SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0076
         (634 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    57   9e-18
UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa...    87   3e-16
UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...    87   3e-16
UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ...    77   3e-13
UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo...    76   8e-13
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    71   2e-11
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    60   3e-08
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    58   1e-07
UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;...    55   1e-06
UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47...    52   1e-05
UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1; ...    46   8e-04
UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3; ...    45   0.002
UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1; ...    44   0.002
UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221...    43   0.005
UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|R...    38   0.26 
UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2; ...    38   0.26 
UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1; ...    38   0.26 
UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1; ...    38   0.26 
UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ...    38   0.26 
UniRef50_Q580V9 Cluster: Putative uncharacterized protein; n=1; ...    35   1.4  
UniRef50_Q5BBP8 Cluster: Putative uncharacterized protein; n=1; ...    35   1.4  
UniRef50_Q2H5Q5 Cluster: Putative uncharacterized protein; n=1; ...    35   1.4  
UniRef50_O74086 Cluster: Putative uncharacterized protein PHS003...    35   1.4  
UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia ...    33   7.5  
UniRef50_A7S5E9 Cluster: Predicted protein; n=1; Nematostella ve...    32   10.0 

>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 56.8 bits (131), Expect(2) = 9e-18
 Identities = 27/40 (67%), Positives = 29/40 (72%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSVSN 502
           F PF   E+SVL E  LGHLRY LTDVPPQ NSP  +VSN
Sbjct: 48  FYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSPPDNVSN 87



 Score = 56.0 bits (129), Expect(2) = 9e-18
 Identities = 29/49 (59%), Positives = 34/49 (69%)
 Frame = -2

Query: 390 PPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVSFPA 244
           P + +S ETM+VVVF RR     SHL YT HVS QCQTRVKLN  ++ A
Sbjct: 97  PLHWISKETMEVVVFHRRRS---SHLFYTLHVSSQCQTRVKLNHAAYTA 142


>UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa
           group|Rep: Zgc:165536 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 55

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 36/41 (87%), Positives = 39/41 (95%)
 Frame = +3

Query: 135 MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKR 257
           MPRHLISDAHEW+NEIPTVP  YLAKPQPRERAW+NQRGK+
Sbjct: 1   MPRHLISDAHEWMNEIPTVPTCYLAKPQPRERAWQNQRGKK 41



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 15/17 (88%), Positives = 17/17 (100%)
 Frame = +2

Query: 248 GKETLLSLTLVWHCKET 298
           GK+TLLSLTLVWHC+ET
Sbjct: 39  GKKTLLSLTLVWHCEET 55


>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 66/135 (48%), Positives = 76/135 (56%), Gaps = 1/135 (0%)
 Frame = -2

Query: 576 ALGHLRYSLTDVPPQSNSPHGSVSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRA 397
           +LGHLRY LTDVPPQ NSP  +V  R  R     T VS       L  K         R 
Sbjct: 168 SLGHLRYLLTDVPPQPNSPPDNVF-RPDRP----TKVS-------LWIKKEGQR----RP 211

Query: 396 PLPPNRVSN-ETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVSFPADSPKPVPL 220
           P   N+++N ++  +  F   S    SHL YTS V  Q +TRVKLNRV FPADS K VPL
Sbjct: 212 PDSRNKLNNVKSSGISTFAVSS----SHLSYTSQVISQSRTRVKLNRVFFPADSAKAVPL 267

Query: 219 AVVSLDSR*GQWESR 175
            +VSLDSR GQWE R
Sbjct: 268 LLVSLDSRKGQWEFR 282


>UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC
           50803
          Length = 329

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 43/71 (60%), Positives = 45/71 (63%)
 Frame = -2

Query: 255 SFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVYPRLLEF 76
           S PA  P PVP A  S     GQW+ R SIHAR  L DEAFGYLKRVIVTPAVY      
Sbjct: 186 SCPAGRPSPVPEAGGSRRRGSGQWDPRWSIHARRKLPDEAFGYLKRVIVTPAVYQGFGGS 245

Query: 75  LHVDIQSTGQK 43
           LH D + TGQK
Sbjct: 246 LHSDGRGTGQK 256


>UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10;
           Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana
           tabacum (Common tobacco)
          Length = 530

 Score = 75.8 bits (178), Expect = 8e-13
 Identities = 57/120 (47%), Positives = 68/120 (56%), Gaps = 2/120 (1%)
 Frame = -2

Query: 399 APLPPNRVSNETMKVVVFQ-RRSRETISHLCYTSH-VSLQCQTRVKLNRVSFPADSPKPV 226
           APLP + +S  T+KVVVF  R S  T +    + H V L+  +       SFPADS KPV
Sbjct: 31  APLPIHGISKITLKVVVFHFRLSAPTYTTPLKSFHKVGLESSSTGS----SFPADSAKPV 86

Query: 225 PLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQ 46
           PL VVSLDSR     S  SIHA           L+    +P VYPRL+EFLH DIQSTG+
Sbjct: 87  PLVVVSLDSRQDSGISL-SIHAVTNKMTRHLATLRESCYSP-VYPRLVEFLHFDIQSTGR 144


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = -2

Query: 147 DDEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQK 43
           +DEAFGYLKRVIVTPAVYPRL+EFLH DIQSTGQK
Sbjct: 113 NDEAFGYLKRVIVTPAVYPRLVEFLHFDIQSTGQK 147



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 26/38 (68%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NSP  +V
Sbjct: 48  FYPFVLHEISVLVELILGHLRYLLTDVPPQPNSPPDNV 85


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 28/43 (65%), Positives = 33/43 (76%)
 Frame = -2

