SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0090
         (604 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...    94   3e-18
UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0...    58   2e-07
UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ...    55   1e-06
UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella ve...    51   2e-05
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    48   1e-04
UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontog...    47   4e-04
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    44   0.004
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    42   0.015
UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; ...    40   0.045
UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; ...    38   0.14 
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    38   0.24 
UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia scl...    35   1.7  
UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7; ...    35   1.7  
UniRef50_O77086 Cluster: Guanine nucleotide-releasing factor 2; ...    33   3.9  
UniRef50_Q29IL8 Cluster: GA16131-PA; n=1; Drosophila pseudoobscu...    33   5.2  
UniRef50_A4HHL8 Cluster: Putative uncharacterized protein; n=3; ...    33   6.9  
UniRef50_Q5KKC3 Cluster: Expressed protein; n=2; Filobasidiella ...    33   6.9  
UniRef50_Q0U498 Cluster: Putative uncharacterized protein; n=1; ...    33   6.9  
UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20; ...    33   6.9  
UniRef50_UPI0000EBC3AF Cluster: PREDICTED: hypothetical protein;...    32   9.1  
UniRef50_Q82K49 Cluster: Putative uncharacterized protein; n=2; ...    32   9.1  
UniRef50_Q2LUB9 Cluster: Hypothetical membrane protein; n=1; Syn...    32   9.1  
UniRef50_Q5KHX1 Cluster: Putative uncharacterized protein; n=1; ...    32   9.1  

>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 41/46 (89%), Positives = 42/46 (91%)
 Frame = +3

Query: 369 HQ*GKTNLSHDGLSPAHVPF*WVNNPTLGEFCFAMIGRADIEGSKS 506
           HQ GKTNLSHDGL PAHVP+ WVNNPTLGEFCF MIGRADIEGSKS
Sbjct: 57  HQWGKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKS 102



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 26/34 (76%)
 Frame = +2

Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILKDR 601
           K  VAMNAWLPQASYPCGNFS TS  K   LKDR
Sbjct: 101 KSNVAMNAWLPQASYPCGNFSDTSSFKFRSLKDR 134


>UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep:
           LRRG00134 - Rattus norvegicus (Rat)
          Length = 221

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 24/25 (96%), Positives = 24/25 (96%)
 Frame = +3

Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506
           WVNNPTLGEFCF MIGRADIEGSKS
Sbjct: 25  WVNNPTLGEFCFTMIGRADIEGSKS 49



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/27 (81%), Positives = 22/27 (81%)
 Frame = +2

Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*K 580
           K  VAMNAW PQASYPCGNFS TSC K
Sbjct: 48  KSDVAMNAWPPQASYPCGNFSDTSCLK 74


>UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 116

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 29/57 (50%), Positives = 33/57 (57%)
 Frame = -1

Query: 589 YKEFLARGARKVTTGITGLWQPSVHSDLLFDPSMSALPIIAKQNSPSVGLFTHQKGT 419
           +  F    + K+  G          S LLFDPSMSALPII KQNS  VGLFT Q+GT
Sbjct: 60  FTSFKLEVSEKLPQGQLACGSQEFISTLLFDPSMSALPIIVKQNSQRVGLFTRQQGT 116



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/32 (71%), Positives = 25/32 (78%)
 Frame = -2

Query: 603 YRSFSIKSF*QEVPEKLPQG*LACGSQAFIAT 508
           YRSF+  SF  EV EKLPQG LACGSQ FI+T
Sbjct: 55  YRSFNFTSFKLEVSEKLPQGQLACGSQEFIST 86


>UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 746

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 22/30 (73%), Positives = 26/30 (86%)
 Frame = -1

Query: 355 IVILLSTRGTAVSDIWFMHSAERPVVRSYH 266
           +VILLSTRGTA SD W +H AE+P+VRSYH
Sbjct: 660 VVILLSTRGTADSDNWHLHLAEKPMVRSYH 689


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +2

Query: 515 MNAWLPQASYPCGNFSGTS 571
           MNAWLPQASYPCGNFSGTS
Sbjct: 1   MNAWLPQASYPCGNFSGTS 19


>UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3;
           Euarchontoglires|Rep: 4933429F08Rik protein - Mus
           musculus (Mouse)
          Length = 29

