SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0105
         (697 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...   112   9e-24
UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ...   106   4e-22
UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0...    72   2e-11
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    63   5e-09
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    62   1e-08
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    52   1e-05
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    51   2e-05
UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontog...    47   5e-04
UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;...    44   0.003
UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.004
UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47...    39   0.13 
UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; ...    38   0.18 
UniRef50_A0WXU1 Cluster: Putative uncharacterized protein precur...    36   0.95 
UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; ...    34   3.8  
UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2; ...    34   3.8  
UniRef50_UPI00015B4E02 Cluster: PREDICTED: similar to translin; ...    33   5.1  
UniRef50_O88573 Cluster: AF4/FMR2 family member 1; n=20; Mammali...    33   6.7  
UniRef50_A4S5W9 Cluster: Predicted protein; n=2; Ostreococcus|Re...    33   8.8  

>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score =  112 bits (269), Expect = 9e-24
 Identities = 78/167 (46%), Positives = 86/167 (51%), Gaps = 8/167 (4%)
 Frame = -3

Query: 506 ARLASA----LEAFRHNPADGSSHHRPLGRVHEPN-VRNCGSSRTEQYYYR---NDKPSV 351
           AR+AS+    LEAF HNP  GS    PL    +P+ + NC + R   YY           
Sbjct: 4   ARIASSPDSDLEAFSHNPTHGS--FAPLA--FQPSAMTNCANQRFLSYYVELLLRHCHQW 59

Query: 350 GXXXXXXXXXXXXXXSLLMGEQSNAWRMFVRNIGRADIEGSKSNVAMNAWLPQASYPCGN 171
           G                               IGRADIEGSKSNVAMNAWLPQASYPCGN
Sbjct: 60  GKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKSNVAMNAWLPQASYPCGN 119

Query: 170 FSGTSC*KLFILKDR*AVLSQSLCVLNIWIKPAFALLLHARFLSSLS 30
           FS TS  K   LKDR A LS+ + VL I IK AF LL H RFL SLS
Sbjct: 120 FSDTSSFKFRSLKDRLATLSRFVFVLEIRIKRAFTLLFHTRFLFSLS 166



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 28/35 (80%), Positives = 30/35 (85%)
 Frame = -1

Query: 358 HQ*GKTNLSHDGLIPAHVPF*WVNNPTLGECLFAI 254
           HQ GKTNLSHDGLIPAHVP+ WVNNPTLGE  F +
Sbjct: 57  HQWGKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTM 91


>UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 116

 Score =  106 bits (255), Expect = 4e-22
 Identities = 57/86 (66%), Positives = 65/86 (75%)
 Frame = +1

Query: 1   QRITQVS*GQLSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIKSF*QEVPEKLPQ 180
           Q ITQ S  QLSE+ NL  +KR KA LI +FS + + ES AYRSF+  SF  EV EKLPQ
Sbjct: 14  QTITQASQVQLSENGNLTQNKRVKATLILIFSRNTNRESVAYRSFNFTSFKLEVSEKLPQ 73

Query: 181 G*LACGSQAFIATLLFDPSMSALPIL 258
           G LACGSQ FI+TLLFDPSMSALPI+
Sbjct: 74  GQLACGSQEFISTLLFDPSMSALPII 99


>UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep:
           LRRG00134 - Rattus norvegicus (Rat)
          Length = 221

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 32/36 (88%), Positives = 33/36 (91%)
 Frame = -3

Query: 254 IGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSC*K 147
           IGRADIEGSKS+VAMNAW PQASYPCGNFS TSC K
Sbjct: 39  IGRADIEGSKSDVAMNAWPPQASYPCGNFSDTSCLK 74


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 27/28 (96%), Positives = 28/28 (100%)
 Frame = -3

Query: 254 IGRADIEGSKSNVAMNAWLPQASYPCGN 171
           IGRADIEGSKSNVAMNAWLPQASYPCG+
Sbjct: 2   IGRADIEGSKSNVAMNAWLPQASYPCGS 29



