3
          Length = 271

 Score = 41.1 bits (92), Expect = 0.013
 Identities = 23/77 (29%), Positives = 40/77 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L+V  +EA DL   D  G  D ++ I+ + +++H++         NP W + F L +S  
Sbjct: 5   LHVRAIEAQDLPKMDTFGRCDCYL-IFSLDSNAHKFRGKTIKNNYNPRWNQDFHLRVSNF 63

Query: 442 VNEDSLCLEVWDFDPAE 492
            + DSL +++ D D  E
Sbjct: 64  AS-DSLNIKLMDEDAIE 79


>UniRef50_UPI00004D1F3F Cluster: UPI00004D1F3F related cluster;
           n=11; Xenopus tropicalis|Rep: UPI00004D1F3F UniRef100
           entry - Xenopus tropicalis
          Length = 767

 Score = 40.7 bits (91), Expect = 0.018
 Identities = 29/77 (37%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKD-PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           L + V+ A +LV KD     SDPFV I         + TSV S TLNP W + F +  S 
Sbjct: 181 LRIHVLGAKNLVAKDFITKKSDPFVVI---RGGGKTFKTSVISKTLNPRWNQIFEILFSE 237

Query: 439 TVNEDSLCLEVWDFDPA 489
              ++ +  EV+D D A
Sbjct: 238 LPGQE-IVFEVFDRDEA 253



 Score = 40.7 bits (91), Expect = 0.018
 Identities = 29/77 (37%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKD-PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           L + V+ A +LV KD     SDPFV I         + TSV S TLNP W + F +  S 
Sbjct: 504 LRIHVLGAKNLVAKDFITKKSDPFVVI---RGGGKTFKTSVISKTLNPRWNQIFEILFSE 560

Query: 439 TVNEDSLCLEVWDFDPA 489
              ++ +  EV+D D A
Sbjct: 561 LPGQE-IVFEVFDRDEA 576


>UniRef50_Q4T1V0 Cluster: Chromosome undetermined SCAF10467, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF10467, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 767

 Score = 40.7 bits (91), Expect = 0.018
 Identities = 21/54 (38%), Positives = 31/54 (57%)
 Frame = +1

Query: 271 EVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +V+EA DL P+D +G SDPF   ++ +N  H   TS+   T  P W+E   L +
Sbjct: 100 KVIEARDLAPRDISGTSDPFAR-FIFNN--HSAETSIIKKTRFPHWDETLELDL 150


>UniRef50_Q4RY01 Cluster: Chromosome 11 SCAF14979, whole genome
           shotgun sequence; n=3; Clupeocephala|Rep: Chromosome 11
           SCAF14979, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 1605

 Score = 40.7 bits (91), Expect = 0.018
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 6/81 (7%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDP------NGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           +L + ++   +L+PKD        G SDP+V I +       + + V  G LNP W E +
Sbjct: 679 LLRIHLLAGQNLIPKDNFMGGMVKGKSDPYVKINI---GGETFTSQVIKGNLNPTWNEMY 735

Query: 421 SLPMSGTVNEDSLCLEVWDFD 483
            + ++    ++ L LEV+D+D
Sbjct: 736 EVILTQLPGQE-LHLEVFDYD 755



 Score = 36.3 bits (80), Expect = 0.38
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 6/81 (7%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDP------NGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
            +L + ++EA +LV KD        G SDP+V I   S     + + V    LNP W E +
Sbjct: 1233 VLRIHLLEAQNLVAKDNLMGGMVKGKSDPYVKI---SIGGAVFKSHVIKENLNPTWNEMY 1289

Query: 421  SLPMSGTVNEDSLCLEVWDFD 483
             L ++G  + + + +E +D D
Sbjct: 1290 ELVLNGHTDHE-IKIEAYDKD 1309



 Score = 33.9 bits (74), Expect = 2.0
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 6/81 (7%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDP------NGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
            ++ + ++EA  L+ KD        G SDP+  I   S     + +SV    LNPVW E +
Sbjct: 891  LVRIILLEAQSLIAKDNMMGGMVKGKSDPYAKI---SVGEFTFKSSVIKENLNPVWNEMY 947

Query: 421  SLPMSGTVNEDSLCLEVWDFD 483
             + +     +  + +E++D D
Sbjct: 948  EVVLKPESEQVQVKIELFDKD 968


>UniRef50_Q4REK5 Cluster: Chromosome 10 SCAF15123, whole genome
            shotgun sequence; n=4; Clupeocephala|Rep: Chromosome 10
            SCAF15123, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1931

