SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0086
         (739 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa...    87   3e-16
UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo...    87   4e-16
UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ...    84   3e-15
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    84   4e-15
UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...    73   1e-11
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    69   1e-10
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    56   9e-07
UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;...    55   2e-06
UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1; ...    50   8e-05
UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3; ...    45   0.002
UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1; ...    44   0.005
UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221...    43   0.007
UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|R...    38   0.34 
UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1; ...    38   0.34 
UniRef50_Q580V9 Cluster: Putative uncharacterized protein; n=1; ...    35   1.8  
UniRef50_Q5BBP8 Cluster: Putative uncharacterized protein; n=1; ...    35   1.8  
UniRef50_Q7QW44 Cluster: GLP_457_25625_26368; n=2; Giardia intes...    35   2.4  
UniRef50_Q7QQ50 Cluster: GLP_139_12114_8350; n=1; Giardia lambli...    33   5.5  
UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia ...    33   9.7  
UniRef50_Q6CQE6 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    33   9.7  

>UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa
           group|Rep: Zgc:165536 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 55

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 36/41 (87%), Positives = 39/41 (95%)
 Frame = +2

Query: 389 MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKR 511
           MPRHLISDAHEW+NEIPTVP  YLAKPQPRERAW+NQRGK+
Sbjct: 1   MPRHLISDAHEWMNEIPTVPTCYLAKPQPRERAWQNQRGKK 41



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 15/17 (88%), Positives = 17/17 (100%)
 Frame = +1

Query: 502 GKETLLSLTLVWHCKET 552
           GK+TLLSLTLVWHC+ET
Sbjct: 39  GKKTLLSLTLVWHCEET 55


>UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10;
           Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana
           tabacum (Common tobacco)
          Length = 530

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 67/144 (46%), Positives = 79/144 (54%), Gaps = 2/144 (1%)
 Frame = -3

Query: 653 APLPPNRVSNETMKVVVFQ-RRSRETISHLCYTSH-VSLQCQTRVKLNRVSFPADSPKPV 480
           APLP + +S  T+KVVVF  R S  T +    + H V L+  +       SFPADS KPV
Sbjct: 31  APLPIHGISKITLKVVVFHFRLSAPTYTTPLKSFHKVGLESSSTGS----SFPADSAKPV 86

Query: 479 PLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQ 300
           PL VVSLDSR     S  SIHA           L+    +P VYPRL+EFLH DIQSTG+
Sbjct: 87  PLVVVSLDSRQDSGISL-SIHAVTNKMTRHLATLRESCYSP-VYPRLVEFLHFDIQSTGR 144

Query: 299 KSHCVNTREGHRNALFN*TVGFPL 228
            +   N R  HRNALF      PL
Sbjct: 145 IT-LRNIRRDHRNALFKLNSRIPL 167



 Score = 33.5 bits (73), Expect = 5.5
 Identities = 19/34 (55%), Positives = 20/34 (58%)
 Frame = -2

Query: 297 ITLRQHPRGPSQCFV*LDSRIPLVRASSELTVER 196
           ITLR   R        L+SRIPLVR SSEL V R
Sbjct: 145 ITLRNIRRDHRNALFKLNSRIPLVRTSSELAVRR 178


>UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC
           50803
          Length = 329

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 48/86 (55%), Positives = 53/86 (61%)
 Frame = -3

Query: 509 SFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVYPRLLEF 330
           S PA  P PVP A  S     GQW+ R SIHAR  L DEAFGYLKRVIVTPAVY      
Sbjct: 186 SCPAGRPSPVPEAGGSRRRGSGQWDPRWSIHARRKLPDEAFGYLKRVIVTPAVYQGFGGS 245

Query: 329 LHVDIQSTGQKSHCVNTREGHRNALF 252
           LH D + TGQKS   +   G R+A+F
Sbjct: 246 LHSDGRGTGQKSRRASAGCGPRDAVF 271


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 37/40 (92%), Positives = 39/40 (97%)
 Frame = -3

Query: 401 DDEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVN 282
           +DEAFGYLKRVIVTPAVYPRL+EFLH DIQSTGQKSHCVN
Sbjct: 113 NDEAFGYLKRVIVTPAVYPRLVEFLHFDIQSTGQKSHCVN 152


>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 36/49 (73%), Positives = 38/49 (77%)
 Frame = -3

