SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0106
         (711 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo...    64   2e-09
UniRef50_Q7TP33 Cluster: Aa1-330; n=1; Rattus norvegicus|Rep: Aa...    53   6e-06
UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0...    53   6e-06
UniRef50_Q3U1V2 Cluster: B6-derived CD11 +ve dendritic cells cDN...    46   0.001
UniRef50_Q6CQE6 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    46   0.001
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    44   0.005
UniRef50_A7SUM0 Cluster: Predicted protein; n=5; Nematostella ve...    43   0.006
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    40   0.080
UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1; ...    38   0.32 
UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ...    38   0.32 
UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1; ...    37   0.43 
UniRef50_Q99JC0 Cluster: RRNA promoter binding protein; n=28; Eu...    36   0.74 
UniRef50_Q2RRH7 Cluster: FeoA; n=1; Rhodospirillum rubrum ATCC 1...    36   0.74 
UniRef50_Q4T8E7 Cluster: Chromosome undetermined SCAF7818, whole...    36   0.98 
UniRef50_Q1EHT8 Cluster: Putative uncharacterized protein P0711E...    28   1.0  
UniRef50_UPI0000F336FF Cluster: PTB-containing, cubilin and LRP1...    33   6.9  
UniRef50_Q0UJW1 Cluster: Predicted protein; n=1; Phaeosphaeria n...    33   9.2  

>UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10;
           Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana
           tabacum (Common tobacco)
          Length = 530

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 39/74 (52%), Positives = 43/74 (58%)
 Frame = -1

Query: 711 LLEFLHVDIQSTGQKSHCVNTREGHRNALF*LDSRIPLVRASSELTVERRSYRIVPIAHE 532
           L+EFLH DIQSTG+ +   N R  HRNALF L+SRIPLVR SSEL V R           
Sbjct: 131 LVEFLHFDIQSTGRIT-LRNIRRDHRNALFKLNSRIPLVRTSSELAVRRPGKAPEGTVPS 189

Query: 531 TKPTRLTAGRSAEG 490
             P R  A RS  G
Sbjct: 190 PSPGRHAATRSRRG 203



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 17/25 (68%), Positives = 19/25 (76%)
 Frame = -2

Query: 254 TSLTYIILSTRGSSPWRPAADMGTN 180
           TSL YI+ STRG SPWRP A +G N
Sbjct: 239 TSLAYIVPSTRGCSPWRPDAFVGGN 263


>UniRef50_Q7TP33 Cluster: Aa1-330; n=1; Rattus norvegicus|Rep:
           Aa1-330 - Rattus norvegicus (Rat)
          Length = 151

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 31/75 (41%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSR-SEPYLPSIGFHGTR 46
           RLFTLETCCGYGY PAR L  HP P   +    +    + R + + + P L +  F G  
Sbjct: 25  RLFTLETCCGYGYGPARDL--HPLPRIFKGQRELTGRRRNRDAFQGTGPSLGANPFQGAL 82

Query: 45  TLRQKRKLFPDLSAA 1
              +KR+L P L  A
Sbjct: 83  PFTKKRELSPGLPPA 97


>UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep:
           LRRG00134 - Rattus norvegicus (Rat)
          Length = 221

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 31/75 (41%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSR-SEPYLPSIGFHGTR 46
           RLFTLETCCGYGY PAR L  HP P   +    +    + R + + + P L +  F G  
Sbjct: 95  RLFTLETCCGYGYGPARDL--HPLPRIFKGQRELTGRRRNRDAFQGTGPSLGANPFQGAL 152

Query: 45  TLRQKRKLFPDLSAA 1
              +KR+L P L  A
Sbjct: 153 PFTKKRELSPGLPPA 167


>UniRef50_Q3U1V2 Cluster: B6-derived CD11 +ve dendritic cells cDNA,
           RIKEN full-length enriched library, clone:F730204M12
           product:hypothetical protein, full insert sequence; n=3;
           Amniota|Rep: B6-derived CD11 +ve dendritic cells cDNA,
           RIKEN full-length enriched library, clone:F730204M12
           product:hypothetical protein, full insert sequence - Mus
           musculus (Mouse)
          Length = 136

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 30/70 (42%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +2

Query: 17  GKSFLFCLSVRVPWNPIEGRYGSEREEHRICGGVRILSA-DLENSGEGCTWRCRAGSYPY 193
           G+S LF +  R PWN    R G    +        + S   L+  G GC  + RAG YPY
Sbjct: 63  GESSLFFVKGRAPWNGFAPREGPVPWKASRFRRRPVSSRWPLKIRGRGC--KSRAGPYPY 120

Query: 194 PQQVSKVKSL 223
           PQQVSKV SL
Sbjct: 121 PQQVSKVNSL 130


>UniRef50_Q6CQE6 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=2; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome D of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 144

