SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0081
         (629 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes ...    63   5e-09
UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: ...    48   2e-04
UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;...    42   0.016
UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513...    41   0.028
UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n...    36   0.80 
UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|...    36   0.80 
UniRef50_Q5DDG7 Cluster: SJCHGC07011 protein; n=1; Schistosoma j...    36   1.1  
UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ...    34   2.4  
UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; ...    33   5.7  
UniRef50_A7HQK3 Cluster: Cytochrome c oxidase subunit II; n=1; P...    33   5.7  
UniRef50_A2D9Z7 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_O60079 Cluster: Probable ubiquitin carboxyl-terminal hy...    33   7.5  
UniRef50_Q8WXI7 Cluster: Mucin-16; n=23; cellular organisms|Rep:...    33   7.5  
UniRef50_UPI0000E4A253 Cluster: PREDICTED: similar to Vacuolar p...    32   9.9  

>UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes
           scapularis|Rep: Putative secreted protein - Ixodes
           scapularis (Black-legged tick) (Deer tick)
          Length = 65

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 30/53 (56%), Positives = 35/53 (66%)
 Frame = +2

Query: 35  PY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSDGMSAFIRSKPI 193
           P  G+TANGS+ Q WFLRS+  TWITV ILELIHA+         AFIR + I
Sbjct: 2   PKQGETANGSLNQLWFLRSFLPTWITVAILELIHAVSPKPLGATGAFIRPRSI 54


>UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep:
           LRRG00114 - Rattus norvegicus (Rat)
          Length = 223

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -3

Query: 414 LLPSLDVVAVSQAPSPESNPDSP 346
           LLPSLDVVAVSQAPSPE NPDSP
Sbjct: 167 LLPSLDVVAVSQAPSPELNPDSP 189


>UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;
           n=2; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 508

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 19/31 (61%), Positives = 20/31 (64%)
 Frame = +1

Query: 100 YLDNCGNSRANTCNQNSDQ*WDECFY*IKTN 192
           YLDNCGNSRANTC +      D C Y  KTN
Sbjct: 468 YLDNCGNSRANTCRRAPTS-GDACIYQTKTN 497


>UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130;
           n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY05130 - Plasmodium yoelii yoelii
          Length = 402

 Score = 40.7 bits (91), Expect = 0.028
 Identities = 26/61 (42%), Positives = 30/61 (49%)
 Frame = -2

Query: 604 LTATILVYXXXXXXXXXXXTRLALQLFLVKIFKCTHSDYEAS*ESRIVIFRHYLPCREWV 425
           LTATIL+Y           TRLALQL   K+    HS+Y+      IVI  HYL   E  
Sbjct: 314 LTATILIYAIGAGITAAAGTRLALQLIFGKVLSSHHSNYKTKIWPYIVISCHYLSYLELA 373

Query: 424 I 422
           I
Sbjct: 374 I 374



 Score = 39.1 bits (87), Expect = 0.086
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = -3

Query: 393 VAVSQAPSPESNPDSPLPVTTMVVAETTIES 301
           +A+SQAPSPESN +SPLPV  M+     I+S
Sbjct: 372 LAISQAPSPESNSNSPLPVKAMLGQYPNIKS 402


>UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1;
           Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry -
           Gallus gallus
          Length = 103

 Score = 35.9 bits (79), Expect = 0.80
 Identities = 18/27 (66%), Positives = 20/27 (74%)
 Frame = -1

Query: 506 VYSFRLRGLVRVPYRYFSSLPPVPGVG 426
           V SF+L+GL RV Y YFSSLPP  G G
Sbjct: 77  VDSFQLQGLERVLYCYFSSLPPRVGSG 103



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 20/37 (54%), Positives = 21/37 (56%)
 Frame = -2

Query: 616 TTSFLTATILVYXXXXXXXXXXXTRLALQLFLVKIFK 506
           TTSFLTA  L+Y           TRLALQ  LVK FK
Sbjct: 40  TTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFK 76


>UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus
           tropicalis|Rep: Novel protein - Xenopus tropicalis
           (Western clawed frog) (Silurana tropicalis)
          Length = 118

 Score = 35.9 bits (79), Expect = 0.80
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +1

Query: 286 MSALSTFDGSFCDYHG 333
           MSALSTFDG+FC YHG
Sbjct: 1   MSALSTFDGTFCAYHG 16


>UniRef50_Q5DDG7 Cluster: SJCHGC07011 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC07011 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 101

