SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0079
         (617 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...    95   1e-18
UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0...    56   5e-07
UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ...    52   8e-06
UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella ve...    51   2e-05
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    47   4e-04
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    44   0.002
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    42   0.012
UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontog...    41   0.021
UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; ...    40   0.047
UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; ...    38   0.14 
UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;...    38   0.25 
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    38   0.25 
UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia scl...    35   1.8  
UniRef50_A3B1W2 Cluster: Putative uncharacterized protein; n=4; ...    34   2.4  
UniRef50_A4HHL8 Cluster: Putative uncharacterized protein; n=3; ...    33   4.1  
UniRef50_Q5KKC3 Cluster: Expressed protein; n=2; Filobasidiella ...    33   4.1  
UniRef50_Q5BGW6 Cluster: Putative uncharacterized protein; n=1; ...    33   4.1  
UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7; ...    33   4.1  
UniRef50_Q7M6X7 Cluster: Zinc finger protein 457; n=15; Murinae|...    33   5.5  
UniRef50_Q3W7D7 Cluster: Regulatory protein, TetR; n=1; Frankia ...    33   5.5  
UniRef50_Q0UKE4 Cluster: Predicted protein; n=1; Phaeosphaeria n...    33   5.5  
UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20; ...    33   5.5  
UniRef50_UPI0000E8113C Cluster: PREDICTED: hypothetical protein;...    32   9.5  
UniRef50_Q2LUB9 Cluster: Hypothetical membrane protein; n=1; Syn...    32   9.5  
UniRef50_Q5KHX1 Cluster: Putative uncharacterized protein; n=1; ...    32   9.5  

>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 41/46 (89%), Positives = 43/46 (93%)
 Frame = +1

Query: 373 HQ*GKTNLSHDGLIPAHVPF*WVNNPTLGEFCFAMIGRADIEGSKT 510
           HQ GKTNLSHDGLIPAHVP+ WVNNPTLGEFCF MIGRADIEGSK+
Sbjct: 57  HQWGKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKS 102



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGT 572
           K+NVAMNAWLPQASYPCGNFS T
Sbjct: 101 KSNVAMNAWLPQASYPCGNFSDT 123


>UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep:
           LRRG00134 - Rattus norvegicus (Rat)
          Length = 221

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 23/25 (92%), Positives = 24/25 (96%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKT 510
           WVNNPTLGEFCF MIGRADIEGSK+
Sbjct: 25  WVNNPTLGEFCFTMIGRADIEGSKS 49



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 19/23 (82%), Positives = 21/23 (91%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGT 572
           K++VAMNAW PQASYPCGNFS T
Sbjct: 48  KSDVAMNAWPPQASYPCGNFSDT 70


>UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 116

 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 24/32 (75%), Positives = 27/32 (84%)
 Frame = -1

Query: 518 SDVVFDPSMSALPIIAKQNSPSVGLFTHQKGT 423
           S ++FDPSMSALPII KQNS  VGLFT Q+GT
Sbjct: 85  STLLFDPSMSALPIIVKQNSQRVGLFTRQQGT 116



 Score = 39.1 bits (87), Expect = 0.083
 Identities = 18/28 (64%), Positives = 20/28 (71%)
 Frame = -2

Query: 592 YKEFLARVPEKLPQG*LACGSQAFIATL 509
           +  F   V EKLPQG LACGSQ FI+TL
Sbjct: 60  FTSFKLEVSEKLPQGQLACGSQEFISTL 87


>UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 746

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 22/30 (73%), Positives = 26/30 (86%)
 Frame = -1

Query: 359 IVILLSTRGTAVSDIWFMHSAERPVVRSYH 270
           +VILLSTRGTA SD W +H AE+P+VRSYH
Sbjct: 660 VVILLSTRGTADSDNWHLHLAEKPMVRSYH 689


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 18/18 (100%), Positives = 18/18 (100%)
 Frame = +3

Query: 519 MNAWLPQASYPCGNFSGT 572
           MNAWLPQASYPCGNFSGT
Sbjct: 1   MNAWLPQASYPCGNFSGT 18


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 17/19 (89%), Positives = 19/19 (100%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGN 560
           K+NVAMNAWLPQASYPCG+
Sbjct: 11  KSNVAMNAWLPQASYPCGS 29


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 17/23 (73%), Positives = 19/23 (82%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGT 572
           K+ VA +AW PQASYPCGNFS T
Sbjct: 11  KSYVARSAWQPQASYPCGNFSDT 33


>UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3;
           Euarchontoglires|Rep: 4933429F08Rik protein - Mus
           musculus (Mouse)
          Length = 29

 Score = 41.1 bits (92), Expect = 0.021
 Identities = 16/18 (88%), Positives = 16/18 (88%)
 Frame = +3