Query: 575 SHLCYTSHVSLQCQTRVKLNRVSFPADSPKPVPLAVVSLDSR*GQWESR 429
           SHL YTS V  Q +TRVKLNRV FPADS K VPL +VSLDSR GQWE R
Sbjct: 234 SHLSYTSQVISQSRTRVKLNRVFFPADSAKAVPLLLVSLDSRKGQWEFR 282


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 32/43 (74%), Positives = 33/43 (76%)
 Frame = -3

Query: 398 DEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREG 270
           DE FGYLKRVIVTPAVY   +EF  VDI  TGQKSHCVNT  G
Sbjct: 144 DETFGYLKRVIVTPAVYLCFIEFHQVDIHGTGQKSHCVNTISG 186



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 31/82 (37%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = -1

Query: 457 IVDRDSGNLVNPFMRVTN*MTRHLATLRES*LLPPFTRACLNFFTLTFRALG-RNHIAST 281
           I  RDS NLVNPFM VTN        L+   + P      + F  +     G ++H  +T
Sbjct: 125 IASRDSENLVNPFMHVTN-YDETFGYLKRVIVTPAVYLCFIEFHQVDIHGTGQKSHCVNT 183

Query: 280 PARAIAMLCLIRQSDSPCPCQF 215
            +       LI+QSDSPCP QF
Sbjct: 184 ISGFSQCYVLIKQSDSPCPFQF 205


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 29/49 (59%), Positives = 34/49 (69%)
 Frame = -3

Query: 644 PPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVSFPA 498
           P + +S ETM+VVVF RR     SHL YT HVS QCQTRVKLN  ++ A
Sbjct: 97  PLHWISKETMEVVVFHRRRS---SHLFYTLHVSSQCQTRVKLNHAAYTA 142


>UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 70

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 30/58 (51%), Positives = 31/58 (53%)
 Frame = -1

Query: 577 SPTYATPLMSPYNARXXXXXXXXXXXXXXXXXXXXLWFR*IVDRDSGNLVNPFMRVTN 404
           SPTYATPLMSPYNAR                          + RDSGNLVNPFMRVTN
Sbjct: 13  SPTYATPLMSPYNARLESSSTGSSFPANFSKPVPLAVVSLDMGRDSGNLVNPFMRVTN 70


>UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 421

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 30/71 (42%), Positives = 40/71 (56%)
 Frame = +2

Query: 257 KHCDGPRGC*RNVISAQCSECQREEIQASAGKRRE*L*LS*GSQMPRHLISDAHEWINEI 436
           K+C+GP GC RNVIS+Q    +  +++ S                  HLISDAHEWIN+ 
Sbjct: 372 KNCNGPCGCSRNVISSQ----RNVKVKKS-----------------NHLISDAHEWINKN 410

Query: 437 PTVPIYYLAKP 469
           PT+ +YY  KP
Sbjct: 411 PTILVYYPTKP 421


>UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3;
           Thermoproteaceae|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-061
          Length = 234

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/35 (48%), Positives = 24/35 (68%)
 Frame = +2

Query: 407 SDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKR 511
           S  HEWINE+PTVP    A P P  ++W+ +RG++
Sbjct: 177 SGVHEWINEVPTVPARGPANPPPGAQSWDPRRGEK 211


>UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1;
           Crassostrea gigas|Rep: Tyrosine-protein kinase receptor
           - Crassostrea gigas (Pacific oyster) (Crassostrea
           angulata)
          Length = 804

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/25 (80%), Positives = 21/25 (84%)
 Frame = +2

Query: 287 RNVISAQCSECQREEIQASAGKRRE 361
           RNVISAQCSECQ EEIQ+S GK  E
Sbjct: 1   RNVISAQCSECQSEEIQSSEGKGGE 25


>UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221;
           n=2; Pyrococcus|Rep: Putative uncharacterized protein
           PH0221 - Pyrococcus horikoshii
          Length = 235

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 27/54 (50%), Positives = 29/54 (53%)
 Frame = -3

Query: 509 SFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 348
           S P   P     A VS     GQ   R +IHA   L D+ F YLKRVIVTPAVY
Sbjct: 4   SLPTGGPWHARQAEVSPGPGRGQRGPRYAIHAGRHLTDKEFRYLKRVIVTPAVY 57


>UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|Rep:
           Lipoprotein, putative - Campylobacter lari RM2100
          Length = 97

 Score = 37.5 bits (83), Expect = 0.34
 Identities = 21/40 (52%), Positives = 25/40 (62%)
 Frame = -3

Query: 467 VSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 348
           +SLD    Q  SR +IHA   L D+ F YL+ VIVT AVY
Sbjct: 50  ISLDPSLRQLPSRYAIHAGRYLTDKEFRYLRTVIVTAAVY 89


>UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 70

 Score = 37.5 bits (83), Expect = 0.34
 Identities = 18/23 (78%), Positives = 19/23 (82%)
 Frame = -3

Query: 509 SFPADSPKPVPLAVVSLDSR*GQ 441
           SFPAD  KPVPLA+ SLDSR GQ
Sbjct: 31  SFPADYSKPVPLAMGSLDSRQGQ 53


>UniRef50_Q580V9 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 1232

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 27/82 (32%), Positives = 36/82 (43%), Gaps = 2/82 (2%)
 Frame = -3

Query: 716 ATSPLCTLGTKHRAPA-DIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 540
           +TSP+    TK   P  D +D   +PP  V  E     VF     +T     ++S V+ Q
Sbjct: 105 STSPVVVRPTKDLPPTKDAVDAPRMPPTAVKREES---VFHDGDGQTPVTSVHSSVVATQ 161

Query: 539 CQTR-VKLNRVSFPADSPKPVP 477
             +  VKL     PA SP P P
Sbjct: 162 SASEAVKLRPPKIPASSPSPSP 183


>UniRef50_Q5BBP8 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 2221

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 26/81 (32%), Positives = 39/81 (48%)
 Frame = -3

Query: 716 ATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQC 537
           A   LC    + R P  +  R  LP N+VS +   +V    RS   ++ L +TS  S+  
Sbjct: 280 AVVELCQSMPELRYP--VAARLALPINQVSGQETDLVGMVLRSM-LVNQLNWTSTTSMLT 336

Query: 536 QTRVKLNRVSFPADSPKPVPL 474
             + +L+RV F  D P P P+
Sbjct: 337 LNKEELSRVEFGLDRPLPPPV 357


>UniRef50_Q7QW44 Cluster: GLP_457_25625_26368; n=2; Giardia
           intestinalis|Rep: GLP_457_25625_26368 - Giardia lamblia
           ATCC 50803
          Length = 247

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 26/83 (31%), Positives = 38/83 (45%)
 Frame = -1

Query: 316 FRALGRNHIASTPARAIAMLCLIRQSDSPCPCQF*ADR*TAVVQNRADRARNETDTTLRL 137
           FRA+  + ++    R +  + L+ Q  S       ADR      N      NET   +  
Sbjct: 27  FRAVKTSGLSHVAIRCLDGVVLVSQLQS-------ADRLVDTANNTFIHEINETSACMIC 79

Query: 136 GRSAEGRRTRVRIQSET*DDFRE 68
           GR A+GRR   R++SE  D FR+
Sbjct: 80  GRIADGRRVIDRVRSEAVDFFRK 102


>UniRef50_Q7QQ50 Cluster: GLP_139_12114_8350; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_139_12114_8350 - Giardia lamblia
           ATCC 50803
          Length = 1254

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 25/62 (40%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = -3

Query: 731 ATSVPATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETI-SHLC-YT 558
           +TS+P   P   LGT   APAD + R  LP  R++ ET K +     S     SHL  YT
Sbjct: 278 STSLPMVYP--PLGTIMAAPADFLCRPRLPGRRITRETTKRIPPNEVSSYIYDSHLLDYT 335

Query: 557 SH 552
            H
Sbjct: 336 RH 337


>UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_557_1225 - Giardia lamblia ATCC
           50803
          Length = 222

 Score = 32.7 bits (71), Expect = 9.7
 Identities = 16/30 (53%), Positives = 17/30 (56%)
 Frame = +1

Query: 421 MD*RDSHCPYLLSSETTAKGTGLGESAGKE 510
           MD R SHCP     E  A GTG G  AG+E
Sbjct: 1   MDQRGSHCPEPRLREPPASGTGEGRPAGQE 30


>UniRef50_Q6CQE6 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=2; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome D of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 144

 Score = 32.7 bits (71), Expect = 9.7
 Identities = 19/35 (54%), Positives = 24/35 (68%), Gaps = 3/35 (8%)
 Frame = -2

Query: 249 LDSRIPLVRASSELTV---ERRSYRIVPIAHETKP 154
           LDS+IPLVR SS+L V   +RRS R +P    T+P
Sbjct: 1   LDSQIPLVRTSSKLIVNCSKRRSTRDLPRPSTTRP 35


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 745,084,181
Number of Sequences: 1657284
Number of extensions: 15374434
Number of successful extensions: 37589
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 36327
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37574
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 60088620670
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).