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 30/67 (44%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = -3

Query: 253 LPLPTLFYRLEALHLGDLLRIWVRTG-ATSPRTSLT*IFKVRREYPDTAANAVLFAFRTI 77
           LPL TLFY+LEA+HLGDLLR+ VR G  T P    +   +     PD A      + +T 
Sbjct: 80  LPLSTLFYQLEAVHLGDLLRLSVRPGMKTIPSCGFS---RAVAGAPDPAQGLGSSSHKTP 136

Query: 76  SPFYRIP 56
           SP   IP
Sbjct: 137 SPDKPIP 143



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 15/24 (62%), Positives = 16/24 (66%)
 Frame = -1

Query: 318 QTRHAPVLRANPYSEVTDPICHFP 247
           Q  H P+LRANPY EVTD  C  P
Sbjct: 58  QGPHCPILRANPYPEVTDLFCRLP 81



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = -1

Query: 618 LDSRIPLVRASSELTV---ERRSYRIVPIAHETKPTRLTAGRSAEGRRT 481
           LDS+IPLVR SS+L V   +RRS R +P    T+P    + R++  R++
Sbjct: 1   LDSQIPLVRTSSKLIVNCSKRRSTRDLPRPSTTRPASSPSHRASPVRQS 49


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/20 (90%), Positives = 19/20 (95%)
 Frame = -1

Query: 711 LLEFLHVDIQSTGQKSHCVN 652
           L+EFLH DIQSTGQKSHCVN
Sbjct: 133 LVEFLHFDIQSTGQKSHCVN 152


>UniRef50_A7SUM0 Cluster: Predicted protein; n=5; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 123

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 24/49 (48%), Positives = 29/49 (59%)
 Frame = -3

Query: 328 ASRPNPTRPGPQSQSLFRSYGSNLPLPLPTLFYRLEALHLGDLLRIWVR 182
           AS  +PT P  ++            LPLPTLFY+ EA HLGDLLR+ VR
Sbjct: 55  ASSLSPTDPTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRLLVR 103


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 39.5 bits (88), Expect = 0.080
 Identities = 16/20 (80%), Positives = 18/20 (90%)
 Frame = -3

Query: 643 GPSQCFVLIRQSDSPCPCQF 584
           G SQC+VLI+QSDSPCP QF
Sbjct: 186 GFSQCYVLIKQSDSPCPFQF 205



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 16/23 (69%), Positives = 17/23 (73%)
 Frame = -1

Query: 708 LEFLHVDIQSTGQKSHCVNTREG 640
           +EF  VDI  TGQKSHCVNT  G
Sbjct: 164 IEFHQVDIHGTGQKSHCVNTISG 186


>UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1;
           Crassostrea gigas|Rep: Tyrosine-protein kinase receptor
           - Crassostrea gigas (Pacific oyster) (Crassostrea
           angulata)
          Length = 804

 Score = 37.5 bits (83), Expect = 0.32
 Identities = 16/18 (88%), Positives = 17/18 (94%)
 Frame = +3

Query: 657 RNVISAQCSECQREEIQA 710
           RNVISAQCSECQ EEIQ+
Sbjct: 1   RNVISAQCSECQSEEIQS 18


>UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC
           50803
          Length = 329

 Score = 37.5 bits (83), Expect = 0.32
 Identities = 26/67 (38%), Positives = 37/67 (55%)
 Frame = -1

Query: 699 LHVDIQSTGQKSHCVNTREGHRNALF*LDSRIPLVRASSELTVERRSYRIVPIAHETKPT 520
           LH D + TGQKS   +   G R+A+F ++SR P VR+SS+    R+S+          PT
Sbjct: 246 LHSDGRGTGQKSRRASAGCGPRDAVFLVNSRDPRVRSSSD-PARRQSHSFSRGYGAGLPT 304

Query: 519 RLTAGRS 499
            L+  RS
Sbjct: 305 SLSRVRS 311


>UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 421

 Score = 37.1 bits (82), Expect = 0.43
 Identities = 15/22 (68%), Positives = 18/22 (81%)
 Frame = +3

Query: 612 CLIKTKHCDGPRGC*RNVISAQ 677
           CL K K+C+GP GC RNVIS+Q
Sbjct: 367 CLAKIKNCNGPCGCSRNVISSQ 388


>UniRef50_Q99JC0 Cluster: RRNA promoter binding protein; n=28;
           Euteleostomi|Rep: RRNA promoter binding protein - Rattus
           norvegicus (Rat)
          Length = 295

 Score = 36.3 bits (80), Expect = 0.74
 Identities = 15/17 (88%), Positives = 16/17 (94%)
 Frame = -3