Query: 519 MNAWLPQASYPCGNFSGT 572
           MNAW PQASYPCGNFS T
Sbjct: 1   MNAWPPQASYPCGNFSDT 18


>UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4;
           Bacteria|Rep: Putative uncharacterized protein -
           Magnetospirillum gryphiswaldense
          Length = 76

 Score = 39.9 bits (89), Expect = 0.047
 Identities = 20/34 (58%), Positives = 21/34 (61%)
 Frame = -2

Query: 496 RCRLFLSLRSKIRQALDCSPIKRERELGLDRRET 395
           RCRL  S      Q   CSPIK  RELGL+RRET
Sbjct: 4   RCRLITSWGWSRSQGFGCSPIKVVRELGLERRET 37


>UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4;
           Eukaryota|Rep: Putative uncharacterized protein -
           Plasmodium berghei
          Length = 54

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 16/18 (88%), Positives = 16/18 (88%)
 Frame = -2

Query: 448 DCSPIKRERELGLDRRET 395
           DCSP  RERELGLDRRET
Sbjct: 6   DCSPANRERELGLDRRET 23


>UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 440

 Score = 37.5 bits (83), Expect = 0.25
 Identities = 16/18 (88%), Positives = 18/18 (100%)
 Frame = +2

Query: 503 QKQRRYERLAATSQLSLW 556
           +K+RRYERLAATSQLSLW
Sbjct: 57  KKRRRYERLAATSQLSLW 74


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 37.5 bits (83), Expect = 0.25
 Identities = 15/21 (71%), Positives = 17/21 (80%)
 Frame = +3

Query: 498 RIKNNVAMNAWLPQASYPCGN 560
           R K+ VA NAW PQASYPCG+
Sbjct: 9   RSKSYVAKNAWQPQASYPCGS 29


>UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia
           sclerotiorum 1980|Rep: Predicted protein - Sclerotinia
           sclerotiorum 1980
          Length = 147

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 15/23 (65%), Positives = 18/23 (78%)
 Frame = +1

Query: 439 VNNPTLGEFCFAMIGRADIEGSK 507
           VN+P L EFCF +  RADIEGS+
Sbjct: 120 VNSPMLTEFCFGIRERADIEGSE 142


>UniRef50_A3B1W2 Cluster: Putative uncharacterized protein; n=4;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 486

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = -3

Query: 321 GHLVHALGRAAGGAKLPSAGLCRTPLR 241
           GH  H +G AAGGA  P  G+ R PLR
Sbjct: 352 GHGDHRVGAAAGGAAAPGGGMVRHPLR 378


>UniRef50_A4HHL8 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania braziliensis
          Length = 489

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 17/60 (28%), Positives = 30/60 (50%)
 Frame = -2

Query: 346 SVREEPQFRTFGSCTRPSGRWCEATIRGIMPNASKAEASLAESGKDMLTVEPRESGGSKQ 167
           SV +E +  + G C  PS RW  A++R +    S    +  E+  D   ++  ++GGS +
Sbjct: 105 SVDKESEGESEGLCPSPSARWKRASLRAMRGRDSVPRLAATEARDDADEMDDIDNGGSDE 164


>UniRef50_Q5KKC3 Cluster: Expressed protein; n=2; Filobasidiella
           neoformans|Rep: Expressed protein - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 778

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 18/49 (36%), Positives = 24/49 (48%)
 Frame = -3

Query: 360 DSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCRTPLRPKPA*PNPA 214
           D     ++  RS G LV  LGR  G  KLP   +  +P RP+   P P+
Sbjct: 147 DQGDGGFDPERSLGRLVGELGRIIGDEKLPK--IPNSPFRPRSRSPLPS 193


>UniRef50_Q5BGW6 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 998

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 23/51 (45%), Positives = 26/51 (50%), Gaps = 2/51 (3%)
 Frame = -2

Query: 271 IRGIMPNASKAEASLAE--SGKDMLTVEPRESGGSKQCDFTSRVSHSKRET 125
           IRGIMP A + E S  E  SGK   TV    SGG    + +   S SKR T
Sbjct: 643 IRGIMPQADRMEVSEQEITSGK-TFTVGASGSGGPSNVNISMEGSKSKRST 692


>UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7;
           Archaea|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-062
          Length = 272

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 19/39 (48%), Positives = 21/39 (53%)
 Frame = -3

Query: 495 DVGSSYHCEAKFAKRWIVHPSKGNVSWD*TVVRQVSFTL 379
           DV SS+   A  AK  +  P KGNV W  TV RQV   L
Sbjct: 228 DVVSSHPGGAAAAKGGVARPLKGNVRWVQTVARQVGLYL 266


