SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0103
         (685 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A0ST23 Cluster: Putative reverse transcriptase; n=4; Ma...    77   3e-13
UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo...    72   1e-11
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    70   6e-11
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    57   5e-07
UniRef50_Q9KHC4 Cluster: SocE; n=1; Myxococcus xanthus|Rep: SocE...    55   2e-06
UniRef50_Q49222 Cluster: Putative uncharacterized protein; n=1; ...    54   4e-06
UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ...    53   6e-06
UniRef50_P03023 Cluster: Lactose operon repressor; n=24; Enterob...    47   4e-04
UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1; ...    44   0.005
UniRef50_A6MBK8 Cluster: Odorranain-E1 antimicrobial peptide; n=...    43   0.008
UniRef50_Q02940 Cluster: Beta-lactamase precursor; n=1; Burkhold...    42   0.014
UniRef50_Q5CDC4 Cluster: LacOPZ-alpha peptide from pUC9; n=1; Cr...    40   0.075
UniRef50_Q47167 Cluster: D-serine deaminase activator; n=3; Esch...    38   0.17 
UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1; ...    37   0.40 
UniRef50_Q9L3Q4 Cluster: Putative uncharacterized protein; n=1; ...    35   1.6  
UniRef50_Q9PAB1 Cluster: Ribonuclease E; n=13; Xanthomonadaceae|...    35   2.1  
UniRef50_Q571Q0 Cluster: Putative N-acetylglucosamine-6-phosphat...    34   3.7  

>UniRef50_A0ST23 Cluster: Putative reverse transcriptase; n=4;
           Magnoliophyta|Rep: Putative reverse transcriptase -
           Zingiber officinale (Ginger)
          Length = 49

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10;
           Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana
           tabacum (Common tobacco)
          Length = 530

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 47/87 (54%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = -3

Query: 434 VYPRLLEFLHVDIQSTGQKSHCVNTREGHRNALF*LDSRIPLVRASSELTVERRSYR--- 264
           VYPRL+EFLH DIQSTG+ +   N R  HRNALF L+SRIPLVR SSEL V R       
Sbjct: 127 VYPRLVEFLHFDIQSTGRIT-LRNIRRDHRNALFKLNSRIPLVRTSSELAVRRPGKAPEG 185

Query: 263 IVPSRTKRNRHDLTARKIRGRPENAGP 183
            VPS +   RH  T R  RG   ++ P
Sbjct: 186 TVPSPSP-GRHAAT-RSRRGSSSSSPP 210


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 69.7 bits (163), Expect = 6e-11
 Identities = 31/34 (91%), Positives = 32/34 (94%)
 Frame = -3

Query: 464 YPKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVN 363
           Y KRVIVTPAVYPRL+EFLH DIQSTGQKSHCVN
Sbjct: 119 YLKRVIVTPAVYPRLVEFLHFDIQSTGQKSHCVN 152


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -3

Query: 464 YPKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREG 351
           Y KRVIVTPAVY   +EF  VDI  TGQKSHCVNT  G
Sbjct: 149 YLKRVIVTPAVYLCFIEFHQVDIHGTGQKSHCVNTISG 186



 Score = 39.5 bits (88), Expect = 0.075
 Identities = 16/20 (80%), Positives = 18/20 (90%)
 Frame = -2

Query: 354 GPSQCFVLIRQSDSPCPCQF 295
           G SQC+VLI+QSDSPCP QF
Sbjct: 186 GFSQCYVLIKQSDSPCPFQF 205


>UniRef50_Q9KHC4 Cluster: SocE; n=1; Myxococcus xanthus|Rep: SocE -
           Myxococcus xanthus
          Length = 486

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 29/57 (50%), Positives = 36/57 (63%)
 Frame = +3

Query: 510 IVIRSQFHTTYEPEA*SVKPGVPNE*ANSH*LRCAHCPLSSRETCRASCINESANAR 680
           +VIRSQ HTTYEP+   V+ GV    A  +     HCP S+R+T RASCI + A AR
Sbjct: 218 VVIRSQSHTTYEPDDWMVQLGVLVASAPYYWSLRVHCPFSTRDTWRASCIRDPATAR 274


>UniRef50_Q49222 Cluster: Putative uncharacterized protein; n=1;
           Mycoplasma genitalium|Rep: Putative uncharacterized
           protein - Mycoplasma genitalium
          Length = 77

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 25/36 (69%), Positives = 27/36 (75%)
 Frame = +1

Query: 448 MTLLGYRARIRNHGHSCXXXXLLSAHNSTQHTSRKH 555
           M  +GYRARIRNH  +     LLSAHNSTQHTSRKH
Sbjct: 42  MIYVGYRARIRNHVIAVSCVKLLSAHNSTQHTSRKH 77


>UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC
           50803
          Length = 329

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 30/58 (51%), Positives = 38/58 (65%)
 Frame = -3

Query: 464 YPKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNALF*LDSRIPLVRASSE 291
           Y KRVIVTPAVY      LH D + TGQKS   +   G R+A+F ++SR P VR+SS+
Sbjct: 228 YLKRVIVTPAVYQGFGGSLHSDGRGTGQKSRRASAGCGPRDAVFLVNSRDPRVRSSSD 285


>UniRef50_P03023 Cluster: Lactose operon repressor; n=24;
           Enterobacteriaceae|Rep: Lactose operon repressor -
           Escherichia coli (strain K12)
          Length = 360

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/23 (100%), Positives = 23/23 (100%)
 Frame = -1

