SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0101
         (509 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa...   116   3e-25
UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo...    96   4e-19
UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ...    81   1e-14
UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;...    69   8e-11
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    61   1e-08
UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...    54   2e-06
UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3; ...    52   1e-05
UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221...    46   5e-04
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    45   0.001
UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia ...    45   0.001
UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1; ...    44   0.002
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    44   0.002
UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;...    42   0.011
UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|R...    38   0.17 
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    37   0.31 
UniRef50_Q54SH1 Cluster: Putative uncharacterized protein; n=1; ...    36   0.40 
UniRef50_Q4PCA4 Cluster: Putative uncharacterized protein; n=1; ...    36   0.40 
UniRef50_A5ZYV6 Cluster: Putative uncharacterized protein; n=1; ...    35   0.93 
UniRef50_Q68S97 Cluster: C type lectin receptor B; n=1; Salmo sa...    35   1.2  
UniRef50_A6RWT0 Cluster: Putative uncharacterized protein; n=1; ...    35   1.2  
UniRef50_A4LZ01 Cluster: Beta-ketoacyl synthase; n=2; cellular o...    34   1.6  
UniRef50_O04059 Cluster: Putative 3,4-dihydroxy-2-butanone kinas...    33   3.8  
UniRef50_UPI0000DD7F3C Cluster: PREDICTED: hypothetical protein;...    33   5.0  
UniRef50_A6E328 Cluster: Putative uncharacterized protein; n=1; ...    33   5.0  
UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1; ...    33   5.0  
UniRef50_A7SHE8 Cluster: Predicted protein; n=1; Nematostella ve...    33   5.0  
UniRef50_A7S5E9 Cluster: Predicted protein; n=1; Nematostella ve...    32   6.6  
UniRef50_A4R4H2 Cluster: Predicted protein; n=1; Magnaporthe gri...    32   6.6  
UniRef50_UPI00015A6F06 Cluster: hypothetical protein LOC570789; ...    32   8.7  
UniRef50_A4X4V1 Cluster: Putative uncharacterized protein; n=1; ...    32   8.7  
UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47...    32   8.7  

>UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa
           group|Rep: Zgc:165536 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 55

 Score =  116 bits (279), Expect = 3e-25
 Identities = 49/55 (89%), Positives = 53/55 (96%)
 Frame = +3

Query: 78  MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKQTLLSLTLVWHCKET 242
           MPRHLISDAHEW+NEIPTVP  YLAKPQPRERAW+NQRGK+TLLSLTLVWHC+ET
Sbjct: 1   MPRHLISDAHEWMNEIPTVPTCYLAKPQPRERAWQNQRGKKTLLSLTLVWHCEET 55


>UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10;
           Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana
           tabacum (Common tobacco)
          Length = 530

 Score = 96.3 bits (229), Expect = 4e-19
 Identities = 75/163 (46%), Positives = 88/163 (53%)
 Frame = -3

Query: 489 MYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNRVSNE 310
           M RPSQTP L +SS RI  +              +LG+  R  A      PLP + +S  
Sbjct: 1   MCRPSQTPHLTMSSARIGLQ-------------ASLGSKKRGSA------PLPIHGISKI 41

Query: 309 TMKVVVFQRRSREXISHLSTPLMSPYNARLESSSTGSAFPADSPKPVPLAVVSLDSR*GQ 130
           T+KVVVF  R        +TPL S +   LESSSTGS+FPADS KPVPL VVSLDSR   
Sbjct: 42  TLKVVVFHFRLSAPT--YTTPLKSFHKVGLESSSTGSSFPADSAKPVPLVVVSLDSRQDS 99

Query: 129 WESR*SIHARH*LDDEAFGYLKRVIVTPAVYPRLLEFLHVDIQ 1
             S  SIHA           L+    +P VYPRL+EFLH DIQ
Sbjct: 100 GISL-SIHAVTNKMTRHLATLRESCYSP-VYPRLVEFLHFDIQ 140


>UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC
           50803
          Length = 329

 Score = 81.0 bits (191), Expect = 1e-14
 Identities = 45/72 (62%), Positives = 47/72 (65%)
 Frame = -3

Query: 222 LESSSTGSAFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPA 43
           LESSS GS+ PA  P PVP A  S     GQW+ R SIHAR  L DEAFGYLKRVIVTPA
Sbjct: 178 LESSSKGSSCPAGRPSPVPEAGGSRRRGSGQWDPRWSIHARRKLPDEAFGYLKRVIVTPA 237

Query: 42  VYPRLLEFLHVD 7
           VY      LH D
Sbjct: 238 VYQGFGGSLHSD 249


>UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 70

 Score = 68.5 bits (160), Expect = 8e-11
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = -3

Query: 255 STPLMSPYNARLESSSTGSAFPADSPKPVPLAVVSLD 145
           +TPLMSPYNARLESSSTGS+FPA+  KPVPLAVVSLD
Sbjct: 17  ATPLMSPYNARLESSSTGSSFPANFSKPVPLAVVSLD 53



 Score = 35.9 bits (79), Expect = 0.53
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -1

Query: 137 RDSGNLVNPFMRVTN 93
           RDSGNLVNPFMRVTN
Sbjct: 56  RDSGNLVNPFMRVTN 70


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 61.3 bits (142), Expect = 1e-08
 Identities = 27/30 (90%), Positives = 29/30 (96%)
 Frame = -3

Query: 90  DDEAFGYLKRVIVTPAVYPRLLEFLHVDIQ 1
           +DEAFGYLKRVIVTPAVYPRL+EFLH DIQ
Sbjct: 113 NDEAFGYLKRVIVTPAVYPRLVEFLHFDIQ 142



 Score = 37.1 bits (82), Expect = 0.23
 Identities = 16/23 (69%), Positives = 17/23 (73%)
 Frame = -2

Query: 508 LRYSLTDVPPQSNSPPGSVLEPD 440
           LRY LTDVPPQ NSPP +V   D
Sbjct: 67  LRYLLTDVPPQPNSPPDNVFHLD 89


>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 44/106 (41%), Positives = 50/106 (47%)
 Frame = -2

Query: 508 LRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNDTPCARRYYRPCTASA 329
           LRY LTDVPPQ NSPP +V  PD              T +  W      RR         
Sbjct: 172 LRYLLTDVPPQPNSPPDNVFRPDRP------------TKVSLWIKKEGQRR------PPD 213

Query: 328 QPSK**NNESSGFPATIARXDLPLIYTSHVSLQCQTRVKLNRVCFP 191
             +K  N +SSG  +T A     L YTS V  Q +TRVKLNRV FP
Sbjct: 214 SRNKLNNVKSSGI-STFAVSSSHLSYTSQVISQSRTRVKLNRVFFP 258



 Score = 44.8 bits (101), Expect = 0.001
 Identities = 25/49 (51%), Positives = 27/49 (55%)
 Frame = -3

Query: 264 SHLSTPLMSPYNARLESSSTGSAFPADSPKPVPLAVVSLDSR*GQWESR 118
           SHLS        +R         FPADS K VPL +VSLDSR GQWE R
Sbjct: 234 SHLSYTSQVISQSRTRVKLNRVFFPADSAKAVPLLLVSLDSRKGQWEFR 282


>UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 70

 Score = 53.6 bits (123), Expect = 2e-06
 Identities = 26/35 (74%), Positives = 29/35 (82%)
 Frame = -3

Query: 234 YNARLESSSTGSAFPADSPKPVPLAVVSLDSR*GQ 130
           +  RLESSSTGS+FPAD  KPVPLA+ SLDSR GQ
Sbjct: 19  HKVRLESSSTGSSFPADYSKPVPLAMGSLDSRQGQ 53


>UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3;
           Thermoproteaceae|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-061
          Length = 234

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 21/46 (45%), Positives = 29/46 (63%)
 Frame = +3

