SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0088
         (672 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...   125   9e-28
UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0...    85   1e-15
UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ...    76   7e-13
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    59   1e-07
UniRef50_A4DID9 Cluster: Putative uncharacterized protein; n=10;...    50   7e-05
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    50   7e-05
UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;...    48   3e-04
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    48   3e-04
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    45   0.002
UniRef50_Q9PLI5 Cluster: Uncharacterized protein TC_0114; n=47; ...    44   0.003
UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1; ...    41   0.024
UniRef50_Q1NYX4 Cluster: Cell wall-associated hydrolase; n=3; Ba...    40   0.055
UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; ...    38   0.17 
UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7; ...    38   0.17 
UniRef50_A7CI87 Cluster: Putative uncharacterized protein; n=21;...    37   0.39 
UniRef50_Q0V1C4 Cluster: Putative uncharacterized protein; n=1; ...    36   0.67 
UniRef50_UPI0000F2CB68 Cluster: PREDICTED: hypothetical protein;...    35   2.1  
UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia scl...    35   2.1  
UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; ...    34   3.6  
UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella ve...    34   3.6  
UniRef50_Q8S7E9 Cluster: Putative uncharacterized protein OSJNBa...    33   8.3  
UniRef50_Q29IL8 Cluster: GA16131-PA; n=1; Drosophila pseudoobscu...    33   8.3  
UniRef50_Q5KAL1 Cluster: Putative uncharacterized protein; n=2; ...    33   8.3  

>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score =  125 bits (302), Expect = 9e-28
 Identities = 56/64 (87%), Positives = 57/64 (89%)
 Frame = +3

Query: 330 HQ*GKTNLSHDGLNPAHVPF*WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYP 509
           HQ GKTNLSHDGL PAHVP+ WVNNPTLGEFCF MIGRADIEGSKSNVAMNAWLPQASYP
Sbjct: 57  HQWGKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKSNVAMNAWLPQASYP 116

Query: 510 VVTF 521
              F
Sbjct: 117 CGNF 120



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 31/50 (62%), Positives = 33/50 (66%)
 Frame = +2

Query: 509 CGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIKPAFALLLHARFLSSLS 658
           CGNFS TS  K   LKDR A LS+ + VL I IK AF LL H RFL SLS
Sbjct: 117 CGNFSDTSSFKFRSLKDRLATLSRFVFVLEIRIKRAFTLLFHTRFLFSLS 166



 Score = 36.3 bits (80), Expect = 0.67
 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 5/49 (10%)
 Frame = +2

Query: 182 ARLASA----LEAFRHNPADGSFAPPAARRVHEPN-VRNCGSSRTEQYY 313
           AR+AS+    LEAF HNP  GSFAP A     +P+ + NC + R   YY
Sbjct: 4   ARIASSPDSDLEAFSHNPTHGSFAPLA----FQPSAMTNCANQRFLSYY 48


>UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep:
           LRRG00134 - Rattus norvegicus (Rat)
          Length = 221

 Score = 85.0 bits (201), Expect = 1e-15
 Identities = 37/43 (86%), Positives = 38/43 (88%)
 Frame = +3

Query: 393 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPVVTF 521
           WVNNPTLGEFCF MIGRADIEGSKS+VAMNAW PQASYP   F
Sbjct: 25  WVNNPTLGEFCFTMIGRADIEGSKSDVAMNAWPPQASYPCGNF 67


>UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 116

 Score = 76.2 bits (179), Expect = 7e-13
 Identities = 37/57 (64%), Positives = 42/57 (73%)
 Frame = -3

Query: 550 YKEFLARGARKVTTG*LACGSQAFIATLLFDPSMSALPIIAKQNSPSVGLFTHQKGT 380
           +  F    + K+  G LACGSQ FI+TLLFDPSMSALPII KQNS  VGLFT Q+GT
Sbjct: 60  FTSFKLEVSEKLPQGQLACGSQEFISTLLFDPSMSALPIIVKQNSQRVGLFTRQQGT 116



