SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0100
         (644 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    99   5e-20
UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa...    89   6e-17
UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...    81   2e-14
UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;...    80   4e-14
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    79   7e-14
UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0...    72   1e-11
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    72   1e-11
UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo...    69   1e-10
UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ...    68   2e-10
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    67   3e-10
UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1; ...    64   4e-09
UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47...    59   1e-07
UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia ...    45   0.001
UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;...    44   0.002
UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontog...    43   0.007
UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2; ...    43   0.007
UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3; ...    42   0.010
UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ...    37   0.36 
UniRef50_O74086 Cluster: Putative uncharacterized protein PHS003...    36   0.63 
UniRef50_Q4S9Z6 Cluster: Chromosome undetermined SCAF14693, whol...    36   0.84 
UniRef50_Q972E8 Cluster: Putative uncharacterized protein ST1183...    36   0.84 
UniRef50_A5ZYV6 Cluster: Putative uncharacterized protein; n=1; ...    35   1.5  
UniRef50_Q8VPR4 Cluster: Putative transcriptional activator; n=1...    34   2.6  
UniRef50_Q05JI3 Cluster: Blue light regulator 1; n=2; Pleosporal...    34   2.6  
UniRef50_Q54SH1 Cluster: Putative uncharacterized protein; n=1; ...    33   4.5  
UniRef50_UPI0000D9CAA4 Cluster: PREDICTED: hypothetical protein;...    33   5.9  

>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score =   99 bits (238), Expect = 5e-20
 Identities = 66/142 (46%), Positives = 77/142 (54%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG  F V + TE+ +Q  F PF   E+SVL E  LGHLRY LTDVPPQ NSPP +     
Sbjct: 30  IGHTFMVCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSPPDN----- 84

Query: 328 HAGVLNGDERFRHVTTLHAWNETPWPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISH 149
              V N D+ +  +T LH W                   +S ETM+VVVF RR     SH
Sbjct: 85  ---VSNSDQAYMLLTPLH-W-------------------ISKETMEVVVFHRRRS---SH 118

Query: 148 LCYTSHVSLQCQTRVKLNRVFF 83
           L YT HVS QCQTRVKLN   +
Sbjct: 119 LFYTLHVSSQCQTRVKLNHAAY 140



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 20/22 (90%), Positives = 20/22 (90%)
 Frame = -1

Query: 593 MNAWLPQASYPCGNFSGTSG*K 528
           MNAWLPQASYPCGNFSGTS  K
Sbjct: 1   MNAWLPQASYPCGNFSGTSSLK 22


>UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa
           group|Rep: Zgc:165536 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 55

 Score = 89.4 bits (212), Expect = 6e-17
 Identities = 38/43 (88%), Positives = 41/43 (95%)
 Frame = +3

Query: 3   INEIPTVPIYYLAKPQPRERAWENQRGKKTLLSLTLVWHCKET 131
           +NEIPTVP  YLAKPQPRERAW+NQRGKKTLLSLTLVWHC+ET
Sbjct: 13  MNEIPTVPTCYLAKPQPRERAWQNQRGKKTLLSLTLVWHCEET 55


>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 38/45 (84%), Positives = 38/45 (84%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILKD 510
           F MIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  K   LKD
Sbjct: 89  FTMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRSLKD 133



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 47/111 (42%), Positives = 58/111 (52%), Gaps = 1/111 (0%)
 Frame = -2

Query: 409 ALGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNETPWPADIIDRA 230
           +LGHLRY LTDVPPQ NSPP +V  PD              T +  W +         R 
Sbjct: 168 SLGHLRYLLTDVPPQPNSPPDNVFRPDRP------------TKVSLWIKKEGQR----RP 211

Query: 229 PLPPNRVSN-ETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVFFP 80
           P   N+++N ++  +  F   S    SHL YTS V  Q +TRVKLNRVFFP
Sbjct: 212 PDSRNKLNNVKSSGISTFAVSS----SHLSYTSQVISQSRTRVKLNRVFFP 258



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 23/48 (47%), Positives = 31/48 (64%)
 Frame = -3

Query: 150 TYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQWESR 7
           +Y + ++S    R++ +     FPADS K VPL +VSLDSR GQWE R
Sbjct: 237 SYTSQVISQSRTRVKLNRV--FFPADSAKAVPLLLVSLDSRKGQWEFR 282



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 19/31 (61%), Positives = 21/31 (67%)
 Frame = -3