Query: 96  SDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKQTLLSLTLVWHC 233
           S  HEWINE+PTVP    A P P  ++W+ +RG+++L S T    C
Sbjct: 177 SGVHEWINEVPTVPARGPANPPPGAQSWDPRRGEKSLWSFTAACRC 222


>UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221;
           n=2; Pyrococcus|Rep: Putative uncharacterized protein
           PH0221 - Pyrococcus horikoshii
          Length = 235

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 28/56 (50%), Positives = 31/56 (55%)
 Frame = -3

Query: 204 GSAFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 37
           GS+ P   P     A VS     GQ   R +IHA   L D+ F YLKRVIVTPAVY
Sbjct: 2   GSSLPTGGPWHARQAEVSPGPGRGQRGPRYAIHAGRHLTDKEFRYLKRVIVTPAVY 57


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 21/28 (75%), Positives = 22/28 (78%)
 Frame = -3

Query: 87  DEAFGYLKRVIVTPAVYPRLLEFLHVDI 4
           DE FGYLKRVIVTPAVY   +EF  VDI
Sbjct: 144 DETFGYLKRVIVTPAVYLCFIEFHQVDI 171



 Score = 33.1 bits (72), Expect = 3.8
 Identities = 15/19 (78%), Positives = 15/19 (78%)
 Frame = -2

Query: 508 LRYSLTDVPPQSNSPPGSV 452
           L Y LTDVPPQSNSP G V
Sbjct: 67  LCYFLTDVPPQSNSPSGYV 85



 Score = 32.3 bits (70), Expect = 6.6
 Identities = 14/18 (77%), Positives = 14/18 (77%)
 Frame = -1

Query: 146 IVDRDSGNLVNPFMRVTN 93
           I  RDS NLVNPFM VTN
Sbjct: 125 IASRDSENLVNPFMHVTN 142


>UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_557_1225 - Giardia lamblia ATCC
           50803
          Length = 222

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 23/41 (56%), Positives = 24/41 (58%)
 Frame = +2

Query: 110 MD*RDSHCPYLLSSETTAKGTGLGESAGKADPVELDSSLAL 232
           MD R SHCP     E  A GTG G  AG+ DP ELDSS  L
Sbjct: 1   MDQRGSHCPEPRLREPPASGTGEGRPAGQEDPFELDSSPGL 41


>UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 421

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 17/24 (70%), Positives = 20/24 (83%)
 Frame = +3

Query: 87  HLISDAHEWINEIPTVPIYYLAKP 158
           HLISDAHEWIN+ PT+ +YY  KP
Sbjct: 398 HLISDAHEWINKNPTILVYYPTKP 421


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 38/105 (36%), Positives = 45/105 (42%)
 Frame = -2

Query: 508 LRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNDTPCARRYYRPCTASA 329
           LRY LTDVPPQ NSPP +V         N D+ +  +T LH W                 
Sbjct: 67  LRYRLTDVPPQPNSPPDNVS--------NSDQAYMLLTPLH-WI---------------- 101

Query: 328 QPSK**NNESSGFPATIARXDLPLIYTSHVSLQCQTRVKLNRVCF 194
                 + E+        R    L YT HVS QCQTRVKLN   +
Sbjct: 102 ------SKETMEVVVFHRRRSSHLFYTLHVSSQCQTRVKLNHAAY 140


>UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 440

 Score = 41.5 bits (93), Expect = 0.011
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = -1

Query: 488 CTAPVKLPAWQCPRTGSR 435
           CTAPVKLP W CPR+GSR
Sbjct: 75  CTAPVKLPTWHCPRSGSR 92


>UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|Rep:
           Lipoprotein, putative - Campylobacter lari RM2100
          Length = 97

 Score = 37.5 bits (83), Expect = 0.17
 Identities = 21/40 (52%), Positives = 25/40 (62%)
 Frame = -3

