SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0095
         (760 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...   110   4e-23
UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ...    64   3e-09
UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0...    56   7e-07
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    56   9e-07
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    56   1e-06
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    52   1e-05
UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella ve...    51   3e-05
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    50   5e-05
UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47...    50   5e-05
UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontog...    47   6e-04
UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; ...    40   0.067
UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; ...    38   0.20 
UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2; ...    35   1.9  
UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia scl...    35   2.5  
UniRef50_A3B1W2 Cluster: Putative uncharacterized protein; n=4; ...    34   3.3  
UniRef50_P38968 Cluster: Protein transport protein SEC31; n=6; S...    34   4.4  
UniRef50_A4HHL8 Cluster: Putative uncharacterized protein; n=3; ...    33   5.8  
UniRef50_Q5KKC3 Cluster: Expressed protein; n=2; Filobasidiella ...    33   5.8  
UniRef50_Q5BGW6 Cluster: Putative uncharacterized protein; n=1; ...    33   5.8  
UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7; ...    33   5.8  
UniRef50_Q3W7D7 Cluster: Regulatory protein, TetR; n=1; Frankia ...    33   7.7  
UniRef50_Q0UKE4 Cluster: Predicted protein; n=1; Phaeosphaeria n...    33   7.7  
UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20; ...    33   7.7  

>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score =  110 bits (264), Expect = 4e-23
 Identities = 66/132 (50%), Positives = 77/132 (58%), Gaps = 3/132 (2%)
 Frame = +1

Query: 373 HQ*GKTNLSHDGLIPAHVPF*WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIP 552
           HQ GKTNLSHDGLIPAHVP+ WVNNPTLGEFCF MIGRADIEGSK+         +   P
Sbjct: 57  HQWGKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKSNVAMNAWLPQASYP 116

Query: 553 VVTFLAPLAKNSLY*RIDRPCFRSPYAY*TS---GSSQLLPFAPREVSVLAELALGHLRY 723
              F +  +        DR    S + +        +  L F  R +  L+  +LGHLRY
Sbjct: 117 CGNF-SDTSSFKFRSLKDRLATLSRFVFVLEIRIKRAFTLLFHTRFLFSLSS-SLGHLRY 174

Query: 724 SLTDVPPQSNSP 759
            LTDVPPQ NSP
Sbjct: 175 LLTDVPPQPNSP 186



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 37/53 (69%), Positives = 40/53 (75%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIKPAF 662
           K+NVAMNAWLPQASYPCGNFS TS  K   LKDR A LS+ + VL I IK AF
Sbjct: 101 KSNVAMNAWLPQASYPCGNFSDTSSFKFRSLKDRLATLSRFVFVLEIRIKRAF 153


>UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 116

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 33/54 (61%), Positives = 40/54 (74%)
 Frame = -1

Query: 670 QKAKAGLIQMFSTHRDCESTAYRSFSIKSF*QEVPEKLPQG*LACGSQAFIATL 509
           ++ KA LI +FS + + ES AYRSF+  SF  EV EKLPQG LACGSQ FI+TL
Sbjct: 34  KRVKATLILIFSRNTNRESVAYRSFNFTSFKLEVSEKLPQGQLACGSQEFISTL 87



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 27/57 (47%), Positives = 33/57 (57%)
 Frame = -3

Query: 593 YKEFLARGARKVTTGITGLWQPSVHSDVVFDPSMSALPIIAKQNSPSVGLFTHQKGT 423
           +  F    + K+  G          S ++FDPSMSALPII KQNS  VGLFT Q+GT
Sbjct: 60  FTSFKLEVSEKLPQGQLACGSQEFISTLLFDPSMSALPIIVKQNSQRVGLFTRQQGT 116



 Score = 36.7 bits (81), Expect = 0.62
 Identities = 20/33 (60%), Positives = 22/33 (66%)
 Frame = -2

Query: 756 GV*LGRYICQRITQVS*GQLSEDRNLAWSKRQK 658
           GV LGR  CQ ITQ S  QLSE+ NL  +KR K
Sbjct: 5   GVCLGRNACQTITQASQVQLSENGNLTQNKRVK 37


>UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep:
           LRRG00134 - Rattus norvegicus (Rat)
          Length = 221

