SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0097
         (620 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q69FX2 Cluster: Promoting protein; n=2; Bombyx mori|Rep...   135   9e-31
UniRef50_UPI0000DB7A3F Cluster: PREDICTED: hypothetical protein;...    59   7e-08
UniRef50_UPI00015B43A7 Cluster: PREDICTED: similar to ENSANGP000...    59   1e-07
UniRef50_Q7Q0A4 Cluster: ENSANGP00000020083; n=1; Anopheles gamb...    51   3e-05
UniRef50_Q17DQ0 Cluster: Niemann-Pick Type C-2, putative; n=1; A...    49   8e-05
UniRef50_Q8IGP0 Cluster: RE56164p; n=5; Sophophora|Rep: RE56164p...    48   1e-04
UniRef50_Q8IMH5 Cluster: CG11315-PB, isoform B; n=1; Drosophila ...    45   0.002
UniRef50_O17271 Cluster: Putative protein heh-1 precursor; n=2; ...    36   0.59 
UniRef50_Q8UZF3 Cluster: BDLF3; n=1; Cercopithecine herpesvirus ...    34   2.4  
UniRef50_A7SM29 Cluster: Predicted protein; n=1; Nematostella ve...    34   2.4  
UniRef50_A5DPI3 Cluster: Putative uncharacterized protein; n=2; ...    33   5.5  
UniRef50_A4QXI3 Cluster: Putative uncharacterized protein; n=1; ...    32   9.6  

>UniRef50_Q69FX2 Cluster: Promoting protein; n=2; Bombyx mori|Rep:
           Promoting protein - Bombyx mori (Silk moth)
          Length = 154

 Score =  135 bits (326), Expect = 9e-31
 Identities = 58/58 (100%), Positives = 58/58 (100%)
 Frame = +1

Query: 310 DACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVRLV 483
           DACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVRLV
Sbjct: 97  DACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVRLV 154



 Score =  130 bits (315), Expect = 2e-29
 Identities = 60/63 (95%), Positives = 60/63 (95%)
 Frame = +3

Query: 78  EFNVVTTRLCREVDASACTVNEVRIDPCVNSRLCHLKKGKNAKVSFDFTPQFSTTKLKTA 257
           EFNVVTTRLCREVDASACTVNEVRIDPCVNSRLCHLKKGKNAKVSFDFTPQFSTTKLKT 
Sbjct: 19  EFNVVTTRLCREVDASACTVNEVRIDPCVNSRLCHLKKGKNAKVSFDFTPQFSTTKLKTG 78

Query: 258 SLG 266
             G
Sbjct: 79  LFG 81



 Score = 40.3 bits (90), Expect = 0.036
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +2

Query: 257 LFGLKNGAEIPFDALYN 307
           LFGLKNGAEIPFDALYN
Sbjct: 79  LFGLKNGAEIPFDALYN 95


>UniRef50_UPI0000DB7A3F Cluster: PREDICTED: hypothetical protein;
           n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein
           - Apis mellifera
          Length = 159

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 24/57 (42%), Positives = 33/57 (57%)
 Frame = +1

Query: 310 DACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVRL 480
           DAC  TSCP EAG   T    + I KK P   ++ KWK+WN+  E Q CC+   +++
Sbjct: 103 DACLSTSCPIEAGSRNTYHVEIPILKKYPVRTYDLKWKIWND--EEQECCFMFQIKI 157



 Score = 40.7 bits (91), Expect = 0.027
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 3/44 (6%)
 Frame = +3

Query: 129 CTVNEVRIDPC---VNSRLCHLKKGKNAKVSFDFTPQFSTTKLK 251
           CT++EV IDPC      + C +K+G    ++F +TP FS+ K++
Sbjct: 40  CTIHEVYIDPCKEITEGKPCKIKRGVIGNMTFHYTPAFSSDKVQ 83


>UniRef50_UPI00015B43A7 Cluster: PREDICTED: similar to
           ENSANGP00000020083, partial; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to
           ENSANGP00000020083, partial - Nasonia vitripennis
          Length = 128

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 24/62 (38%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +1