Query: 156 VSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 37
           +SLD    Q  SR +IHA   L D+ F YL+ VIVT AVY
Sbjct: 50  ISLDPSLRQLPSRYAIHAGRYLTDKEFRYLRTVIVTAAVY 89


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 36.7 bits (81), Expect = 0.31
 Identities = 16/19 (84%), Positives = 16/19 (84%)
 Frame = -2

Query: 508 LRYSLTDVPPQSNSPPGSV 452
           LRY LTDVPPQSNSPP  V
Sbjct: 89  LRYYLTDVPPQSNSPPDYV 107


>UniRef50_Q54SH1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1346

 Score = 36.3 bits (80), Expect = 0.40
 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 4/113 (3%)
 Frame = -3

Query: 477 SQTPRLAVSSNRITREF*TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKV 298
           S TP+ +++ NR++  F   T+ S+T     L    R+ +     +   PNR+S+   KV
Sbjct: 316 SLTPQKSLTPNRLSGTFPRTTTSSSTPTSSPL----RSTSSTTTTSSSTPNRLSSTINKV 371

Query: 297 VVFQRRSREXIS----HLSTPLMSPYNARLESSSTGSAFPADSPKPVPLAVVS 151
           V     S    S      +TPL     ++L S+++ S+  + +P   PL+  S
Sbjct: 372 VSSSPSSTSSSSSSPTRSATPLPPTSTSKLSSTTSSSSSSSSTPNKTPLSTRS 424


>UniRef50_Q4PCA4 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1238

 Score = 36.3 bits (80), Expect = 0.40
 Identities = 33/119 (27%), Positives = 55/119 (46%), Gaps = 2/119 (1%)
 Frame = -3

Query: 492 QMYRPSQTPRLAVSSNRITREF*TATSVSATSPL-CTLGTTHRAPADIIDRAPLPPNRVS 316
           QM+R    P++AV  +  TR     T  S T P+ C +  +H + +D + R   PP R+ 
Sbjct: 510 QMHRSKSAPQIAVQDST-TRTDTARTKTSKTEPVECAVSDSH-SDSDEVQRPRTPPERIL 567

Query: 315 N-ETMKVVVFQRRSREXISHLSTPLMSPYNARLESSSTGSAFPADSPKPVPLAVVSLDS 142
           + +T +  V  + SR     ++ P     +A   +  T SA  A +    P   VS++S
Sbjct: 568 HAQTPRTGV--KASRVRAQRVAVPSAVKVSAMRVAVPTPSAKVAATRMRNPATSVSVES 624


>UniRef50_A5ZYV6 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus obeum ATCC 29174|Rep: Putative
           uncharacterized protein - Ruminococcus obeum ATCC 29174
          Length = 114

 Score = 35.1 bits (77), Expect = 0.93
 Identities = 13/17 (76%), Positives = 13/17 (76%)
 Frame = -1

Query: 485 TAPVKLPAWQCPRTGSR 435
           TAPVKLP W CP  GSR
Sbjct: 55  TAPVKLPVWHCPTAGSR 71


>UniRef50_Q68S97 Cluster: C type lectin receptor B; n=1; Salmo
           salar|Rep: C type lectin receptor B - Salmo salar
           (Atlantic salmon)
          Length = 240

 Score = 34.7 bits (76), Expect = 1.2
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%)
 Frame = -2

Query: 451 LEPDH--AGVLNGDERFRHVTTLHAWNDTPCARRYYRPCTASAQP 323
           LEPD+  +G + G++     +  HAW+D PC   Y R C   A P
Sbjct: 192 LEPDNNISGGVEGEDCVVMESNTHAWSDVPCDFTYRRICQMDAIP 236


>UniRef50_A6RWT0 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 1280

 Score = 34.7 bits (76), Expect = 1.2
 Identities = 29/105 (27%), Positives = 44/105 (41%), Gaps = 2/105 (1%)
 Frame = -3

Query: 459 AVSSNRITREF*TATSVSATS-PLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQR 283
           + S   ++ E    TSVS +S PL T   T + P      +  PP  +S  T+  V+  +
Sbjct: 313 STSLTSLSSESPKTTSVSTSSRPLITTSITSQPPTANTSPSSEPPQTMSKSTISSVISSK 372