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 23/25 (92%), Positives = 24/25 (96%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKT 510
           WVNNPTLGEFCF MIGRADIEGSK+
Sbjct: 25  WVNNPTLGEFCFTMIGRADIEGSKS 49



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 22/27 (81%), Positives = 24/27 (88%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*K 584
           K++VAMNAW PQASYPCGNFS TSC K
Sbjct: 48  KSDVAMNAWPPQASYPCGNFSDTSCLK 74


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 24/32 (75%), Positives = 28/32 (87%)
 Frame = +1

Query: 664 PFAPREVSVLAELALGHLRYSLTDVPPQSNSP 759
           PF+ +E+SVL+EL  GHLRY LTDVPPQSNSP
Sbjct: 72  PFSLQEISVLSELVFGHLRYYLTDVPPQSNSP 103



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/24 (75%), Positives = 20/24 (83%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTS 575
           K+ VA +AW PQASYPCGNFS TS
Sbjct: 11  KSYVARSAWQPQASYPCGNFSDTS 34


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 38/95 (40%), Positives = 46/95 (48%)
 Frame = +1

Query: 475 MIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPCFRSPYAY*TSGSS 654
           MIGRADIEGSK+            +P  ++      ++        C R+          
Sbjct: 1   MIGRADIEGSKSNV-----AMNAWLPQASYPCGSIGHAF-----TVCIRTE----NQNQM 46

Query: 655 QLLPFAPREVSVLAELALGHLRYSLTDVPPQSNSP 759
              PF   E+SVL EL LGHLRY LTDVPPQ NSP
Sbjct: 47  SFYPFVLHEISVLVELILGHLRYLLTDVPPQPNSP 81



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/19 (89%), Positives = 19/19 (100%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGN 560
           K+NVAMNAWLPQASYPCG+
Sbjct: 11  KSNVAMNAWLPQASYPCGS 29


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 31/68 (45%), Positives = 40/68 (58%), Gaps = 6/68 (8%)
 Frame = +1

Query: 574 LAKNSLY*RIDRPCFRSPYAY*TSGSSQ------LLPFAPREVSVLAELALGHLRYSLTD 735
           +AKN+   +   PC    +A+  S  S+        PF+ +E+SVL EL  GHL Y LTD
Sbjct: 14  VAKNAWQPQASYPCGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLFELVFGHLCYFLTD 73

Query: 736 VPPQSNSP 759
           VPPQSNSP
Sbjct: 74  VPPQSNSP 81



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 15/21 (71%), Positives = 17/21 (80%)
 Frame = +3

Query: 498 RIKNNVAMNAWLPQASYPCGN 560
           R K+ VA NAW PQASYPCG+
Sbjct: 9   RSKSYVAKNAWQPQASYPCGS 29


>UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 746

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 22/30 (73%), Positives = 26/30 (86%)
 Frame = -3

Query: 359 IVILLSTRGTAVSDIWFMHSAERPVVRSYH 270
           +VILLSTRGTA SD W +H AE+P+VRSYH
Sbjct: 660 VVILLSTRGTADSDNWHLHLAEKPMVRSYH 689


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +1

Query: 664 PFAPREVSVLAELALGHLRYSLTDVPPQSNSP 759
           PF   E+SVL E  LGHLRY LTDVPPQ NSP
Sbjct: 50  PFVLLEISVLHESPLGHLRYRLTDVPPQPNSP 81



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +3

Query: 519 MNAWLPQASYPCGNFSGTS 575
           MNAWLPQASYPCGNFSGTS
Sbjct: 1   MNAWLPQASYPCGNFSGTS 19


>UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47;
           Eukaryota|Rep: Uncharacterized protein YLR162W-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 62

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +1

Query: 664 PFAPREVSVLAELALGHLRYSLTDVPPQSNSP 759
           PF   E+SVL E  LGHLRY LTDVPPQ NSP
Sbjct: 16  PFVLLEISVLHESPLGHLRYRLTDVPPQPNSP 47


>UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3;
           Euarchontoglires|Rep: 4933429F08Rik protein - Mus
           musculus (Mouse)
          Length = 29

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = +3

Query: 519 MNAWLPQASYPCGNFSGTSC*K 584
           MNAW PQASYPCGNFS TSC K
Sbjct: 1   MNAWPPQASYPCGNFSDTSCLK 22


>UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 108

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/31 (64%), Positives = 22/31 (70%)
 Frame = +1