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 30/51 (58%), Positives = 36/51 (70%)
 Frame = -1

Query: 660 QLSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIKSF*QEVPEKLPQ 508
           QLSE+ NL  +KR KA LI +FS + + ES AYRSF+  SF  EV EKLPQ
Sbjct: 23  QLSENGNLTQNKRVKATLILIFSRNTNRESVAYRSFNFTSFKLEVSEKLPQ 73


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 26/26 (100%), Positives = 26/26 (100%)
 Frame = +3

Query: 432 MIGRADIEGSKSNVAMNAWLPQASYP 509
           MIGRADIEGSKSNVAMNAWLPQASYP
Sbjct: 1   MIGRADIEGSKSNVAMNAWLPQASYP 26



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/42 (59%), Positives = 29/42 (69%)
 Frame = +1

Query: 547 YTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLTELALGH 672
           Y  GSIG AF V +RTE+ +Q SF PF   E+SVL EL LGH
Sbjct: 25  YPCGSIGHAFTVCIRTENQNQMSFYPFVLHEISVLVELILGH 66


>UniRef50_A4DID9 Cluster: Putative uncharacterized protein; n=10;
           Firmicutes|Rep: Putative uncharacterized protein -
           Listeria monocytogenes FSL N3-165
          Length = 112

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 39/98 (39%), Positives = 48/98 (48%), Gaps = 2/98 (2%)
 Frame = -2

Query: 638 SRGAKGQKLA*SRCSVRIGTAKARPIDPLV*--RVFSKRCQKSYHRITGLWQPSVHSDVA 465
           S+  K Q    +R + R GT K    DP+V   R  ++R  K+   ITGL  P VH D  
Sbjct: 6   SQSVKAQGSLTARLTSRAGT-KVGLSDPVVPHGRAIAQRI-KATPGITGLSPPRVHIDGE 63

Query: 464 F*SFDVGSSYHCEAKFAKRWIVHPSKGNVSWV*TVVRQ 351
               DVGSS+       K W V P K + SWV  VVRQ
Sbjct: 64  VWHLDVGSSHPGAVVGPKGWAVRPLKRHASWVQNVVRQ 101


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 23/30 (76%), Positives = 24/30 (80%)
 Frame = +3

Query: 432 MIGRADIEGSKSNVAMNAWLPQASYPVVTF 521
           MIGRADIEGSKS VA +AW PQASYP   F
Sbjct: 1   MIGRADIEGSKSYVARSAWQPQASYPCGNF 30



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/40 (52%), Positives = 27/40 (67%)
 Frame = +1

Query: 553 KGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLTELALGH 672
           KGSIG AF     +E  +Q SF PF+ +E+SVL+EL  GH
Sbjct: 49  KGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLSELVFGH 88


>UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 440

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/23 (95%), Positives = 23/23 (100%)
 Frame = +2

Query: 440 KSRHRRIKKQRRYERLAATSQLS 508
           KSRHRRIKK+RRYERLAATSQLS
Sbjct: 50  KSRHRRIKKRRRYERLAATSQLS 72


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/26 (84%), Positives = 22/26 (84%)
 Frame = +3

Query: 432 MIGRADIEGSKSNVAMNAWLPQASYP 509
           MIGRADIE SKS VA NAW PQASYP
Sbjct: 1   MIGRADIERSKSYVAKNAWQPQASYP 26



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/42 (50%), Positives = 26/42 (61%)
 Frame = +1

Query: 547 YTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLTELALGH 672
           Y  GSIG AF     +E  +Q SF PF+ +E+SVL EL  GH
Sbjct: 25  YPCGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLFELVFGH 66


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/46 (50%), Positives = 28/46 (60%)
 Frame = +1

Query: 535 LKTLYTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLTELALGH 672
           LK   +KGSIG  F V + TE+ +Q  F PF   E+SVL E  LGH
Sbjct: 21  LKCRGSKGSIGHTFMVCIHTENQNQGDFYPFVLLEISVLHESPLGH 66


