SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0092
         (720 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa...    94   3e-18
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    84   4e-15
UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo...    83   7e-15
UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ...    83   7e-15
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    69   1e-10
UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...    65   2e-09
UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;...    59   9e-08
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    53   6e-06
UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3; ...    48   2e-04
UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221...    47   4e-04
UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1; ...    44   0.005
UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia ...    39   0.11 
UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|R...    38   0.33 
UniRef50_Q7QW44 Cluster: GLP_457_25625_26368; n=2; Giardia intes...    37   0.58 
UniRef50_Q580V9 Cluster: Putative uncharacterized protein; n=1; ...    34   3.1  
UniRef50_A1HAT0 Cluster: 5-formyltetrahydrofolate cyclo-ligase-l...    34   4.1  
UniRef50_Q8WWQ5 Cluster: Mucin 5; n=17; root|Rep: Mucin 5 - Homo...    33   7.1  
UniRef50_Q96V83 Cluster: RecQ family helicase; n=1; Metarhizium ...    33   7.1  
UniRef50_Q6CQE6 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    33   9.4  

>UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa
           group|Rep: Zgc:165536 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 55

 Score = 94.3 bits (224), Expect = 3e-18
 Identities = 40/45 (88%), Positives = 43/45 (95%)
 Frame = +3

Query: 378 MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKKTLLA 512
           MPRHLISDAHEW+NEIPTVP  YLAKPQPRERAW+NQRGKKTLL+
Sbjct: 1   MPRHLISDAHEWMNEIPTVPTCYLAKPQPRERAWQNQRGKKTLLS 45


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 37/40 (92%), Positives = 39/40 (97%)
 Frame = -1

Query: 390 DDEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVN 271
           +DEAFGYLKRVIVTPAVYPRL+EFLH DIQSTGQKSHCVN
Sbjct: 113 NDEAFGYLKRVIVTPAVYPRLVEFLHFDIQSTGQKSHCVN 152


>UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10;
           Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana
           tabacum (Common tobacco)
          Length = 530

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 65/144 (45%), Positives = 77/144 (53%), Gaps = 2/144 (1%)
 Frame = -1

Query: 642 APFPPNRVSNETMKVVVFQ-RRSRETISHLCYTSH-VSLQCQTRVKLTGSSFPADSPKPV 469
           AP P + +S  T+KVVVF  R S  T +    + H V L+  +    TGSSFPADS KPV
Sbjct: 31  APLPIHGISKITLKVVVFHFRLSAPTYTTPLKSFHKVGLESSS----TGSSFPADSAKPV 86

Query: 468 PLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQ 289
           PL VVSLDSR     S  SIHA           L+    +P VYPRL+EFLH DIQSTG+
Sbjct: 87  PLVVVSLDSRQDSGISL-SIHAVTNKMTRHLATLRESCYSP-VYPRLVEFLHFDIQSTGR 144

Query: 288 KSHCVNTREGHPMLCFN*TVGFPL 217
            +   N R  H    F      PL
Sbjct: 145 IT-LRNIRRDHRNALFKLNSRIPL 167



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 23/34 (67%), Positives = 24/34 (70%)
 Frame = -3

Query: 286 ITLRQHPRGPSNALF*LDSRIPLVRASSELTVER 185
           ITLR   R   NALF L+SRIPLVR SSEL V R
Sbjct: 145 ITLRNIRRDHRNALFKLNSRIPLVRTSSELAVRR 178


>UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC
           50803
          Length = 329

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 46/74 (62%), Positives = 48/74 (64%)
 Frame = -1

Query: 504 GSSFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVYPRLL 325
           GSS PA  P PVP A  S     GQW+ R SIHAR  L DEAFGYLKRVIVTPAVY    
Sbjct: 184 GSSCPAGRPSPVPEAGGSRRRGSGQWDPRWSIHARRKLPDEAFGYLKRVIVTPAVYQGFG 243

Query: 324 EFLHVDIQSTGQKS 283
             LH D + TGQKS
Sbjct: 244 GSLHSDGRGTGQKS 257


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 32/43 (74%), Positives = 33/43 (76%)
 Frame = -1

Query: 387 DEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREG 259
           DE FGYLKRVIVTPAVY   +EF  VDI  TGQKSHCVNT  G
Sbjct: 144 DETFGYLKRVIVTPAVYLCFIEFHQVDIHGTGQKSHCVNTISG 186