 Score = 40.7 bits (91), Expect = 0.018
 Identities = 21/76 (27%), Positives = 44/76 (57%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            +++ + V+ ATDL P D NG +DP++ I L   +  +   +  S  LNP++ + F +  +
Sbjct: 1314 VLVRIYVIRATDLHPADINGKADPYIAIKL-GKTEIKDKENYISKQLNPLFGKSFDIEAT 1372

Query: 436  GTVNEDSLCLEVWDFD 483
              + + +L + ++D+D
Sbjct: 1373 FPM-DSTLTVSIYDWD 1387



 Score = 34.3 bits (75), Expect = 1.5
 Identities = 18/51 (35%), Positives = 25/51 (49%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L V + +A  L   D  GLSDPF  ++  + S     T V   TL P W++
Sbjct: 774 LRVHLYQARSLFAADSTGLSDPFARVFFSTQSQ---VTEVLPETLCPTWDQ 821


>UniRef50_Q00TV8 Cluster: RBF1_CAEEL Rabphilin 1; n=1; Ostreococcus
           tauri|Rep: RBF1_CAEEL Rabphilin 1 - Ostreococcus tauri
          Length = 625

 Score = 40.7 bits (91), Expect = 0.018
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 6/80 (7%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN-SSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           L V +  A  L   DP G S+ ++T+ +  N    R+ TS+  GT +P WE   S   + 
Sbjct: 369 LRVNMKRAVGLPSCDPFGSSNSYITVEMTGNYEPERHRTSICRGTTSPEWEHWMSFLSTS 428

Query: 439 -----TVNEDSLCLEVWDFD 483
                 +NE++L L V+  D
Sbjct: 429 RQQCRNLNEETLTLRVYVLD 448



 Score = 31.9 bits (69), Expect = 8.2
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +1

Query: 349 SNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           + SSH+  TSV+  TL+PVW+E F        +E  +   ++D D
Sbjct: 264 AKSSHQ--TSVQKQTLDPVWDEEFEFERVDRNSESYVLFRLYDRD 306


>UniRef50_O16700 Cluster: Synaptotagmin protein 5; n=2;
           Caenorhabditis|Rep: Synaptotagmin protein 5 -
           Caenorhabditis elegans
          Length = 458

 Score = 40.7 bits (91), Expect = 0.018
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L + V +A +L P D  G SDP+V I    N        +S K   LNPV+ E   F +P
Sbjct: 316 LYINVSKAYNLRPMDITGASDPYVKIEQTFNGKRFKSKKSSTKRANLNPVFHETLVFDIP 375

Query: 430 MSGTVNEDSLCLEVWDFD 483
            S  + E ++ ++V D+D
Sbjct: 376 -SSQIAETNILIQVMDWD 392



 Score = 35.9 bits (79), Expect = 0.51
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS- 435
           +L + V+ A +L  +D     DP+V +YL+        T +   T +P + E FS  +S 
Sbjct: 184 VLMLHVIRANNLPVEDKGVTVDPYVKMYLLPERRGHCKTRICKKTNDPEFNEMFSFDVSF 243

Query: 436 GTVNEDSLCLEVWDFD 483
             +    L   V+DFD
Sbjct: 244 NNLANRMLQFTVYDFD 259


>UniRef50_A7SG61 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 574

 Score = 40.7 bits (91), Expect = 0.018
 Identities = 27/78 (34%), Positives = 42/78 (53%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           SG++L V +   + L+  D +G SDP+  I   SN      TSV  GT+NPVW+    + 
Sbjct: 415 SGVLL-VALHSGSKLLSMDADGYSDPYCII--TSNREKVKTTSVVEGTVNPVWDSITEI- 470

Query: 430 MSGTVNEDSLCLEVWDFD 483
           +   +N+ +L   V+D D
Sbjct: 471 LVKDINKTNLHFFVYDRD 488


>UniRef50_Q9LNV0 Cluster: F22G5.35; n=1; Arabidopsis thaliana|Rep:
           F22G5.35 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 352

 Score = 40.3 bits (90), Expect = 0.023
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 2/75 (2%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKD-PNGLSDPFVTIYLMSNSSHRYNT-SVKSGTLNPVWEEHFSLP 429
           L L V VV A  L   +  NG   P+V +YL  +  H  +T S  S ++ PVW E  +LP
Sbjct: 7   LDLVVTVVSAKHLKNVNWRNGDLKPYVVLYL--DQDHPLSTRSDDSSSIKPVWNERITLP 64

Query: 430 MSGTVNEDSLCLEVW 474
           ++ +V+E  L +EV+
Sbjct: 65  LTRSVHESVLNIEVF 79


>UniRef50_Q0D8E3 Cluster: Os07g0165100 protein; n=5; Oryza
           sativa|Rep: Os07g0165100 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 1037