Query: 667 FAPREVSVLAELALGHLRYSLTDVPPQSNSP 759
           F   E+ VL +L LGHLRY LTDV PQ NSP
Sbjct: 49  FVLHEIFVLVKLILGHLRYLLTDVSPQPNSP 79


>UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4;
           Bacteria|Rep: Putative uncharacterized protein -
           Magnetospirillum gryphiswaldense
          Length = 76

 Score = 39.9 bits (89), Expect = 0.067
 Identities = 20/34 (58%), Positives = 21/34 (61%)
 Frame = -1

Query: 496 RCRLFLSLRSKIRQALDCSPIKRERELGLDRRET 395
           RCRL  S      Q   CSPIK  RELGL+RRET
Sbjct: 4   RCRLITSWGWSRSQGFGCSPIKVVRELGLERRET 37


>UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4;
           Eukaryota|Rep: Putative uncharacterized protein -
           Plasmodium berghei
          Length = 54

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 16/18 (88%), Positives = 16/18 (88%)
 Frame = -1

Query: 448 DCSPIKRERELGLDRRET 395
           DCSP  RERELGLDRRET
Sbjct: 6   DCSPANRERELGLDRRET 23


>UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2;
           Streptococcus pneumoniae|Rep: Putative uncharacterized
           protein - Streptococcus pneumoniae SP3-BS71
          Length = 44

 Score = 35.1 bits (77), Expect = 1.9
 Identities = 18/34 (52%), Positives = 21/34 (61%)
 Frame = -1

Query: 751 LTGAVHLSKNNAGVLRPAQRGQKPRVEQKAKAGL 650
           + GA HL  +NA VLR A   QK  VEQK K+ L
Sbjct: 1   MAGAAHLLNDNADVLRGAHGEQKSPVEQKGKSPL 34


>UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia
           sclerotiorum 1980|Rep: Predicted protein - Sclerotinia
           sclerotiorum 1980
          Length = 147

 Score = 34.7 bits (76), Expect = 2.5
 Identities = 15/23 (65%), Positives = 18/23 (78%)
 Frame = +1

Query: 439 VNNPTLGEFCFAMIGRADIEGSK 507
           VN+P L EFCF +  RADIEGS+
Sbjct: 120 VNSPMLTEFCFGIRERADIEGSE 142


>UniRef50_A3B1W2 Cluster: Putative uncharacterized protein; n=4;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 486

 Score = 34.3 bits (75), Expect = 3.3
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = -2

Query: 321 GHLVHALGRAAGGAKLPSAGLCRTPLR 241
           GH  H +G AAGGA  P  G+ R PLR
Sbjct: 352 GHGDHRVGAAAGGAAAPGGGMVRHPLR 378


>UniRef50_P38968 Cluster: Protein transport protein SEC31; n=6;
            Saccharomycetales|Rep: Protein transport protein SEC31 -
            Saccharomyces cerevisiae (Baker's yeast)
          Length = 1273

 Score = 33.9 bits (74), Expect = 4.4
 Identities = 21/74 (28%), Positives = 33/74 (44%)
 Frame = +1

Query: 538  KPVIPVVTFLAPLAKNSLY*RIDRPCFRSPYAY*TSGSSQLLPFAPREVSVLAELALGHL 717
            KP +P  T  AP+     Y    +P   SP+   T+ S++L  FAP   +  A   +   
Sbjct: 808  KPYVPATTTSAPVHTEGKYAPPSQPSMASPFVNKTNSSTRLNSFAP-PPNPYATATVPAT 866

Query: 718  RYSLTDVPPQSNSP 759
              S T +P  + +P
Sbjct: 867  NVSTTSIPQNTFAP 880


>UniRef50_A4HHL8 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania braziliensis
          Length = 489

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 17/60 (28%), Positives = 30/60 (50%)
 Frame = -1

Query: 346 SVREEPQFRTFGSCTRPSGRWCEATIRGIMPNASKAEASLAESGKDMLTVEPRESGGSKQ 167
           SV +E +  + G C  PS RW  A++R +    S    +  E+  D   ++  ++GGS +
Sbjct: 105 SVDKESEGESEGLCPSPSARWKRASLRAMRGRDSVPRLAATEARDDADEMDDIDNGGSDE 164