Query: 504 AVLSQSLCVLNIWIKPAFALLLHARFLSSLS 412
           A LS+ + VL I IK AF LL H RFL SLS
Sbjct: 136 ATLSRFVFVLEIRIKRAFTLLFHTRFLFSLS 166


>UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 70

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 38/41 (92%), Positives = 39/41 (95%)
 Frame = -3

Query: 156 SPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 34
           SPTYATPLMSPYNARLESSSTGSSFPA+  KPVPLAVVSLD
Sbjct: 13  SPTYATPLMSPYNARLESSSTGSSFPANFSKPVPLAVVSLD 53


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 38/60 (63%), Positives = 43/60 (71%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V +RTE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NSPP +V   D
Sbjct: 30  IGHAFTVCIRTENQNQMSFYPFVLHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFHLD 89



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = -1

Query: 638 MIGRADIEGSKSNVAMNAWLPQASYPCGN 552
           MIGRADIEGSKSNVAMNAWLPQASYPCG+
Sbjct: 1   MIGRADIEGSKSNVAMNAWLPQASYPCGS 29


>UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep:
           LRRG00134 - Rattus norvegicus (Rat)
          Length = 221

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 32/36 (88%), Positives = 33/36 (91%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTS 537
           F MIGRADIEGSKS+VAMNAW PQASYPCGNFS TS
Sbjct: 36  FTMIGRADIEGSKSDVAMNAWPPQASYPCGNFSDTS 71


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 34/56 (60%), Positives = 40/56 (71%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSV 341
           IG AF     +E  +Q SF PF+ +E+SVL+EL  GHLRY LTDVPPQSNSPP  V
Sbjct: 52  IGHAFTFSTFSESRNQTSFSPFSLQEISVLSELVFGHLRYYLTDVPPQSNSPPDYV 107



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 29/34 (85%), Positives = 30/34 (88%)
 Frame = -1

Query: 638 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTS 537
           MIGRADIEGSKS VA +AW PQASYPCGNFS TS
Sbjct: 1   MIGRADIEGSKSYVARSAWQPQASYPCGNFSDTS 34


>UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10;
           Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana
           tabacum (Common tobacco)
          Length = 530

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 54/117 (46%), Positives = 63/117 (53%)
 Frame = -3

Query: 378 MYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRGPPILSTAHRFRPTE*VMK 199
           M RPSQTP L +SS RI  +              +LG+K RG   L      + T  V+ 
Sbjct: 1   MCRPSQTPHLTMSSARIGLQ-------------ASLGSKKRGSAPLPIHGISKITLKVVV 47

Query: 198 Q*K*WFFSDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR 28
               + F       +PTY TPL S +   LESSSTGSSFPADS KPVPL VVSLDSR
Sbjct: 48  ----FHFR----LSAPTYTTPLKSFHKVGLESSSTGSSFPADSAKPVPLVVVSLDSR 96


>UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 116

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 34/43 (79%), Positives = 36/43 (83%)
 Frame = +1

Query: 511 SFSIKSF*PEVPEKLPQG*LACGSQAFIATLLFDPSMSALPII 639
           SF+  SF  EV EKLPQG LACGSQ FI+TLLFDPSMSALPII
Sbjct: 57  SFNFTSFKLEVSEKLPQGQLACGSQEFISTLLFDPSMSALPII 99



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 30/53 (56%), Positives = 35/53 (66%)
 Frame = +2

Query: 350 RRGV*LGRYICQRITQVS*GQLSEDRNLAWSKRAKAGLIQMFSTHRDCESTAY 508
           R GV LGR  CQ ITQ S  QLSE+ NL  +KR KA LI +FS + + ES AY
Sbjct: 3   RGGVCLGRNACQTITQASQVQLSENGNLTQNKRVKATLILIFSRNTNRESVAY 55


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 33/56 (58%), Positives = 38/56 (67%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSV 341
           IG AF     +E  +Q SF PF+ +E+SVL EL  GHL Y LTDVPPQSNSP G V
Sbjct: 30  IGHAFTFSTFSESRNQTSFSPFSLQEISVLFELVFGHLCYFLTDVPPQSNSPSGYV 85



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 24/29 (82%), Positives = 25/29 (86%)
 Frame = -1

Query: 638 MIGRADIEGSKSNVAMNAWLPQASYPCGN 552
           MIGRADIE SKS VA NAW PQASYPCG+
Sbjct: 1   MIGRADIERSKSYVAKNAWQPQASYPCGS 29


>UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 108

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 32/56 (57%), Positives = 38/56 (67%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSV 341
           IG AF V +RT + +Q SF  F   E+ VL +L LGHLRY LTDV PQ NSPP +V
Sbjct: 28  IGYAFNVRIRTGNQNQTSFYHFVLHEIFVLVKLILGHLRYLLTDVSPQPNSPPDNV 83


>UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47;
           Eukaryota|Rep: Uncharacterized protein YLR162W-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 62

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/46 (60%), Positives = 32/46 (69%)
 Frame = -2

Query: 490 VPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSP 353
           V + TE+ +Q  F PF   E+SVL E  LGHLRY LTDVPPQ NSP
Sbjct: 2   VCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSP 47


>UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 70

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/35 (77%), Positives = 29/35 (82%)
 Frame = -3

Query: 123 YNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQ 19
           +  RLESSSTGSSFPAD  KPVPLA+ SLDSR GQ
Sbjct: 19  HKVRLESSSTGSSFPADYSKPVPLAMGSLDSRQGQ 53


>UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_557_1225 - Giardia lamblia ATCC
           50803
          Length = 222

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 23/40 (57%), Positives = 24/40 (60%)
 Frame = +2

Query: 2   D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSSLAL 121
           D R SHCP     E  A GTG G  AG+EDP ELDSS  L
Sbjct: 2   DQRGSHCPEPRLREPPASGTGEGRPAGQEDPFELDSSPGL 41


>UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 440

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 20/21 (95%), Positives = 21/21 (100%)
 Frame = -3

Query: 630 KSRHRRIKKQRRYERLAATSQ 568
           KSRHRRIKK+RRYERLAATSQ
Sbjct: 50  KSRHRRIKKRRRYERLAATSQ 70



 Score = 41.5 bits (93), Expect = 0.017
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = -1

Query: 377 CTAPVKLPAWQCPRTGSR 324
           CTAPVKLP W CPR+GSR
Sbjct: 75  CTAPVKLPTWHCPRSGSR 92


>UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3;
           Euarchontoglires|Rep: 4933429F08Rik protein - Mus
           musculus (Mouse)
          Length = 29

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 17/19 (89%), Positives = 17/19 (89%)
 Frame = -1

Query: 593 MNAWLPQASYPCGNFSGTS 537
           MNAW PQASYPCGNFS TS
Sbjct: 1   MNAWPPQASYPCGNFSDTS 19


>UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2;
           Streptococcus pneumoniae|Rep: Putative uncharacterized
           protein - Streptococcus pneumoniae SP3-BS71
          Length = 44

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 23/39 (58%), Positives = 25/39 (64%)
 Frame = +1

Query: 361 LTGAVHLSKNNAGVLRPAQRGQKPRVEQKGKSWLDPDVQ 477
           + GA HL  +NA VLR A   QK  VEQKGKS LD D Q
Sbjct: 1   MAGAAHLLNDNADVLRGAHGEQKSPVEQKGKSPLDFDFQ 39


>UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3;
           Thermoproteaceae|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-061
          Length = 234

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 18/40 (45%), Positives = 25/40 (62%)
 Frame = +3

Query: 3   INEIPTVPIYYLAKPQPRERAWENQRGKKTLLSLTLVWHC 122
           INE+PTVP    A P P  ++W+ +RG+K+L S T    C
Sbjct: 183 INEVPTVPARGPANPPPGAQSWDPRRGEKSLWSFTAACRC 222


>UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC
           50803
          Length = 329

 Score = 37.1 bits (82), Expect = 0.36
 Identities = 20/35 (57%), Positives = 21/35 (60%)
 Frame = -3

Query: 111 LESSSTGSSFPADSPKPVPLAVVSLDSR*GQWESR 7
           LESSS GSS PA  P PVP A  S     GQW+ R
Sbjct: 178 LESSSKGSSCPAGRPSPVPEAGGSRRRGSGQWDPR 212


>UniRef50_O74086 Cluster: Putative uncharacterized protein PHS003;
           n=1; Pyrococcus horikoshii|Rep: Putative uncharacterized
           protein PHS003 - Pyrococcus horikoshii
          Length = 52

 Score = 36.3 bits (80), Expect = 0.63
 Identities = 19/34 (55%), Positives = 20/34 (58%)
 Frame = +1

Query: 355 GSLTGAVHLSKNNAGVLRPAQRGQKPRVEQKGKS 456
           GSL GA    K   G LR AQ GQ+  VE KGKS
Sbjct: 2   GSLAGAARPRKGIGGALRSAQAGQESAVECKGKS 35


>UniRef50_Q4S9Z6 Cluster: Chromosome undetermined SCAF14693, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF14693, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 125