 Score = 40.3 bits (90), Expect = 0.023
 Identities = 22/63 (34%), Positives = 28/63 (44%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L VEVVEA +L+PKD  G S P+  +        R  T      LNP W E      +G 
Sbjct: 10  LVVEVVEARNLLPKDGTGTSSPYARV---DFDGQRRKTHTVPRELNPAWNEALEFNFAGV 66

Query: 442 VNE 450
             +
Sbjct: 67  AGD 69


>UniRef50_A5AXU7 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 916

 Score = 40.3 bits (90), Expect = 0.023
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L VE+++A+DL+PKD  G + PFV +           T  K   LNP W E
Sbjct: 4   LVVEILDASDLMPKDGQGSASPFVEV---DFDKQPLRTQTKHKDLNPTWNE 51


>UniRef50_Q8MQJ2 Cluster: RE01517p; n=4; Sophophora|Rep: RE01517p -
           Drosophila melanogaster (Fruit fly)
          Length = 787

 Score = 40.3 bits (90), Expect = 0.023
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLV-PKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           G+ L V V+EA  L+ P     L D FV IYL+ +      T V  GTL P + E F   
Sbjct: 500 GMELTVSVLEAKGLICPFSVESL-DTFVRIYLVPDHPGAMQTKVVKGTLTPSYNESFDFW 558

Query: 430 MSGTVNEDSLCLEVWDFDPAETV 498
           +       SL   ++   PA T+
Sbjct: 559 LHKRQARHSLWFHLYHNGPAHTL 581


>UniRef50_Q54YT1 Cluster: C2 domain-containing protein; n=1;
           Dictyostelium discoideum AX4|Rep: C2 domain-containing
           protein - Dictyostelium discoideum AX4
          Length = 132

 Score = 40.3 bits (90), Expect = 0.023
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 4/65 (6%)
 Frame = +1

Query: 301 KDPNGLSDPFVTIYLMSN----SSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLE 468
           +D NG +DPFV +  +      S   + ++VK  TLNP W E+  + +   VN+  L +E
Sbjct: 24  QDLNGKADPFVQVRAIKTDGTYSKVLFKSTVKKATLNPAWNEYDKIKVKDYVND--LLVE 81

Query: 469 VWDFD 483
           ++D D
Sbjct: 82  LYDED 86


>UniRef50_UPI0000E23F62 Cluster: PREDICTED: similar to group IVB
           cytosolic phospholipase A2 beta splice variant 2,
           partial; n=1; Pan troglodytes|Rep: PREDICTED: similar to
           group IVB cytosolic phospholipase A2 beta splice variant
           2, partial - Pan troglodytes
          Length = 355

 Score = 39.9 bits (89), Expect = 0.031
 Identities = 24/75 (32%), Positives = 41/75 (54%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V V++A  L  KD    SD +VT++L +  SHR  T     + +PVW + F   +  
Sbjct: 11  LLTVHVLQAHRLPAKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVWNQSFHFRIHR 70

Query: 439 TVNEDSLCLEVWDFD 483
            + ++ + L+V+D D
Sbjct: 71  QL-KNVMELKVFDRD 84


>UniRef50_UPI0000ECB77F Cluster: family with sequence similarity 62
           (C2 domain containing), member C; n=2; Gallus
           gallus|Rep: family with sequence similarity 62 (C2
           domain containing), member C - Gallus gallus
          Length = 825

 Score = 39.9 bits (89), Expect = 0.031
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 5/81 (6%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDP-----NGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           ++ V ++EA +LV KD       G SDP+  + L    + +Y +   S  LNP+W E F 
Sbjct: 316 VIRVHLLEAENLVQKDNFLGAIRGKSDPYALLRL---GTVQYRSKTISRDLNPIWNETFE 372

Query: 424 LPMSGTVNEDSLCLEVWDFDP 486
             +   + +D L ++++D DP
Sbjct: 373 FVVHEVLGQD-LEVDLYDADP 392



 Score = 37.9 bits (84), Expect = 0.13
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 2/46 (4%)
 Frame = +1

Query: 289 DLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHF 420
           +L+P    G+ DP+V IYL+ +   + R  TSVK  TLNP ++E F
Sbjct: 730 NLIPSSNRGV-DPYVRIYLLPDRRWTSRKKTSVKKRTLNPQYDEKF 774


>UniRef50_Q6PBU6 Cluster: Synaptotagmin IV; n=7; Elopocephala|Rep:
           Synaptotagmin IV - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 439

 Score = 39.9 bits (89), Expect = 0.031
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGL-SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           V + EA  L P D   L SDP++ + L+    H+  T V   TL+P ++E FS
Sbjct: 185 VHIKEAHGLSPTDEQSLTSDPYIKLTLLPEKKHKVKTRVLRKTLDPAFDETFS 237