Query: 223 EALHLGDLLRIWVRTGA 173
           EA+HLGDLLRIWVR GA
Sbjct: 181 EAVHLGDLLRIWVRPGA 197



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 30/118 (25%), Positives = 41/118 (34%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S+  G  P PL    R    L      ++   +  FPYLH S       L         P
Sbjct: 136 SSSRGARPAPLRAPARPTQPLEPILIPKLRIRLADFPYLHCSNMPEAVHLGDLLRIWVRP 195

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSA 4
                  P P+F   A + RTPP+ R   R  P        G   L ++++  P   A
Sbjct: 196 GARFTPSP-PDFQGPARAHRTPPEPRRFPRHGPLSRGEPIPGRPALHKEKRTLPGAPA 252



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = -2

Query: 341 PVRIRFPSKPDTPRSSEPILIPKLRIQFA 255
           P  +R P++P  P   EPILIPKLRI+ A
Sbjct: 143 PAPLRAPARPTQPL--EPILIPKLRIRLA 169


>UniRef50_Q2RRH7 Cluster: FeoA; n=1; Rhodospirillum rubrum ATCC
           11170|Rep: FeoA - Rhodospirillum rubrum (strain ATCC
           11170 / NCIB 8255)
          Length = 95

 Score = 36.3 bits (80), Expect = 0.74
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +1

Query: 208 QGEEPLVDRIM*VREVANWIRNFGIRIGSEDRGVSGLDGKRMRTGAGSGR 357
           +G   +V RI   R++A  + + G+R G E R + G DG  +  G G GR
Sbjct: 27  EGHRAVVARIRAERDLAQKLADLGLRTGCEIRVIKGSDGGPLVVGLGDGR 76


>UniRef50_Q4T8E7 Cluster: Chromosome undetermined SCAF7818, whole
           genome shotgun sequence; n=2; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF7818,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 563

 Score = 35.9 bits (79), Expect = 0.98
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = -2

Query: 224 RGSSPWRPAADMGTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVP 84
           RG +  RP   +    R  ST   H NF  P   SGH+  CGAL+VP
Sbjct: 253 RGGAGPRPGGGLAAFSRSSSTSSDHGNFAMP---SGHQATCGALKVP 296


>UniRef50_Q1EHT8 Cluster: Putative uncharacterized protein
           P0711E10.42; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0711E10.42 - Oryza sativa subsp. japonica (Rice)
          Length = 161

 Score = 27.9 bits (59), Expect(2) = 1.0
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -1

Query: 186 YEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRS 85
           ++P+ H H  PSP  SR  + +  PP+ R   RS
Sbjct: 32  FQPSLHAHRRPSPT-SRRRQRLCIPPRSRLCLRS 64



 Score = 27.1 bits (57), Expect(2) = 1.0
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICH 253
           ST   TGPHP+P  ++  P  R  P+     P  H
Sbjct: 4   STLGNTGPHPIPKSSKIVPT-RTVPHIASFQPSLH 37


>UniRef50_UPI0000F336FF Cluster: PTB-containing, cubilin and
           LRP1-interacting protein (P-CLI1) (Protein NYGGF4).;
           n=1; Bos taurus|Rep: PTB-containing, cubilin and
           LRP1-interacting protein (P-CLI1) (Protein NYGGF4). -
           Bos Taurus
          Length = 145

 Score = 33.1 bits (72), Expect = 6.9
 Identities = 17/37 (45%), Positives = 19/37 (51%)
 Frame = -1

Query: 372 HNARTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDP 262
           H  RT T    GP PLP  T  AP+ R  P S V +P
Sbjct: 46  HLPRTPTPDVAGPQPLPPPTLPAPIDRVLPASPVPNP 82


>UniRef50_Q0UJW1 Cluster: Predicted protein; n=1; Phaeosphaeria
           nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 631

 Score = 32.7 bits (71), Expect = 9.2
 Identities = 29/115 (25%), Positives = 49/115 (42%), Gaps = 9/115 (7%)
 Frame = -2

Query: 368 THEHRPDPAPVRIRFPSKPDTPRSSEPILIPKLRIQFATSLTYIILSTRGSSPWRPAADM 189
           T++H P P+P  +   + P     +EPI          +    I  + R SSP  P  + 
Sbjct: 432 TYQHSPPPSPPNLPTTTPPRQRTVTEPISSTSAANSILSRRRPIPQANRPSSPHPPLPNP 491

Query: 188 GTNRRD------ISTYIPHLNFQGPQRVSGHRR---KCGALRVPNHISLL*DSME 51
            TN +       +S + PHL+   P   +  +R      +L   +HI++L  +ME
Sbjct: 492 TTNGQPRHRHALLSHFAPHLSLLYPTAPTPPKRCPSPPTSLSAADHIAVLESAME 546


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 796,537,117
Number of Sequences: 1657284
Number of extensions: 18048394
Number of successful extensions: 61615
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 57325
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61542
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 57024798702
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).