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 29/47 (61%), Positives = 33/47 (70%)
 Frame = -2

Query: 141 YTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSL 1
           Y  GSIG AF V +RTE+ +Q SF PF   E+SVL EL LGHLRY L
Sbjct: 25  YPCGSIGHAFTVCIRTENQNQMSFYPFVLHEISVLVELILGHLRYLL 71


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 28/33 (84%), Positives = 29/33 (87%)
 Frame = -3

Query: 254 IGRADIEGSKSNVAMNAWLPQASYPCGNFSGTS 156
           IGRADIEGSKS VA +AW PQASYPCGNFS TS
Sbjct: 2   IGRADIEGSKSYVARSAWQPQASYPCGNFSDTS 34



 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 25/45 (55%), Positives = 31/45 (68%)
 Frame = -2

Query: 135 KGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSL 1
           KGSIG AF     +E  +Q SF PF+ +E+SVL+EL  GHLRY L
Sbjct: 49  KGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLSELVFGHLRYYL 93


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/28 (82%), Positives = 24/28 (85%)
 Frame = -3

Query: 254 IGRADIEGSKSNVAMNAWLPQASYPCGN 171
           IGRADIE SKS VA NAW PQASYPCG+
Sbjct: 2   IGRADIERSKSYVAKNAWQPQASYPCGS 29



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/47 (51%), Positives = 29/47 (61%)
 Frame = -2

Query: 141 YTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSL 1
           Y  GSIG AF     +E  +Q SF PF+ +E+SVL EL  GHL Y L
Sbjct: 25  YPCGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLFELVFGHLCYFL 71


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/46 (54%), Positives = 30/46 (65%)
 Frame = -2

Query: 138 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSL 1
           +KGSIG  F V + TE+ +Q  F PF   E+SVL E  LGHLRY L
Sbjct: 26  SKGSIGHTFMVCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRL 71



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = -3

Query: 212 MNAWLPQASYPCGNFSGTS 156
           MNAWLPQASYPCGNFSGTS
Sbjct: 1   MNAWLPQASYPCGNFSGTS 19


>UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 108

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 25/45 (55%), Positives = 30/45 (66%)
 Frame = -2

Query: 135 KGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSL 1
           KGSIG AF V +RT + +Q SF  F   E+ VL +L LGHLRY L
Sbjct: 25  KGSIGYAFNVRIRTGNQNQTSFYHFVLHEIFVLVKLILGHLRYLL 69


>UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3;
           Euarchontoglires|Rep: 4933429F08Rik protein - Mus
           musculus (Mouse)
          Length = 29

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 212 MNAWLPQASYPCGNFSGTSC*K 147
           MNAW PQASYPCGNFS TSC K
Sbjct: 1   MNAWPPQASYPCGNFSDTSCLK 22


>UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 440

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/21 (95%), Positives = 21/21 (100%)
 Frame = -2

Query: 249 KSRHRRIKKQRRYERLAATSQ 187
           KSRHRRIKK+RRYERLAATSQ
Sbjct: 50  KSRHRRIKKRRRYERLAATSQ 70


>UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 746

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/28 (67%), Positives = 24/28 (85%)
 Frame = +3

Query: 372 IVILLSTRGTAVSDIWFMHSAERPVVRT 455
           +VILLSTRGTA SD W +H AE+P+VR+
Sbjct: 660 VVILLSTRGTADSDNWHLHLAEKPMVRS 687


>UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47;
           Eukaryota|Rep: Uncharacterized protein YLR162W-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 62

 Score = 38.7 bits (86), Expect = 0.13
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = -2

Query: 108 VPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSL 1
           V + TE+ +Q  F PF   E+SVL E  LGHLRY L
Sbjct: 2   VCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRL 37


>UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4;
           Eukaryota|Rep: Putative uncharacterized protein -
           Plasmodium berghei
          Length = 54

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 16/18 (88%), Positives = 16/18 (88%)
 Frame = +1