Query: 301 LQCDACTL-TSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVR 477
           ++ DAC   T+CP       T + +L I KK PT  F+ KWKLWN + E ++CC+   + 
Sbjct: 66  MESDACKEGTTCPLARDTKYTYNINLPISKKFPTRPFDVKWKLWNTEKEDELCCFLFQIN 125

Query: 478 LV 483
           L+
Sbjct: 126 LL 127



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 23/45 (51%), Positives = 36/45 (80%), Gaps = 3/45 (6%)
 Frame = +3

Query: 129 CTVNEVRIDPC---VNSRLCHLKKGKNAKVSFDFTPQFSTTKLKT 254
           CT++EVR+ PC   V  + C+LKKG++AK+SFDFTP+F  +K+++
Sbjct: 6   CTIHEVRVLPCKEAVQGKACNLKKGEDAKISFDFTPKFDASKVES 50


>UniRef50_Q7Q0A4 Cluster: ENSANGP00000020083; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000020083 - Anopheles gambiae
           str. PEST
          Length = 161

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 36/63 (57%)
 Frame = +1

Query: 313 ACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVRLV**T 492
           AC  T CPT +G  QT  + L I K  P  +++ KWKL  E++ES  CC+   + +   +
Sbjct: 101 ACKSTKCPTVSGTRQTYAYDLPIKKSYPPKHYDVKWKLTGENSES--CCFIVQINITKKS 158

Query: 493 QKT 501
           ++T
Sbjct: 159 KRT 161



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 3/43 (6%)
 Frame = +3

Query: 129 CTVNEVRIDPCVNSR---LCHLKKGKNAKVSFDFTPQFSTTKL 248
           CT++EV I PC  +     C + +G N  +SFDFTP+F+  +L
Sbjct: 37  CTIHEVSISPCPEAAEGVACTVYRGTNVSISFDFTPEFAANEL 79


>UniRef50_Q17DQ0 Cluster: Niemann-Pick Type C-2, putative; n=1;
           Aedes aegypti|Rep: Niemann-Pick Type C-2, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 157

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 21/60 (35%), Positives = 34/60 (56%)
 Frame = +1

Query: 301 LQCDACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVRL 480
           L  + C  T+CP  +G+ Q+  + L I K  P   ++ KW+L NE NE  MCC+  ++ +
Sbjct: 92  LDQEGCKYTTCPVVSGQRQSYSYDLPIMKSYPMRQYKVKWQLLNEANE--MCCFMIDMAI 149



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 3/54 (5%)
 Frame = +3

Query: 87  VVTTRLCREVDASACTVNEVRIDPCVNS---RLCHLKKGKNAKVSFDFTPQFST 239
           V+    C E  +  CTV+EVR+DPC  S   + C + +G NA ++FD+TP FS+
Sbjct: 21  VIPFEKCNE--SVKCTVHEVRVDPCPESAQNKPCVMVRGTNATIAFDYTPDFSS 72


>UniRef50_Q8IGP0 Cluster: RE56164p; n=5; Sophophora|Rep: RE56164p -
           Drosophila melanogaster (Fruit fly)
          Length = 168

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 3/63 (4%)
 Frame = +3

Query: 87  VVTTRLCREVDASACTVNEVRIDPC---VNSRLCHLKKGKNAKVSFDFTPQFSTTKLKTA 257
           VV    C +     CT+ +VR+ PC   +N+  C++++  N+++SFDFTP F    L  A
Sbjct: 34  VVNFEPCPD-SVDTCTIQQVRVSPCPEALNNAACNIRRKHNSEMSFDFTPNFDADTL-VA 91

Query: 258 SLG 266
           SLG
Sbjct: 92  SLG 94



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 17/62 (27%), Positives = 29/62 (46%)
 Frame = +1

Query: 298 SLQCDACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVR 477
           +L   AC  T CP  +G  QT    + I  K P   +  +W L  +    + CC+  +++
Sbjct: 107 TLDSAACKYTPCPVRSGVKQTYTTLVPIEAKFPLSPYTIRWAL-KDPVSQKRCCFTIDIK 165