>UniRef50_Q9PLI5 Cluster: Uncharacterized protein TC_0114; n=47;
           cellular organisms|Rep: Uncharacterized protein TC_0114
           - Chlamydia muridarum
          Length = 122

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 22/40 (55%), Positives = 24/40 (60%)
 Frame = +2

Query: 389 LMGEQSNAWRILLRNDRKSRHRRIKKQRRYERLAATSQLS 508
           L+GEQ N W +L   D  SRHR  K  RRYE L A S LS
Sbjct: 64  LIGEQPNPWDLLQPQDAMSRHRGAKPPRRYELLVAISLLS 103


>UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 108

 Score = 41.1 bits (92), Expect = 0.024
 Identities = 21/40 (52%), Positives = 26/40 (65%)
 Frame = +1

Query: 553 KGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLTELALGH 672
           KGSIG AF V +RT + +Q SF  F   E+ VL +L LGH
Sbjct: 25  KGSIGYAFNVRIRTGNQNQTSFYHFVLHEIFVLVKLILGH 64


>UniRef50_Q1NYX4 Cluster: Cell wall-associated hydrolase; n=3;
           Bacteria|Rep: Cell wall-associated hydrolase -
           Candidatus Sulcia muelleri str. Hc (Homalodisca
           coagulata)
          Length = 132

 Score = 39.9 bits (89), Expect = 0.055
 Identities = 21/40 (52%), Positives = 23/40 (57%)
 Frame = +2

Query: 389 LMGEQSNAWRILLRNDRKSRHRRIKKQRRYERLAATSQLS 508
           LMGEQ N W +L   D  SRHR  +  RR E L  TS LS
Sbjct: 64  LMGEQPNPWDLLQPQDVTSRHRGAEPPRRCELLGETSLLS 103


>UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4;
           Eukaryota|Rep: Putative uncharacterized protein -
           Plasmodium berghei
          Length = 54

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 16/18 (88%), Positives = 16/18 (88%)
 Frame = -1

Query: 405 DCSPIKRERELGLDRRET 352
           DCSP  RERELGLDRRET
Sbjct: 6   DCSPANRERELGLDRRET 23


>UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7;
           Archaea|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-062
          Length = 272

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 26/57 (45%), Positives = 29/57 (50%)
 Frame = -2

Query: 506 ITGLWQPSVHSDVAF*SFDVGSSYHCEAKFAKRWIVHPSKGNVSWV*TVVRQVSFTL 336
           ITG  +  V  D A    DV SS+   A  AK  +  P KGNV WV TV RQV   L
Sbjct: 210 ITGSSRVRVPIDPAVWYPDVVSSHPGGAAAAKGGVARPLKGNVRWVQTVARQVGLYL 266


>UniRef50_A7CI87 Cluster: Putative uncharacterized protein; n=21;
           Bacteria|Rep: Putative uncharacterized protein -
           Ralstonia pickettii 12D
          Length = 226

 Score = 37.1 bits (82), Expect = 0.39
 Identities = 20/40 (50%), Positives = 21/40 (52%)
 Frame = +2

Query: 389 LMGEQSNAWRILLRNDRKSRHRRIKKQRRYERLAATSQLS 508
           L GEQ   W  L   D  SRHR  K +RRYE L   S LS
Sbjct: 64  LNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLS 103


>UniRef50_Q0V1C4 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 571

 Score = 36.3 bits (80), Expect = 0.67
 Identities = 21/60 (35%), Positives = 28/60 (46%)
 Frame = +2

Query: 122 HCLEPPDSRGSTVSISLPDSARLASALEAFRHNPADGSFAPPAARRVHEPNVRNCGSSRT 301
           H L PP            D A   S+LE  R N + GS+ P + ++ H  NV   GSSR+
Sbjct: 115 HSLAPPPHLPFPAYAKRGDHAGGVSSLEYSRPNSSQGSYPPESWKKEHRNNVATPGSSRS 174