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = +2

Query: 515 MNAWLPQASYPCGNFSGTSC*K 580
           MNAW PQASYPCGNFS TSC K
Sbjct: 1   MNAWPPQASYPCGNFSDTSCLK 22


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 18/24 (75%), Positives = 19/24 (79%)
 Frame = +2

Query: 500 KKQVAMNAWLPQASYPCGNFSGTS 571
           K  VA +AW PQASYPCGNFS TS
Sbjct: 11  KSYVARSAWQPQASYPCGNFSDTS 34


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 16/19 (84%), Positives = 17/19 (89%)
 Frame = +2

Query: 500 KKQVAMNAWLPQASYPCGN 556
           K  VAMNAWLPQASYPCG+
Sbjct: 11  KSNVAMNAWLPQASYPCGS 29


>UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4;
           Bacteria|Rep: Putative uncharacterized protein -
           Magnetospirillum gryphiswaldense
          Length = 76

 Score = 39.9 bits (89), Expect = 0.045
 Identities = 20/34 (58%), Positives = 21/34 (61%)
 Frame = -2

Query: 492 RCRLFLSLRSKIRQALDCSPIKRERELGLDRRET 391
           RCRL  S      Q   CSPIK  RELGL+RRET
Sbjct: 4   RCRLITSWGWSRSQGFGCSPIKVVRELGLERRET 37


>UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4;
           Eukaryota|Rep: Putative uncharacterized protein -
           Plasmodium berghei
          Length = 54

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 16/18 (88%), Positives = 16/18 (88%)
 Frame = -2

Query: 444 DCSPIKRERELGLDRRET 391
           DCSP  RERELGLDRRET
Sbjct: 6   DCSPANRERELGLDRRET 23


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 15/21 (71%), Positives = 16/21 (76%)
 Frame = +2

Query: 494 RIKKQVAMNAWLPQASYPCGN 556
           R K  VA NAW PQASYPCG+
Sbjct: 9   RSKSYVAKNAWQPQASYPCGS 29


>UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia
           sclerotiorum 1980|Rep: Predicted protein - Sclerotinia
           sclerotiorum 1980
          Length = 147

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 15/23 (65%), Positives = 18/23 (78%)
 Frame = +3

Query: 435 VNNPTLGEFCFAMIGRADIEGSK 503
           VN+P L EFCF +  RADIEGS+
Sbjct: 120 VNSPMLTEFCFGIRERADIEGSE 142


>UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7;
           Archaea|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-062
          Length = 272

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 19/39 (48%), Positives = 21/39 (53%)
 Frame = -3

Query: 491 DVGSSYHCEAKFAKRWIVHPSKGNVSWA*TVVRQVSFTL 375
           DV SS+   A  AK  +  P KGNV W  TV RQV   L
Sbjct: 228 DVVSSHPGGAAAAKGGVARPLKGNVRWVQTVARQVGLYL 266


>UniRef50_O77086 Cluster: Guanine nucleotide-releasing factor 2;
           n=7; melanogaster subgroup|Rep: Guanine
           nucleotide-releasing factor 2 - Drosophila melanogaster
           (Fruit fly)
          Length = 1571

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 3/65 (4%)
 Frame = -2

Query: 273 ATIRGISLNAS---KAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPF 103
           A    ISLN+     +  SL   G D L+V  R    + QC F S ++HS+ E  ++   
Sbjct: 584 AQSHNISLNSDLDCSSNISLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQH 643

Query: 102 GSRRS 88
              RS
Sbjct: 644 QHLRS 648


>UniRef50_Q29IL8 Cluster: GA16131-PA; n=1; Drosophila
           pseudoobscura|Rep: GA16131-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 1196

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 3/53 (5%)
 Frame = -2

Query: 273 ATIRGISLNAS---KAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRE 124
           A    ISLN+     +  SL   G D L+V  R    + QC F S ++HS+ E
Sbjct: 395 AQSHNISLNSDLDCSSNISLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREE 447


>UniRef50_A4HHL8 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania braziliensis
          Length = 489

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 17/60 (28%), Positives = 30/60 (50%)
 Frame = -2

Query: 342 SVREEPQFRTFGSCTRPSGRWCEATIRGISLNASKAEASLAESGKDMLTVEPRESGGSKQ 163
           SV +E +  + G C  PS RW  A++R +    S    +  E+  D   ++  ++GGS +
Sbjct: 105 SVDKESEGESEGLCPSPSARWKRASLRAMRGRDSVPRLAATEARDDADEMDDIDNGGSDE 164