Query: 478 LV 483
           +V
Sbjct: 166 VV 167


>UniRef50_Q8IMH5 Cluster: CG11315-PB, isoform B; n=1; Drosophila
           melanogaster|Rep: CG11315-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 130

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 87  VVTTRLCREVDASACTVNEVRIDPCVNSRL---CHLKKGKNAKVSFDFTPQFSTTKLKTA 257
           +V  + C +    +C++++VR+ PC  +     CH+++     +SFDFTP F    L  A
Sbjct: 23  IVNFQTCED-SVDSCSISQVRVTPCPEANANAACHIRRRHRFTMSFDFTPHFDADTL-VA 80

Query: 258 SLG*RMALKFLLMLSTM 308
           SLG   +    L L TM
Sbjct: 81  SLGWAKSENVELPLLTM 97


>UniRef50_O17271 Cluster: Putative protein heh-1 precursor; n=2;
           Caenorhabditis|Rep: Putative protein heh-1 precursor -
           Caenorhabditis elegans
          Length = 154

 Score = 36.3 bits (80), Expect = 0.59
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)
 Frame = +1

Query: 310 DACTL-TSCPTEAGKTQTLDFSLHIGKKLPTGN-FEFKWKLWNEDNESQMC 456
           DACT    CP  AG+ Q  + S+ I +  P G   +  W+L   D+  ++C
Sbjct: 95  DACTYGVKCPVSAGENQIFEQSISITENHPAGEVIQVNWQLTRPDSGKEVC 145


>UniRef50_Q8UZF3 Cluster: BDLF3; n=1; Cercopithecine herpesvirus
           15|Rep: BDLF3 - Cercopithecine herpesvirus 15 (Rhesus
           lymphocryptovirus)
          Length = 259

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = -2

Query: 163 TQGSIRTSFTVHALASTSRHSLVVTTLNSARPQPRN-AANNSEE*RAMLYT 14
           TQ +  T+ T HA  +TS  S   TT  ++ P+P N  AN +EE  A L T
Sbjct: 144 TQATSTTNATTHAANATSNVSTEATTSTTSTPEPSNVTANATEETTAELPT 194


>UniRef50_A7SM29 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 149

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +1

Query: 307 CDACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMC 456
           C    LT CP ++GK   L F  +I +  PTG+   K +L ++D++  +C
Sbjct: 93  CKGYGLT-CPLKSGKQVELVFEHYIDQTFPTGHLTLKAELKDQDSDVVIC 141


>UniRef50_A5DPI3 Cluster: Putative uncharacterized protein; n=2;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 593

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 36/109 (33%), Positives = 52/109 (47%), Gaps = 6/109 (5%)
 Frame = -2

Query: 316 KRHIVESIKRNFSAILQPK-EAVLSLVVENCGVKSKETFAFFPFLRWHSRLLTQGSIRTS 140
           + ++V   K NF  I   K E ++S  +E   V  K    F  FL   S +L  G++R+S
Sbjct: 17  EENLVPVQKHNFKLIGALKSELMISQYLE---VVPKIAVLFSSFLIGFSYML-DGNVRSS 72

Query: 139 FTVHALASTSRHSL-----VVTTLNSARPQPRNAANNSEE*RAMLYTLT 8
           FT +A  S   HSL     VVTT+ +A  Q   A       RA +Y ++
Sbjct: 73  FTGYATGSYGHHSLLSTINVVTTIIAAAGQVVYARLTDTFGRAEMYVIS 121


>UniRef50_A4QXI3 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 276

 Score = 32.3 bits (70), Expect = 9.6
 Identities = 9/30 (30%), Positives = 20/30 (66%)
 Frame = +3

Query: 84  NVVTTRLCREVDASACTVNEVRIDPCVNSR 173
           N++T R+C ++ A  C  N+  +D C++++
Sbjct: 224 NIITNRVCDQLGAQTCGANQAAVDLCLDAK 253


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 594,140,926
Number of Sequences: 1657284
Number of extensions: 11811629
Number of successful extensions: 28802
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 27798
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28790
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 45221970467
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).