>UniRef50_UPI0000F2CB68 Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 623

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
 Frame = -2

Query: 527 CQKSYHRITGLWQP-SVHS-DVAF*SFDVGSSYHCEAKFAKRWIVH 396
           C KS+H+IT LWQP ++H+ +  +   D G ++       + W +H
Sbjct: 345 CGKSFHQITQLWQPQNIHTGERPYVCKDCGKAFRHRPALTQHWKIH 390


>UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia
           sclerotiorum 1980|Rep: Predicted protein - Sclerotinia
           sclerotiorum 1980
          Length = 147

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 15/23 (65%), Positives = 18/23 (78%)
 Frame = +3

Query: 396 VNNPTLGEFCFAMIGRADIEGSK 464
           VN+P L EFCF +  RADIEGS+
Sbjct: 120 VNSPMLTEFCFGIRERADIEGSE 142


>UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4;
           Bacteria|Rep: Putative uncharacterized protein -
           Magnetospirillum gryphiswaldense
          Length = 76

 Score = 33.9 bits (74), Expect = 3.6
 Identities = 15/21 (71%), Positives = 16/21 (76%)
 Frame = -1

Query: 414 QALDCSPIKRERELGLDRRET 352
           Q   CSPIK  RELGL+RRET
Sbjct: 17  QGFGCSPIKVVRELGLERRET 37


>UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 746

 Score = 33.9 bits (74), Expect = 3.6
 Identities = 15/21 (71%), Positives = 17/21 (80%)
 Frame = -3

Query: 316 IVILLSTRGTAVSDIWFMHSA 254
           +VILLSTRGTA SD W +H A
Sbjct: 660 VVILLSTRGTADSDNWHLHLA 680


>UniRef50_Q8S7E9 Cluster: Putative uncharacterized protein
           OSJNBa0057L21.8; n=1; Oryza sativa|Rep: Putative
           uncharacterized protein OSJNBa0057L21.8 - Oryza sativa
           (Rice)
          Length = 191

 Score = 32.7 bits (71), Expect = 8.3
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = +2

Query: 197 ALEAFRHNPADGSFAPPAARRVHEPNVRNCGSS 295
           A +A RH  A G   PP+ARRV  P  R+  S+
Sbjct: 13  AEDARRHGLAGGDIGPPSARRVEPPQSRDASST 45


>UniRef50_Q29IL8 Cluster: GA16131-PA; n=1; Drosophila
           pseudoobscura|Rep: GA16131-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 1196

 Score = 32.7 bits (71), Expect = 8.3
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 8/80 (10%)
 Frame = -1

Query: 297 REEPQFRTFGSCTRRAAGGAKLP-----SAGLCLNAS---KAEASLAESGKDMLTVEPRE 142
           R +PQ    GS +  +      P     S  + LN+     +  SL   G D L+V  R 
Sbjct: 369 RSQPQAPPGGSSSSTSTSNQASPLPYAQSHNISLNSDLDCSSNISLLNYGVDRLSVRSRS 428

Query: 141 SGGSKQCDFTSRVSHSKREK 82
              + QC F S ++HS+ E+
Sbjct: 429 PDENSQCSFDSALNHSREEE 448


>UniRef50_Q5KAL1 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 445

 Score = 32.7 bits (71), Expect = 8.3
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = +2

Query: 101 ETRLVKSHCLEPPDSRGSTVSISLPDSARLASALEAFRHNPADGSFAPPAARRV 262
           ++R  ++    PP SRG+T   S P    L    +   HN A   FAPPA R V
Sbjct: 75  DSRRARTRTPPPPSSRGATAQ-SPPRKPPLPLPRKHVAHNAAVEDFAPPAWRTV 127


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 687,986,572
Number of Sequences: 1657284
Number of extensions: 14001754
Number of successful extensions: 37826
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 36524
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37812
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 51652897375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).