Query: 282 -RSREXISHLSTPLMSPYNARLESSSTGSAFPADSPKPVPLAVVS 151
             S   +S   T       +   SSST S   + S  P  L+ +S
Sbjct: 373 TSSSSSLSSSQTSTKESGTSTSSSSSTNSNSQSHSSTPTSLSSLS 417


>UniRef50_A4LZ01 Cluster: Beta-ketoacyl synthase; n=2; cellular
           organisms|Rep: Beta-ketoacyl synthase - Geobacter
           bemidjiensis Bem
          Length = 2396

 Score = 34.3 bits (75), Expect = 1.6
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = -3

Query: 219 ESSSTGSAFPADSPKPVPLAVVSLDSR*GQWESR*SIHAR 100
           ES +T S  PA   K  P+AVV LD+R G+W+   S  AR
Sbjct: 451 ESEATASPAPA---KGCPIAVVGLDARFGEWQDLTSFQAR 487


>UniRef50_O04059 Cluster: Putative 3,4-dihydroxy-2-butanone kinase;
           n=12; Magnoliophyta|Rep: Putative
           3,4-dihydroxy-2-butanone kinase - Solanum lycopersicum
           (Tomato) (Lycopersicon esculentum)
          Length = 594

 Score = 33.1 bits (72), Expect = 3.8
 Identities = 19/49 (38%), Positives = 23/49 (46%)
 Frame = -1

Query: 494 DRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSARLERHTVRPPILS 348
           DR  AP K P W     G+R   K     PP  HS ++E+   RP  LS
Sbjct: 330 DRLDAPTKAPNWPVGAEGNRPPAKIPVPLPP-SHSIKIEKTLSRPEKLS 377


>UniRef50_UPI0000DD7F3C Cluster: PREDICTED: hypothetical protein;
           n=1; Homo sapiens|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 496

 Score = 32.7 bits (71), Expect = 5.0
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 2/44 (4%)
 Frame = -1

Query: 482 APVKLPAWQCPRTG--SRGSFKRRRAFPPRHHSARLERHTVRPP 357
           AP  LPA +  R G  +RG   RR    PR  SAR++  T RPP
Sbjct: 249 APPNLPAARSLRRGPGARGRAGRRGRSRPRLASARIKARTARPP 292


>UniRef50_A6E328 Cluster: Putative uncharacterized protein; n=1;
           Roseovarius sp. TM1035|Rep: Putative uncharacterized
           protein - Roseovarius sp. TM1035
          Length = 501

 Score = 32.7 bits (71), Expect = 5.0
 Identities = 26/79 (32%), Positives = 34/79 (43%), Gaps = 4/79 (5%)
 Frame = -3

Query: 375 THRAPADIIDRAPLPPNRVSNETMKVVVFQ--RRSREXISHLST--PLMSPYNARLESSS 208
           T  APA  +  AP P  RV  +   V   Q  RR+    + LS   P   P    L   +
Sbjct: 135 TAPAPAPRVATAPAPAPRVVRQPAPVAAVQPQRRTASAQAPLSALRPEADPRPLALRPVT 194

Query: 207 TGSAFPADSPKPVPLAVVS 151
             +A PA +PK  P+A  S
Sbjct: 195 ARAAAPATAPKTTPIAKTS 213


>UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 108

 Score = 32.7 bits (71), Expect = 5.0
 Identities = 14/19 (73%), Positives = 15/19 (78%)
 Frame = -2

Query: 508 LRYSLTDVPPQSNSPPGSV 452
           LRY LTDV PQ NSPP +V
Sbjct: 65  LRYLLTDVSPQPNSPPDNV 83


>UniRef50_A7SHE8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 342

 Score = 32.7 bits (71), Expect = 5.0
 Identities = 17/42 (40%), Positives = 20/42 (47%)
 Frame = -3