>UniRef50_Q4RZ64 Cluster: Chromosome undetermined SCAF14961, whole
           genome shotgun sequence; n=4; Tetraodontidae|Rep:
           Chromosome undetermined SCAF14961, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 804

 Score = 39.9 bits (89), Expect = 0.031
 Identities = 21/68 (30%), Positives = 36/68 (52%)
 Frame = +1

Query: 274 VVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNED 453
           V+ A +L  KD   L DPF  + ++  S   ++T     TL+P W +H+ L +  T   D
Sbjct: 20  VLCAKNLAKKDFFRLPDPFAKV-VVDGSGQCHSTDTVKSTLDPKWNQHYDLYIGKT---D 75

Query: 454 SLCLEVWD 477
           S+ + +W+
Sbjct: 76  SITISIWN 83


>UniRef50_A2X930 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 422

 Score = 39.9 bits (89), Expect = 0.031
 Identities = 29/74 (39%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           LN+ VV    L  +D    SDP+V + L      +  T+VK   LNPVW E   L +S  
Sbjct: 269 LNITVVRGIQLAVRDML-TSDPYVVLTL---GEQKAQTTVKPSDLNPVWNE--VLKISIP 322

Query: 442 VNEDSLCLEVWDFD 483
            N   L LEV+D D
Sbjct: 323 RNYGPLKLEVYDHD 336


>UniRef50_A7S4Y1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 572

 Score = 39.9 bits (89), Expect = 0.031
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKD-PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           L V++++  DL  KD     S P+V IY + +  H + T++ +  LNP + E F +    
Sbjct: 319 LFVKILQCRDLPAKDLRRNTSSPYVRIYALPSRRHNHRTNIVTNNLNPTFNELFIISGLT 378

Query: 439 TVNEDSLCLEV 471
            +    L L++
Sbjct: 379 LMEVQQLALQI 389


>UniRef50_Q2WGJ9 Cluster: C8orfK23 protein; n=24; Euteleostomi|Rep:
           C8orfK23 protein - Homo sapiens (Human)
          Length = 1857

 Score = 39.9 bits (89), Expect = 0.031
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L   + +A  L+  D NGLSDPF  +  +   SH   T + S TL+P W +
Sbjct: 828 LRAHMYQARGLIAADSNGLSDPFAKVTFL---SHCQTTKIISQTLSPTWNQ 875



 Score = 36.7 bits (81), Expect = 0.29
 Identities = 22/76 (28%), Positives = 38/76 (50%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            +++ V +V A +L P DP+G SDP++ I L        +  +    LNPV+   F +  +
Sbjct: 1356 VLIRVYIVAAFNLSPADPDGKSDPYIVIKLGKTEIKDRDKYIPK-QLNPVFGRSFEI-QA 1413

Query: 436  GTVNEDSLCLEVWDFD 483
                E  L + ++D D
Sbjct: 1414 TFPKESLLSILIYDHD 1429


>UniRef50_P27715 Cluster: Phorbol ester/diacylglycerol-binding protein
            unc-13; n=8; Bilateria|Rep: Phorbol
            ester/diacylglycerol-binding protein unc-13 -
            Caenorhabditis elegans
          Length = 2155

 Score = 39.9 bits (89), Expect = 0.031
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + V+ A  L+ KD  G SDP+VT   +  +  R  T  +   LNPVW E F      +
Sbjct: 1159 ITLTVLCAQGLIAKDKTGKSDPYVTAQ-VGKTKRRTRTIHQE--LNPVWNEKFHFECHNS 1215

Query: 442  VNEDSLCLEVWDFD 483
               D + + VWD D
Sbjct: 1216 T--DRIKVRVWDED 1227


>UniRef50_Q8TDW5 Cluster: Synaptotagmin-like protein 5; n=6;
           Euarchontoglires|Rep: Synaptotagmin-like protein 5 -
           Homo sapiens (Human)
          Length = 730

 Score = 39.9 bits (89), Expect = 0.031
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 4/80 (5%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           SG +L V + EA +L      G SD FV  YL+ + S   ++ T V   ++NP W   F 
Sbjct: 585 SGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFM 644

Query: 424 LPMSGTVNEDSLCLE--VWD 477
                  +  ++CLE  +WD
Sbjct: 645 FSGIHPQDIKNVCLELTIWD 664


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 506,516,326
Number of Sequences: 1657284
Number of extensions: 9605595
Number of successful extensions: 25686
Number of sequences better than 10.0: 430
Number of HSP's better than 10.0 without gapping: 24675
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25554
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 29273652170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).