Query: 685 SPRALADSLMQLARQVSRLESGQ 617
           SPRALADSLMQLARQVSRLESGQ
Sbjct: 338 SPRALADSLMQLARQVSRLESGQ 360


>UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1;
           Crassostrea gigas|Rep: Tyrosine-protein kinase receptor
           - Crassostrea gigas (Pacific oyster) (Crassostrea
           angulata)
          Length = 804

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/25 (80%), Positives = 21/25 (84%)
 Frame = +2

Query: 368 RNVISAQCSECQREEIQASAGKRRE 442
           RNVISAQCSECQ EEIQ+S GK  E
Sbjct: 1   RNVISAQCSECQSEEIQSSEGKGGE 25


>UniRef50_A6MBK8 Cluster: Odorranain-E1 antimicrobial peptide; n=31;
           Odorrana grahami|Rep: Odorranain-E1 antimicrobial
           peptide - Rana grahami (Yunnanfu frog) (Huia grahami)
          Length = 171

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 26/53 (49%), Positives = 31/53 (58%)
 Frame = -3

Query: 671 GRFINAAGTTGFPTGKRAVSATQLM*VSSLIRHPRLYTLCFRLVCCVEL*ADN 513
           GR   A GT G  TG+ AV+A Q+M  S L R  RL +L   +VC  EL ADN
Sbjct: 19  GRINAAGGTAGLTTGQPAVTAPQIMGGSLLRRPRRLSSLFLLVVCWEELWADN 71


>UniRef50_Q02940 Cluster: Beta-lactamase precursor; n=1;
           Burkholderia cepacia|Rep: Beta-lactamase precursor -
           Burkholderia cepacia (Pseudomonas cepacia)
          Length = 313

 Score = 41.9 bits (94), Expect = 0.014
 Identities = 22/32 (68%), Positives = 22/32 (68%)
 Frame = -2

Query: 615 ERNAINVS*LTH*APQALHFMLPARMLCGIVS 520
           ERNAINVS LT         MLPARMLCGIVS
Sbjct: 194 ERNAINVSYLTALGTPGFTLMLPARMLCGIVS 225


>UniRef50_Q5CDC4 Cluster: LacOPZ-alpha peptide from pUC9; n=1;
           Cryptosporidium hominis|Rep: LacOPZ-alpha peptide from
           pUC9 - Cryptosporidium hominis
          Length = 128

 Score = 39.5 bits (88), Expect = 0.075
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +1

Query: 511 LLSAHNSTQHTSRKHKV 561
           LLSAHNSTQHTSRKHKV
Sbjct: 112 LLSAHNSTQHTSRKHKV 128


>UniRef50_Q47167 Cluster: D-serine deaminase activator; n=3;
           Escherichia coli|Rep: D-serine deaminase activator -
           Escherichia coli
          Length = 249

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 30/87 (34%), Positives = 40/87 (45%), Gaps = 2/87 (2%)
 Frame = -1

Query: 649 ARQVSRLESGQ*AQRN*--CELAHSLGTPGFTLYASGSYVVWNCERITXXXXXSYDHDYE 476
           AR +++    + ++RN   CELAHSLG    TL      V WNCERIT            
Sbjct: 134 ARLIAKRTCPERSERNAIKCELAHSLGPDFHTLCFRLLCVCWNCERITISHRKRLVTMTY 193

Query: 475 FELGTLRES*LLPPFTRACLNFFTLTF 395
            +LG    S L  P + +  N + L F
Sbjct: 194 AKLGHACRSTLEDPPSNSARNGWNLNF 220


>UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 421

 Score = 37.1 bits (82), Expect = 0.40
 Identities = 15/22 (68%), Positives = 18/22 (81%)
 Frame = +2

Query: 323 CLIKTKHCDGPRGC*RNVISAQ 388
           CL K K+C+GP GC RNVIS+Q
Sbjct: 367 CLAKIKNCNGPCGCSRNVISSQ 388


>UniRef50_Q9L3Q4 Cluster: Putative uncharacterized protein; n=1;
           Eubacterium acidaminophilum|Rep: Putative
           uncharacterized protein - Eubacterium acidaminophilum
          Length = 274

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +1

Query: 460 GYRARIRNHGHSC 498
           GYRARIRNHGHSC
Sbjct: 165 GYRARIRNHGHSC 177


>UniRef50_Q9PAB1 Cluster: Ribonuclease E; n=13; Xanthomonadaceae|Rep:
            Ribonuclease E - Xylella fastidiosa
          Length = 1132

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 17/51 (33%), Positives = 23/51 (45%)
 Frame = -3

Query: 314  PLVRASSELTVERRSYRIVPSRTKRNRHDLTARKIRGRPENAGPDPVRNVR 162
            P++      T+E+   ++VPS T  N H  T RKI          PVR  R
Sbjct: 1023 PVMATKPSTTIEKAQTKVVPSTTYNNEHIETKRKIIATESETTQPPVRKPR 1073


>UniRef50_Q571Q0 Cluster: Putative N-acetylglucosamine-6-phosphate
           deacetylase; n=1; Aeromonas punctata|Rep: Putative
           N-acetylglucosamine-6-phosphate deacetylase - Aeromonas
           punctata (Aeromonas caviae)
          Length = 219

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 18/26 (69%), Positives = 18/26 (69%)
 Frame = -3

Query: 611 ATQLM*VSSLIRHPRLYTLCFRLVCC 534
           ATQLM VSSLIRHP L T     VCC
Sbjct: 3   ATQLMGVSSLIRHPSL-TFXLPAVCC 27


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 686,502,074
Number of Sequences: 1657284
Number of extensions: 13322748
Number of successful extensions: 32260
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 31075
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32245
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 53305790091
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).