Query: 294 VFQRRSREXISHLSTPLMSPYNARLESSSTGSAFPADSPKPV 169
           V  R  RE +  LS+ L SPY   L     G   P DSP+ V
Sbjct: 191 VSARIEREAVKPLSSRLPSPYRVNLPKIQCGRLAPVDSPRDV 232


>UniRef50_A7S5E9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 478

 Score = 32.3 bits (70), Expect = 6.6
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 84  RHLISDAHEWINEIPTVPIYYLAKPQPR 167
           +H  +D       +PTVP+ YLA+PQPR
Sbjct: 125 QHKQNDVETHAKPLPTVPMNYLAQPQPR 152


>UniRef50_A4R4H2 Cluster: Predicted protein; n=1; Magnaporthe
           grisea|Rep: Predicted protein - Magnaporthe grisea (Rice
           blast fungus) (Pyricularia grisea)
          Length = 306

 Score = 32.3 bits (70), Expect = 6.6
 Identities = 29/87 (33%), Positives = 39/87 (44%), Gaps = 1/87 (1%)
 Frame = +1

Query: 235 RRHERCR*VGDXFARSSLENHYFHCFITYSVGRKRCTVDNIGGRTVCRSKRAEW*RGGNA 414
           RRH R R       RSS ++H+ H    +   R R T DN GG    R +R E     + 
Sbjct: 143 RRHHRNR--PSRRRRSSNDDHHLHSRRRHRHRRGRSTDDNGGGHGHERHERIEGDVWNDG 200

Query: 415 RRRLKLPRDPVRGHCQ-AGSLTGAVHL 492
           +    + RDP R     A S+TG  H+
Sbjct: 201 QAHGHVDRDPGRREPSIAHSVTGNSHV 227


>UniRef50_UPI00015A6F06 Cluster: hypothetical protein LOC570789;
           n=2; Danio rerio|Rep: hypothetical protein LOC570789 -
           Danio rerio
          Length = 1136

 Score = 31.9 bits (69), Expect = 8.7
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
 Frame = -3

Query: 492 QMYRPSQTPRLAVSSNRITREF*TAT-SVSATSPLCTLGT-THRAPADIIDRAPLPPNRV 319
           Q   P  TPR+   SN+++    + + SV +T+ L    T T   P    D APLPP+  
Sbjct: 415 QRIEPIITPRITPLSNQVSVPLSSGSASVESTASLPLESTPTSDLPTQARDPAPLPPHDG 474

Query: 318 SNETMK 301
           +  T+K
Sbjct: 475 TTHTLK 480


>UniRef50_A4X4V1 Cluster: Putative uncharacterized protein; n=1;
            Salinispora tropica CNB-440|Rep: Putative uncharacterized
            protein - Salinispora tropica CNB-440
          Length = 3437

 Score = 31.9 bits (69), Expect = 8.7
 Identities = 24/82 (29%), Positives = 38/82 (46%)
 Frame = -3

Query: 423  TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPL 244
            T+TS SA++P  T      APA     AP P +  ++ +         S    +  STP 
Sbjct: 1277 TSTSASASTPASTPAP---APAPAPASAPAPASAPASTSAPASTSAPASTSASTPASTPA 1333

Query: 243  MSPYNARLESSSTGSAFPADSP 178
             +P +A   +S++ S  PA +P
Sbjct: 1334 STPASASTSASASAST-PASAP 1354


>UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47;
           Eukaryota|Rep: Uncharacterized protein YLR162W-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 62

 Score = 31.9 bits (69), Expect = 8.7
 Identities = 13/15 (86%), Positives = 13/15 (86%)
 Frame = -2

Query: 508 LRYSLTDVPPQSNSP 464
           LRY LTDVPPQ NSP
Sbjct: 33  LRYRLTDVPPQPNSP 47


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 533,692,130
Number of Sequences: 1657284
Number of extensions: 11031984
Number of successful extensions: 32791
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 31313
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32758
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 30946432294
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).