SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0085
         (691 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513...    44   0.004
UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: ...    40   0.057
UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n...    39   0.10 
UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein;...    37   0.40 
UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lu...    36   1.2  
UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ...    36   1.2  
UniRef50_A5LFU4 Cluster: Putative uncharacterized protein; n=2; ...    34   2.9  
UniRef50_Q0CLG0 Cluster: Putative uncharacterized protein; n=2; ...    33   6.6  
UniRef50_A7RZL6 Cluster: Predicted protein; n=1; Nematostella ve...    33   8.7  

>UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130;
           n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY05130 - Plasmodium yoelii yoelii
          Length = 402

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 18/26 (69%), Positives = 22/26 (84%)
 Frame = +3

Query: 84  GKCFR*CSSCDDPRISPLTSQYECPQ 161
           GKCFR C S ++ RISPLTS+Y+CPQ
Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQ 284



 Score = 37.9 bits (84), Expect = 0.23
 Identities = 21/45 (46%), Positives = 25/45 (55%)
 Frame = +1

Query: 466 LTATILVYAIGAGITRLLAPDLPSNCSSLKYLKCTHSDYEARKSP 600
           LTATIL+YAIGAGIT      L       K L   HS+Y+ +  P
Sbjct: 314 LTATILIYAIGAGITAAAGTRLALQLIFGKVLSSHHSNYKTKIWP 358


>UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep:
          Predicted protein - Nematostella vectensis
          Length = 79

 Score = 39.9 bits (89), Expect = 0.057
 Identities = 18/23 (78%), Positives = 18/23 (78%)
 Frame = -2

Query: 75 FHQSRTKVRGSKAIRYRPSSNRK 7
          F   RTKVRGSK IRYRPSSN K
Sbjct: 6  FRCQRTKVRGSKTIRYRPSSNHK 28


>UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1;
           Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry -
           Gallus gallus
          Length = 103

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 26/46 (56%), Positives = 31/46 (67%)
 Frame = +3

Query: 510 AAAGTRLALQLFLVKIFKVYSFRLRGS*ESRIVIFRHYLPVPGVGN 647
           AAAGTRLALQ  LVK FKV SF+L+G  E  +  +   LP P VG+
Sbjct: 59  AAAGTRLALQWILVKGFKVDSFQLQGL-ERVLYCYFSSLP-PRVGS 102



 Score = 33.1 bits (72), Expect = 6.6
 Identities = 15/19 (78%), Positives = 15/19 (78%)
 Frame = +2

Query: 587 LVRVPYRYFSSLPPRAGSG 643
           L RV Y YFSSLPPR GSG
Sbjct: 85  LERVLYCYFSSLPPRVGSG 103


>UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 493

 Score = 37.1 bits (82), Expect = 0.40
 Identities = 16/18 (88%), Positives = 16/18 (88%)
 Frame = +1

Query: 589 RKSPVSLFFVTTSPCREW 642
           RKSPV LFFVTTSP REW
Sbjct: 25  RKSPVLLFFVTTSPGREW 42


>UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus
          lucimarinus CCE9901|Rep: Predicted protein -
          Ostreococcus lucimarinus CCE9901
          Length = 72

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 16/23 (69%), Positives = 16/23 (69%)
 Frame = -2

Query: 75 FHQSRTKVRGSKAIRYRPSSNRK 7
          FH  RTKV GSK IRY PS N K
Sbjct: 6  FHCQRTKVGGSKMIRYHPSLNHK 28


>UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 76

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 23/61 (37%), Positives = 35/61 (57%)
 Frame = +2

Query: 509 RGCWHQTCPPIVPR*NI*SVLIPITRLVRVPYRYFSSLPPRAGSG*LARLLPSLDVVAVS 688
           R CWHQT  P++    + +   PI    R  + + S  PP+  SG ++RLL  +D+VA+S
Sbjct: 11  RSCWHQT-GPLLGFGTVEN-RTPIHSTKRHQWNW-SLPPPKVSSGKVSRLLLPVDIVAIS 67

Query: 689 Q 691
           Q
Sbjct: 68  Q 68


>UniRef50_A5LFU4 Cluster: Putative uncharacterized protein; n=2;
           Streptococcus pneumoniae|Rep: Putative uncharacterized
           protein - Streptococcus pneumoniae SP3-BS71
          Length = 81

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 15/20 (75%), Positives = 18/20 (90%)
 Frame = -3

Query: 518 SSRVIPAPIAYTKIVAVKKL 459
           ++ VIPAPIAY K+VAVKKL
Sbjct: 3   AAAVIPAPIAYIKVVAVKKL 22


>UniRef50_Q0CLG0 Cluster: Putative uncharacterized protein; n=2;
            Eurotiomycetidae|Rep: Putative uncharacterized protein -
            Aspergillus terreus (strain NIH 2624)
          Length = 1413

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 19/63 (30%), Positives = 31/63 (49%)
 Frame = +1

Query: 484  VYAIGAGITRLLAPDLPSNCSSLKYLKCTHSDYEARKSPVSLFFVTTSPCREWVISAPAA 663
            +Y   AGI  LLA  LP +CS L+ ++   +        ++ F V T+P   W+++    
Sbjct: 1038 IYEHDAGIIPLLASHLPHSCSVLRRIQHGIAYPSPTAKILAPFPVGTTPTEPWIVAHVDL 1097

Query: 664  FLG 672
            F G
Sbjct: 1098 FCG 1100


>UniRef50_A7RZL6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 73

 Score = 32.7 bits (71), Expect = 8.7
 Identities = 14/19 (73%), Positives = 17/19 (89%)
 Frame = -3

Query: 518 SSRVIPAPIAYTKIVAVKK 462
           ++ VIPAPIAY K+VAVKK
Sbjct: 43  AAAVIPAPIAYIKVVAVKK 61


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 670,388,169
Number of Sequences: 1657284
Number of extensions: 13264285
Number of successful extensions: 30045
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 29270
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30034
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 54132236449
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).