>UniRef50_Q7M6X7 Cluster: Zinc finger protein 457; n=15;
           Murinae|Rep: Zinc finger protein 457 - Mus musculus
           (Mouse)
          Length = 644

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = -3

Query: 597 ISIKSF*-QECQKSYHRDNWLVAAKR--S*RRCF*SFDVGSSYHCEAKFAKRWIVH 439
           + +KS+  +EC KS+H  + L A KR  +  + + S D G  +HC +  ++  IVH
Sbjct: 104 LRVKSYKCEECGKSFHFPSLLSAHKRKHTGEKLYSSEDSGKDFHCPSLLSQNKIVH 159


>UniRef50_Q3W7D7 Cluster: Regulatory protein, TetR; n=1; Frankia sp.
           EAN1pec|Rep: Regulatory protein, TetR - Frankia sp.
           EAN1pec
          Length = 220

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 22/56 (39%), Positives = 27/56 (48%)
 Frame = -3

Query: 315 LVHALGRAAGGAKLPSAGLCRTPLRPKPA*PNPARICSLWSPESREALNNVTLLVA 148
           L  AL  AA G   P A L R  L    A P+P R+  LW+   RE +  V  L+A
Sbjct: 72  LKEALDVAAVGDDEPVALLDRPWLEELTAEPDPVRVIELWTHGGREIMGRVAPLLA 127


>UniRef50_Q0UKE4 Cluster: Predicted protein; n=1; Phaeosphaeria
           nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 298

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 31/98 (31%), Positives = 42/98 (42%), Gaps = 5/98 (5%)
 Frame = -3

Query: 297 RAAGGAKLPSAGLCRTPLRPKPA*P--NPARICSLWSPESREALN---NVTLLVAFRIQN 133
           RA  G+K  S G  R  +   P  P  +P+   SL S + R   +   N++  +    QN
Sbjct: 50  RADRGSKTSSYGRGRDSVISHPFSPKQSPSPRSSLSSGDKRRHSSIPQNLSPTLVNDAQN 109

Query: 132 ARRDVEAHLDRGDRCYRFFS*HVHHGSEGPDITQFDVG 19
            RR  +AHLD     Y     H H GS   D   +D G
Sbjct: 110 IRRPPQAHLDPEKHGYGSSKPHRHSGSTRSDEAVYDQG 147


>UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20;
           n=1; Yarrowia lipolytica|Rep: Serine/threonine-protein
           kinase STE20 - Yarrowia lipolytica (Candida lipolytica)
          Length = 1125

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 22/69 (31%), Positives = 30/69 (43%)
 Frame = -3

Query: 306 ALGRAAGGAKLPSAGLCRTPLRPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR 127
           A G +  GA  PSA     P RP PA   P  + S+ +P S      +T L AF  +  +
Sbjct: 639 ASGDSGAGAAPPSAAPKSPPPRPPPA--PPLGVPSVHAPNSEYRQKMITQLEAFNAKRQQ 696

Query: 126 RDVEAHLDR 100
              E H  +
Sbjct: 697 ERAERHAQK 705


>UniRef50_UPI0000E8113C Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 171

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 21/50 (42%), Positives = 24/50 (48%)
 Frame = +3

Query: 192 GSTVSISLPDSARLASALEAFGIIPRMVASHHRPLGRVHEPNVRNCGSSR 341
           G+T +   PDS RL S   + G  PR  ASH  P G    P  R  GS R
Sbjct: 18  GTTAAPRPPDSPRLTSRRRSPGPPPRRAASHLVPAGGC-GPRPRGAGSRR 66


>UniRef50_Q2LUB9 Cluster: Hypothetical membrane protein; n=1;
           Syntrophus aciditrophicus SB|Rep: Hypothetical membrane
           protein - Syntrophus aciditrophicus (strain SB)
          Length = 90

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 2/35 (5%)
 Frame = +3

Query: 105 PNGLRRRVSRFECETRLVKS--HCLEPPDSRGSTV 203
           P+ ++R V  + CE+R+ +S  HCL  P SRG+ +
Sbjct: 31  PSYIKRGVPAYRCESRVGQSNFHCLNIPSSRGTEI 65


>UniRef50_Q5KHX1 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 628

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
 Frame = -3

Query: 360 DSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCR-TPLR-PKPA*PNP 217
           ++  A ++  RS G LV  LGR  G  KLPS      +P R P P   NP
Sbjct: 48  EAGDADFDPERSLGRLVDELGRVMGSDKLPSRPSSPFSPTRTPTPLGSNP 97


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 644,037,123
Number of Sequences: 1657284
Number of extensions: 13202967
Number of successful extensions: 36274
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 35125
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36259
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 44807090004
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).