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = -2

Query: 446 IVDRDSGNLVNPFMRVTN*MTRHLATLRES*LLPPFTRACLNFFTLTFRALG-RNHIAST 270
           I  RDS NLVNPFM VTN        L+   + P      + F  +     G ++H  +T
Sbjct: 125 IASRDSENLVNPFMHVTN-YDETFGYLKRVIVTPAVYLCFIEFHQVDIHGTGQKSHCVNT 183

Query: 269 PARAIQCFVLIRQSDSPCPCQF 204
            +   QC+VLI+QSDSPCP QF
Sbjct: 184 ISGFSQCYVLIKQSDSPCPFQF 205


>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 33/49 (67%), Positives = 35/49 (71%)
 Frame = -1

Query: 564 SHLCYTSHVSLQCQTRVKLTGSSFPADSPKPVPLAVVSLDSR*GQWESR 418
           SHL YTS V  Q +TRVKL    FPADS K VPL +VSLDSR GQWE R
Sbjct: 234 SHLSYTSQVISQSRTRVKLNRVFFPADSAKAVPLLLVSLDSRKGQWEFR 282


>UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 70

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 33/58 (56%), Positives = 34/58 (58%)
 Frame = -2

Query: 566 SPTYATPLMSPYNARLEXXXXXXXXXXXXXXXXPWLWFR*IVDRDSGNLVNPFMRVTN 393
           SPTYATPLMSPYNARLE                P       + RDSGNLVNPFMRVTN
Sbjct: 13  SPTYATPLMSPYNARLESSSTGSSFPANFSKPVPLAVVSLDMGRDSGNLVNPFMRVTN 70


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 28/49 (57%), Positives = 34/49 (69%)
 Frame = -1

Query: 633 PPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLTGSSFPA 487
           P + +S ETM+VVVF RR     SHL YT HVS QCQTRVKL  +++ A
Sbjct: 97  PLHWISKETMEVVVFHRRRS---SHLFYTLHVSSQCQTRVKLNHAAYTA 142


>UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3;
           Thermoproteaceae|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-061
          Length = 234

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +3

Query: 396 SDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKKTL 506
           S  HEWINE+PTVP    A P P  ++W+ +RG+K+L
Sbjct: 177 SGVHEWINEVPTVPARGPANPPPGAQSWDPRRGEKSL 213


>UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221;
           n=2; Pyrococcus|Rep: Putative uncharacterized protein
           PH0221 - Pyrococcus horikoshii
          Length = 235

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 29/56 (51%), Positives = 31/56 (55%)
 Frame = -1

Query: 504 GSSFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 337
           GSS P   P     A VS     GQ   R +IHA   L D+ F YLKRVIVTPAVY
Sbjct: 2   GSSLPTGGPWHARQAEVSPGPGRGQRGPRYAIHAGRHLTDKEFRYLKRVIVTPAVY 57


>UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 421

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 29/71 (40%), Positives = 38/71 (53%)
 Frame = +3

Query: 246 KALDGPRGC*RNVISAQCSECQREEIQASAGKRRE*L*LS*GSQMPRHLISDAHEWINEI 425
           K  +GP GC RNVIS+Q    +  +++ S                  HLISDAHEWIN+ 
Sbjct: 372 KNCNGPCGCSRNVISSQ----RNVKVKKS-----------------NHLISDAHEWINKN 410

Query: 426 PTVPIYYLAKP 458
           PT+ +YY  KP
Sbjct: 411 PTILVYYPTKP 421


>UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1;
           Crassostrea gigas|Rep: Tyrosine-protein kinase receptor
           - Crassostrea gigas (Pacific oyster) (Crassostrea
           angulata)
          Length = 804

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/25 (80%), Positives = 21/25 (84%)
 Frame = +3

Query: 276 RNVISAQCSECQREEIQASAGKRRE 350
           RNVISAQCSECQ EEIQ+S GK  E
Sbjct: 1   RNVISAQCSECQSEEIQSSEGKGGE 25


>UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 70

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/26 (80%), Positives = 22/26 (84%)
 Frame = -1

Query: 507 TGSSFPADSPKPVPLAVVSLDSR*GQ 430
           TGSSFPAD  KPVPLA+ SLDSR GQ
Sbjct: 28  TGSSFPADYSKPVPLAMGSLDSRQGQ 53


>UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_557_1225 - Giardia lamblia ATCC
           50803
          Length = 222

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 19/35 (54%), Positives = 20/35 (57%)
 Frame = +2

Query: 410 MD*RDSHCPYLLSSETTAKGTGLGESAGKEDPVSL 514
           MD R SHCP     E  A GTG G  AG+EDP  L
Sbjct: 1   MDQRGSHCPEPRLREPPASGTGEGRPAGQEDPFEL 35


>UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|Rep:
           Lipoprotein, putative - Campylobacter lari RM2100
          Length = 97

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 21/40 (52%), Positives = 25/40 (62%)
 Frame = -1

Query: 456 VSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 337
           +SLD    Q  SR +IHA   L D+ F YL+ VIVT AVY
Sbjct: 50  ISLDPSLRQLPSRYAIHAGRYLTDKEFRYLRTVIVTAAVY 89


>UniRef50_Q7QW44 Cluster: GLP_457_25625_26368; n=2; Giardia
           intestinalis|Rep: GLP_457_25625_26368 - Giardia lamblia
           ATCC 50803
          Length = 247

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 27/83 (32%), Positives = 38/83 (45%)
 Frame = -2

Query: 305 FRALGRNHIASTPARAIQCFVLIRQSDSPCPCQF*ADR*TAVVQNRADRARNETDTTLRL 126
           FRA+  + ++    R +   VL+ Q  S       ADR      N      NET   +  
Sbjct: 27  FRAVKTSGLSHVAIRCLDGVVLVSQLQS-------ADRLVDTANNTFIHEINETSACMIC 79

Query: 125 GRSAEGRRTRVRIQSET*DDFRE 57
           GR A+GRR   R++SE  D FR+
Sbjct: 80  GRIADGRRVIDRVRSEAVDFFRK 102


>UniRef50_Q580V9 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 1232

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 27/82 (32%), Positives = 35/82 (42%), Gaps = 2/82 (2%)
 Frame = -1

Query: 705 ATSPLCTLGTKHRAPA-DIIDRAPFPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 529
           +TSP+    TK   P  D +D    PP  V  E     VF     +T     ++S V+ Q
Sbjct: 105 STSPVVVRPTKDLPPTKDAVDAPRMPPTAVKREES---VFHDGDGQTPVTSVHSSVVATQ 161

Query: 528 CQTR-VKLTGSSFPADSPKPVP 466
             +  VKL     PA SP P P
Sbjct: 162 SASEAVKLRPPKIPASSPSPSP 183


>UniRef50_A1HAT0 Cluster: 5-formyltetrahydrofolate cyclo-ligase-like
           precursor; n=5; Burkholderiaceae|Rep:
           5-formyltetrahydrofolate cyclo-ligase-like precursor -
           Ralstonia pickettii 12J
          Length = 257

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 1/59 (1%)
 Frame = +1

Query: 88  IRTRVLRPSADLPSRKVVSVSFRARSARFCTTA-VQRSAQNWHGQGESDCLIKTKHWMA 261
           +RT +L   A LP R     +     A    T  V+R A  W  QGE D L    HW+A
Sbjct: 79  LRTMLLDARAALPDRIAHDAALAHHLAGLLNTLPVKRLAAYWPTQGEFDALTVLDHWLA 137


>UniRef50_Q8WWQ5 Cluster: Mucin 5; n=17; root|Rep: Mucin 5 - Homo
            sapiens (Human)
          Length = 2448

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = -1

Query: 582  RSRETISHLCYTSHVSLQCQTRVKLTGSSFPADSPKP 472
            R+RE  S LCY   + +QC T +  + SS PA +  P
Sbjct: 1457 RNREQASGLCYNYQIRVQCCTPLPCSTSSSPAQTTPP 1493


>UniRef50_Q96V83 Cluster: RecQ family helicase; n=1; Metarhizium
            anisopliae|Rep: RecQ family helicase - Metarhizium
            anisopliae
          Length = 1517

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +3

Query: 183  RRSTVSSELARTRGIRLSN*NKALDG-PRGC*RNVISAQCSECQREEIQ 326
            +R  V+S L RT+G R     + LDG PR C + + +  C  CQR+E++
Sbjct: 1281 KRREVNS-LIRTQGCRRRVLGQCLDGDPRDC-KGISAVLCDNCQRDELK 1327


>UniRef50_Q6CQE6 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=2; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome D of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 144

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 19/35 (54%), Positives = 24/35 (68%), Gaps = 3/35 (8%)
 Frame = -3

Query: 238 LDSRIPLVRASSELTV---ERRSYRIVPIAHETKP 143
           LDS+IPLVR SS+L V   +RRS R +P    T+P
Sbjct: 1   LDSQIPLVRTSSKLIVNCSKRRSTRDLPRPSTTRP 35


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 752,601,848
Number of Sequences: 1657284
Number of extensions: 15626999
Number of successful extensions: 37777
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 36526
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37760
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 58264468239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).