Query: 283 DCSPIKRERELGLDRRET 336
           DCSP  RERELGLDRRET
Sbjct: 6   DCSPANRERELGLDRRET 23


>UniRef50_A0WXU1 Cluster: Putative uncharacterized protein
           precursor; n=1; Shewanella pealeana ATCC 700345|Rep:
           Putative uncharacterized protein precursor - Shewanella
           pealeana ATCC 700345
          Length = 228

 Score = 35.9 bits (79), Expect = 0.95
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = +1

Query: 418 GSCTRPSGRWCELPSAGLCLNASKAEA-SLANPARICSLWSPESREALNNVTLLVAFRIQ 594
           G+  + S +   L S+ L ++ SKAE+ S   P ++ SL  PE ++A NNV      +  
Sbjct: 104 GAQQQSSSQAVNLKSSDLVVDESKAESGSRQEPVKVNSLLEPEQKKASNNVIANAEQQAV 163

Query: 595 NARRDVEAHL 624
            + RD+ A L
Sbjct: 164 ASERDITAGL 173


>UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4;
           Bacteria|Rep: Putative uncharacterized protein -
           Magnetospirillum gryphiswaldense
          Length = 76

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 15/21 (71%), Positives = 16/21 (76%)
 Frame = +1

Query: 274 QALDCSPIKRERELGLDRRET 336
           Q   CSPIK  RELGL+RRET
Sbjct: 17  QGFGCSPIKVVRELGLERRET 37


>UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2;
          Streptococcus pneumoniae|Rep: Putative uncharacterized
          protein - Streptococcus pneumoniae SP3-BS71
          Length = 44

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 19/30 (63%), Positives = 20/30 (66%)
 Frame = +3

Query: 6  NNAGVLRPAQRGQKPRVEQKGKSWLDPDVQ 95
          +NA VLR A   QK  VEQKGKS LD D Q
Sbjct: 10 DNADVLRGAHGEQKSPVEQKGKSPLDFDFQ 39


>UniRef50_UPI00015B4E02 Cluster: PREDICTED: similar to translin;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           translin - Nasonia vitripennis
          Length = 306

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 2/65 (3%)
 Frame = -3

Query: 587 RNATSKVTLFRASRLSGLHS--EHILAGLARLASALEAFRHNPADGSSHHRPLGRVHEPN 414
           +   +++   +  R  G H   E  L GL +L+S L  F  N      +HRP+   H  N
Sbjct: 180 KETVAEILGLKHKREDGFHLDLEDFLMGLLQLSSELSRFAVNSVTNGDYHRPMEIAHFVN 239

Query: 413 VRNCG 399
             N G
Sbjct: 240 ELNAG 244


>UniRef50_O88573 Cluster: AF4/FMR2 family member 1; n=20;
            Mammalia|Rep: AF4/FMR2 family member 1 - Mus musculus
            (Mouse)
          Length = 1217

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 6/78 (7%)
 Frame = +3

Query: 471  MPERL*GRSQPSQSGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSP------FGSR 632
            +P+ L   S+P ++    L+   ++   +K CD +SRV+  +R T+++S       + SR
Sbjct: 778  IPQPLGKGSRPRKAEDKQLSAGKKQDSETKSCDSSSRVTKKRRVTQKKSTVTRDTNWISR 837

Query: 633  RSMLSVFFLTRASRLRSP 686
            ++  S    T +SR ++P
Sbjct: 838  KTASSSSSHTESSRTKAP 855


>UniRef50_A4S5W9 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 689

 Score = 32.7 bits (71), Expect = 8.8
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +3

Query: 492 RSQPSQSGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRSMLSVF 653
           R +  Q    +L   PRE   ++      R + S+RE RRR P G+R S  ++F
Sbjct: 35  RGRKGQRADFLLCFAPRERPEARATRRERRGARSEREARRRKPRGARSSSRALF 88


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 719,598,684
Number of Sequences: 1657284
Number of extensions: 14640515
Number of successful extensions: 37328
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 36059
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37317
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 54958682807
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).