 Score = 35.9 bits (79), Expect = 0.84
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = -3

Query: 174 DDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*G 22
           ++  K SP   TP +SP+++ L  SS+ S  P  SP P P AV+  + + G
Sbjct: 41  EEGGKASPEQDTPPVSPHSSLLSPSSSCSPPPFYSPPPSPTAVLFCEDKAG 91


>UniRef50_Q972E8 Cluster: Putative uncharacterized protein ST1183;
           n=1; Sulfolobus tokodaii|Rep: Putative uncharacterized
           protein ST1183 - Sulfolobus tokodaii
          Length = 117

 Score = 35.9 bits (79), Expect = 0.84
 Identities = 19/41 (46%), Positives = 19/41 (46%)
 Frame = -2

Query: 463 QASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSV 341
           QA FCP   R  SV  E   G   Y    VPPQ N PP  V
Sbjct: 23  QAGFCPCTLRRRSVPPEPTFGLPCYLFAGVPPQPNRPPDDV 63


>UniRef50_A5ZYV6 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus obeum ATCC 29174|Rep: Putative
           uncharacterized protein - Ruminococcus obeum ATCC 29174
          Length = 114

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 13/17 (76%), Positives = 13/17 (76%)
 Frame = -1

Query: 374 TAPVKLPAWQCPRTGSR 324
           TAPVKLP W CP  GSR
Sbjct: 55  TAPVKLPVWHCPTAGSR 71


>UniRef50_Q8VPR4 Cluster: Putative transcriptional activator; n=1;
           Micrococcus sp. 28|Rep: Putative transcriptional
           activator - Micrococcus sp. 28
          Length = 241

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 21/63 (33%), Positives = 31/63 (49%)
 Frame = +1

Query: 247 RRATVFRSKRAEW*RGGNARRRLKLPRDPVRGHCQAGSLTGAVHLSKNNAGVLRPAQRGQ 426
           RRA   R+ +A    G ++R  ++L R P RGH   G   G +H  +   G  R  + G 
Sbjct: 91  RRALHPRAAQAHRHHGPHSRPLVRLRR-PARGHDHRGRAGGLLHSRREGPGGARTGRPGP 149

Query: 427 KPR 435
           +PR
Sbjct: 150 RPR 152


>UniRef50_Q05JI3 Cluster: Blue light regulator 1; n=2;
            Pleosporales|Rep: Blue light regulator 1 - Bipolaris
            oryzae
          Length = 1054

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = -1

Query: 341  PRTGSRGSFKRRRAFPPRHHSARLERNTVARRYYRPRTASAQPSK 207
            PRT S  S K +++  PRHH  + E     ++ + P T+ A PSK
Sbjct: 972  PRTSSATSDKSKKSASPRHHQTKSE---AGQQAFSPSTSMATPSK 1013


>UniRef50_Q54SH1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1346

 Score = 33.5 bits (73), Expect = 4.5
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 2/111 (1%)
 Frame = -3

Query: 366 SQTPRLAVSSNRITREF*TATSVSATSPLCTL-GTKHRGPPILSTAHRFRPTE*VMKQ*K 190
           S TP+ +++ NR++  F   T+ S+T     L  T        ST +R   T  + K   
Sbjct: 316 SLTPQKSLTPNRLSGTFPRTTTSSSTPTSSPLRSTSSTTTTSSSTPNRLSST--INKVVS 373

Query: 189 *WFFSDDRAKRSPTY-ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVS 40
               S   +  SPT  ATPL     ++L S+++ SS  + +P   PL+  S
Sbjct: 374 SSPSSTSSSSSSPTRSATPLPPTSTSKLSSTTSSSSSSSSTPNKTPLSTRS 424


>UniRef50_UPI0000D9CAA4 Cluster: PREDICTED: hypothetical protein;
           n=1; Macaca mulatta|Rep: PREDICTED: hypothetical protein
           - Macaca mulatta
          Length = 181

 Score = 33.1 bits (72), Expect = 5.9
 Identities = 13/44 (29%), Positives = 24/44 (54%)
 Frame = -1

Query: 341 PRTGSRGSFKRRRAFPPRHHSARLERNTVARRYYRPRTASAQPS 210
           P    +G F ++   P RH +    R+  +RR++ PR+ S+ P+
Sbjct: 4   PSAFQKGRFLKKTTTPTRHQATATARHHGSRRHFSPRSRSSPPT 47


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 679,054,869
Number of Sequences: 1657284
Number of extensions: 14554869
Number of successful extensions: 43392
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 41390
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43372
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 48541014171
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).