>UniRef50_Q5KKC3 Cluster: Expressed protein; n=2; Filobasidiella
           neoformans|Rep: Expressed protein - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 778

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 18/49 (36%), Positives = 24/49 (48%)
 Frame = -2

Query: 360 DSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCRTPLRPKPA*PNPA 214
           D     ++  RS G LV  LGR  G  KLP   +  +P RP+   P P+
Sbjct: 147 DQGDGGFDPERSLGRLVGELGRIIGDEKLPK--IPNSPFRPRSRSPLPS 193


>UniRef50_Q5BGW6 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 998

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 23/51 (45%), Positives = 26/51 (50%), Gaps = 2/51 (3%)
 Frame = -1

Query: 271 IRGIMPNASKAEASLAE--SGKDMLTVEPRESGGSKQCDFTSRVSHSKRET 125
           IRGIMP A + E S  E  SGK   TV    SGG    + +   S SKR T
Sbjct: 643 IRGIMPQADRMEVSEQEITSGK-TFTVGASGSGGPSNVNISMEGSKSKRST 692


>UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7;
           Archaea|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-062
          Length = 272

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 19/39 (48%), Positives = 21/39 (53%)
 Frame = -2

Query: 495 DVGSSYHCEAKFAKRWIVHPSKGNVSWD*TVVRQVSFTL 379
           DV SS+   A  AK  +  P KGNV W  TV RQV   L
Sbjct: 228 DVVSSHPGGAAAAKGGVARPLKGNVRWVQTVARQVGLYL 266


>UniRef50_Q3W7D7 Cluster: Regulatory protein, TetR; n=1; Frankia sp.
           EAN1pec|Rep: Regulatory protein, TetR - Frankia sp.
           EAN1pec
          Length = 220

 Score = 33.1 bits (72), Expect = 7.7
 Identities = 22/56 (39%), Positives = 27/56 (48%)
 Frame = -2

Query: 315 LVHALGRAAGGAKLPSAGLCRTPLRPKPA*PNPARICSLWSPESREALNNVTLLVA 148
           L  AL  AA G   P A L R  L    A P+P R+  LW+   RE +  V  L+A
Sbjct: 72  LKEALDVAAVGDDEPVALLDRPWLEELTAEPDPVRVIELWTHGGREIMGRVAPLLA 127


>UniRef50_Q0UKE4 Cluster: Predicted protein; n=1; Phaeosphaeria
           nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 298

 Score = 33.1 bits (72), Expect = 7.7
 Identities = 31/98 (31%), Positives = 42/98 (42%), Gaps = 5/98 (5%)
 Frame = -2

Query: 297 RAAGGAKLPSAGLCRTPLRPKPA*P--NPARICSLWSPESREALN---NVTLLVAFRIQN 133
           RA  G+K  S G  R  +   P  P  +P+   SL S + R   +   N++  +    QN
Sbjct: 50  RADRGSKTSSYGRGRDSVISHPFSPKQSPSPRSSLSSGDKRRHSSIPQNLSPTLVNDAQN 109

Query: 132 ARRDVEAHLDRGDRCYRFFS*HVHHGSEGPDITQFDVG 19
            RR  +AHLD     Y     H H GS   D   +D G
Sbjct: 110 IRRPPQAHLDPEKHGYGSSKPHRHSGSTRSDEAVYDQG 147


>UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20;
           n=1; Yarrowia lipolytica|Rep: Serine/threonine-protein
           kinase STE20 - Yarrowia lipolytica (Candida lipolytica)
          Length = 1125

 Score = 33.1 bits (72), Expect = 7.7
 Identities = 22/69 (31%), Positives = 30/69 (43%)
 Frame = -2

Query: 306 ALGRAAGGAKLPSAGLCRTPLRPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR 127
           A G +  GA  PSA     P RP PA   P  + S+ +P S      +T L AF  +  +
Sbjct: 639 ASGDSGAGAAPPSAAPKSPPPRPPPA--PPLGVPSVHAPNSEYRQKMITQLEAFNAKRQQ 696

Query: 126 RDVEAHLDR 100
              E H  +
Sbjct: 697 ERAERHAQK 705


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 793,809,230
Number of Sequences: 1657284
Number of extensions: 16370643
Number of successful extensions: 42891
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 41355
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42876
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 62969581935
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).