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +1

Query: 103 LDNCGNSRANTCNQNSDQ*WDECFY*IKTNRRRASRPKSLILMNLDNFCRSMVKYR 270
           +DNC NSRANTC ++  +     F   +TNR +       +  ++D  C +++  R
Sbjct: 1   MDNCSNSRANTCLESLTRKGTGAFIRTETNRVQRLMTSVPVTSSVDELCDNVILSR 56


>UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 76

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 11/13 (84%), Positives = 11/13 (84%)
 Frame = -1

Query: 572 SWNYRGCWHQTCP 534
           SWNYR CWHQT P
Sbjct: 7   SWNYRSCWHQTGP 19


>UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1;
           Roseovarius sp. HTCC2601|Rep: Putative uncharacterized
           protein - Roseovarius sp. HTCC2601
          Length = 507

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 16/40 (40%), Positives = 24/40 (60%)
 Frame = +2

Query: 92  YSVTWITVVILELIHAIRTLTSDGMSAFIRSKPIDGGPRV 211
           YS T + VV+ EL+    T+ SD  +A I + P+DG  R+
Sbjct: 139 YSATSMAVVLSELVVDDETIPSDNAAAQISAGPVDGETRI 178


>UniRef50_A7HQK3 Cluster: Cytochrome c oxidase subunit II; n=1;
           Parvibaculum lavamentivorans DS-1|Rep: Cytochrome c
           oxidase subunit II - Parvibaculum lavamentivorans DS-1
          Length = 394

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 23/67 (34%), Positives = 32/67 (47%)
 Frame = -2

Query: 535 LQLFLVKIFKCTHSDYEAS*ESRIVIFRHYLPCREWVICAPAAFLGCGSRFSGSLSGIEP 356
           L L L ++F+     ++ S   +I + R     R   ICA AA  GC    SG LS ++P
Sbjct: 140 LDLRLDRVFRVVGFAHDTSPIRKITLLRRGPFRRAAAICAGAALSGC----SGDLSALDP 195

Query: 355 *FPVTRD 335
             P  RD
Sbjct: 196 AGPAARD 202


>UniRef50_A2D9Z7 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 872

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = -3

Query: 411 LPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES**GRHLKD 277
           +PSL  V++SQ   P+  P +PLP    +++E   E   G  + D
Sbjct: 67  IPSLPPVSISQTIKPQIIPQNPLPTMNHIISEPLDEPASGEEMAD 111


>UniRef50_O60079 Cluster: Probable ubiquitin carboxyl-terminal
           hydrolase 12; n=1; Schizosaccharomyces pombe|Rep:
           Probable ubiquitin carboxyl-terminal hydrolase 12 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 979

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
 Frame = +3

Query: 207 ASEVVNFDESG*LLQIHGQVPATHLSNVCLINFRW*F---LRLPWLSRVTGNQGSIPERE 377
           + E+++F E    L   G   +  L   C+IN  W     LRL +L +   NQ S  E++
Sbjct: 243 SKEIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEEQK 302

Query: 378 PEKRLP 395
            EKR+P
Sbjct: 303 QEKRVP 308


>UniRef50_Q8WXI7 Cluster: Mucin-16; n=23; cellular organisms|Rep:
            Mucin-16 - Homo sapiens (Human)
          Length = 22152

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = -3

Query: 477  KSPVSLFFVTT---SRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVA 319
            ++P  + ++TT       SG F+ + PS+   +   + SPES P SPLPVT ++ +
Sbjct: 5614 RTPGDVSWMTTPPVEETSSG-FSLMSPSMTSPSPVSSTSPESIPSSPLPVTALLTS 5668


>UniRef50_UPI0000E4A253 Cluster: PREDICTED: similar to Vacuolar
           protein sorting protein 36 (ELL-associated protein of 45
           kDa), partial; n=3; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Vacuolar protein sorting protein
           36 (ELL-associated protein of 45 kDa), partial -
           Strongylocentrotus purpuratus
          Length = 349

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = -2

Query: 349 PVTRDNHGSRRNYHRKLIRQTFERCVA 269
           PVTR+ HGS   YH +L +Q  E  +A
Sbjct: 190 PVTRETHGSGLKYHEELAKQLSEALIA 216


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 618,495,737
Number of Sequences: 1657284
Number of extensions: 12710459
Number of successful extensions: 31768
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 30555
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31754
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46466611856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).