>UniRef50_Q5KKC3 Cluster: Expressed protein; n=2; Filobasidiella
           neoformans|Rep: Expressed protein - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 778

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 18/49 (36%), Positives = 24/49 (48%)
 Frame = -3

Query: 356 DSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLA*TPLRPKPA*PNPA 210
           D     ++  RS G LV  LGR  G  KLP   +  +P RP+   P P+
Sbjct: 147 DQGDGGFDPERSLGRLVGELGRIIGDEKLPK--IPNSPFRPRSRSPLPS 193


>UniRef50_Q0U498 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 338

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 27/104 (25%), Positives = 42/104 (40%)
 Frame = +2

Query: 26  TELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSI 205
           T ++P+  S DA        I  + P    +RV      T++     L  P+ RG  V  
Sbjct: 225 TPIFPERESLDADTLALMRQIHPKPPFQYYQRVETRLSSTKI--DAALRDPEPRGGMVD- 281

Query: 206 SLPDSARLASALEAFRLIPRMVASHHRPLGRVHEPNVRNCGSSR 337
             P+SA   + L       +      RP+GR ++P V+  G  R
Sbjct: 282 --PESAEKVTKLAMPESSEKKPRGRGRPIGRKNKPKVKPRGRGR 323


>UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20;
           n=1; Yarrowia lipolytica|Rep: Serine/threonine-protein
           kinase STE20 - Yarrowia lipolytica (Candida lipolytica)
          Length = 1125

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 22/69 (31%), Positives = 30/69 (43%)
 Frame = -3

Query: 302 ALGRAAGGAKLPSAGLA*TPLRPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR 123
           A G +  GA  PSA     P RP PA   P  + S+ +P S      +T L AF  +  +
Sbjct: 639 ASGDSGAGAAPPSAAPKSPPPRPPPA--PPLGVPSVHAPNSEYRQKMITQLEAFNAKRQQ 696

Query: 122 RDVEAHLDR 96
              E H  +
Sbjct: 697 ERAERHAQK 705


>UniRef50_UPI0000EBC3AF Cluster: PREDICTED: hypothetical protein;
           n=1; Bos taurus|Rep: PREDICTED: hypothetical protein -
           Bos taurus
          Length = 285

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -3

Query: 284 GGAKLPSAGLA*TPLRPKPA*PNP 213
           GG   P  GLA TPL+PKP  P+P
Sbjct: 4   GGKPAPPLGLAPTPLQPKPRKPDP 27


>UniRef50_Q82K49 Cluster: Putative uncharacterized protein; n=2;
           Streptomyces|Rep: Putative uncharacterized protein -
           Streptomyces avermitilis
          Length = 232

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 23/79 (29%), Positives = 33/79 (41%)
 Frame = +2

Query: 38  PDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPD 217
           P +R+  +R      ++  R P G RRR          +   C E PDS  +  S S  D
Sbjct: 32  PSVRTSPSRTSAVPFTLPPRIPPGPRRRSLLASAAGAALLVGCSESPDSANTAGSPSAAD 91

Query: 218 SARLASALEAFRLIPRMVA 274
            AR  +A ++  L  R  A
Sbjct: 92  RARARAARDSAALATRYAA 110


>UniRef50_Q2LUB9 Cluster: Hypothetical membrane protein; n=1;
           Syntrophus aciditrophicus SB|Rep: Hypothetical membrane
           protein - Syntrophus aciditrophicus (strain SB)
          Length = 90

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 2/35 (5%)
 Frame = +2

Query: 101 PNGLRRRVSRFECETRLVKS--HCLEPPDSRGSTV 199
           P+ ++R V  + CE+R+ +S  HCL  P SRG+ +
Sbjct: 31  PSYIKRGVPAYRCESRVGQSNFHCLNIPSSRGTEI 65


>UniRef50_Q5KHX1 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 628

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
 Frame = -3

Query: 356 DSNTAQYERNRSFGHLVHALGRAAGGAKLPS-AGLA*TPLR-PKPA*PNP 213
           ++  A ++  RS G LV  LGR  G  KLPS      +P R P P   NP
Sbjct: 48  EAGDADFDPERSLGRLVDELGRVMGSDKLPSRPSSPFSPTRTPTPLGSNP 97


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 602,017,680
Number of Sequences: 1657284
Number of extensions: 11981154
Number of successful extensions: 32338
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 31414
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32326
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 42732687689
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).