Query: 627 SQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSVSNR 499
           + F PF+ +E+SVL+EL  GHLRY LTDVPPQSNSP   VS R
Sbjct: 68  TSFSPFSLQEISVLSELVFGHLRYYLTDVPPQSNSPPDYVSIR 110


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 27/41 (65%), Positives = 31/41 (75%)
 Frame = -2

Query: 627 SQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSVS 505
           + F PF+ +E+SVL EL  GHL Y LTDVPPQSNSP G VS
Sbjct: 46  TSFSPFSLQEISVLFELVFGHLCYFLTDVPPQSNSPSGYVS 86



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 29/48 (60%), Positives = 31/48 (64%)
 Frame = -2

Query: 144 DEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQKFXLRQHPRGPSQCF 1
           DE FGYLKRVIVTPAVY   +EF  VDI  TGQK        G SQC+
Sbjct: 144 DETFGYLKRVIVTPAVYLCFIEFHQVDIHGTGQKSHCVNTISGFSQCY 191



 Score = 39.9 bits (89), Expect = 0.050
 Identities = 23/63 (36%), Positives = 28/63 (44%)
 Frame = -3

Query: 203 IVDRDSGNLVNPFMRVTN*MTRHLATLRES*LLPPFTRACLNFFTLTFRALGRNXXCVNT 24
           I  RDS NLVNPFM VTN        L+   + P      + F  +     G+   CVNT
Sbjct: 125 IASRDSENLVNPFMHVTN-YDETFGYLKRVIVTPAVYLCFIEFHQVDIHGTGQKSHCVNT 183

Query: 23  REG 15
             G
Sbjct: 184 ISG 186


>UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 70

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 30/58 (51%), Positives = 31/58 (53%)
 Frame = -3

Query: 323 SPTYATPLMSPYNARXXXXXXXXXXXXXXXXXXXXLWFR*IVDRDSGNLVNPFMRVTN 150
           SPTYATPLMSPYNAR                          + RDSGNLVNPFMRVTN
Sbjct: 13  SPTYATPLMSPYNARLESSSTGSSFPANFSKPVPLAVVSLDMGRDSGNLVNPFMRVTN 70


>UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47;
           Eukaryota|Rep: Uncharacterized protein YLR162W-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 62

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSP 520
           F PF   E+SVL E  LGHLRY LTDVPPQ NSP
Sbjct: 14  FYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSP 47


>UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 108

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 22/40 (55%), Positives = 26/40 (65%)
 Frame = -2

Query: 627 SQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           + F  F   E+ VL +L LGHLRY LTDV PQ NSP  +V
Sbjct: 44  TSFYHFVLHEIFVLVKLILGHLRYLLTDVSPQPNSPPDNV 83


>UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3;
           Thermoproteaceae|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-061
          Length = 234

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/35 (48%), Positives = 24/35 (68%)
 Frame = +3

Query: 153 SDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKR 257
           S  HEWINE+PTVP    A P P  ++W+ +RG++
Sbjct: 177 SGVHEWINEVPTVPARGPANPPPGAQSWDPRRGEK 211


>UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 421

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 17/24 (70%), Positives = 20/24 (83%)
 Frame = +3

Query: 144 HLISDAHEWINEIPTVPIYYLAKP 215
           HLISDAHEWIN+ PT+ +YY  KP
Sbjct: 398 HLISDAHEWINKNPTILVYYPTKP 421


>UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221;
           n=2; Pyrococcus|Rep: Putative uncharacterized protein
           PH0221 - Pyrococcus horikoshii
          Length = 235

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 27/54 (50%), Positives = 29/54 (53%)
 Frame = -2

Query: 255 SFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 94
           S P   P     A VS     GQ   R +IHA   L D+ F YLKRVIVTPAVY
Sbjct: 4   SLPTGGPWHARQAEVSPGPGRGQRGPRYAIHAGRHLTDKEFRYLKRVIVTPAVY 57


>UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|Rep:
           Lipoprotein, putative - Campylobacter lari RM2100
          Length = 97

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 21/40 (52%), Positives = 25/40 (62%)
 Frame = -2

Query: 213 VSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 94
           +SLD    Q  SR +IHA   L D+ F YL+ VIVT AVY
Sbjct: 50  ISLDPSLRQLPSRYAIHAGRYLTDKEFRYLRTVIVTAAVY 89


>UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2;
           Streptococcus pneumoniae|Rep: Putative uncharacterized
           protein - Streptococcus pneumoniae SP3-BS71
          Length = 44

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 19/34 (55%), Positives = 22/34 (64%)
 Frame = +3

Query: 528 LTGAVHLSKNNAGVLRPAQRGQKPRVEQKGKTGL 629
           + GA HL  +NA VLR A   QK  VEQKGK+ L
Sbjct: 1   MAGAAHLLNDNADVLRGAHGEQKSPVEQKGKSPL 34


>UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1;
           Crassostrea gigas|Rep: Tyrosine-protein kinase receptor
           - Crassostrea gigas (Pacific oyster) (Crassostrea
           angulata)
          Length = 804

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 17/22 (77%), Positives = 18/22 (81%)
 Frame = +3

Query: 42  ISAQCSECQREEIQASAGKRRE 107
           ISAQCSECQ EEIQ+S GK  E
Sbjct: 4   ISAQCSECQSEEIQSSEGKGGE 25


>UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 70

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 18/23 (78%), Positives = 19/23 (82%)
 Frame = -2

Query: 255 SFPADSPKPVPLAVVSLDSR*GQ 187
           SFPAD  KPVPLA+ SLDSR GQ
Sbjct: 31  SFPADYSKPVPLAMGSLDSRQGQ 53


>UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 116

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 20/33 (60%), Positives = 22/33 (66%)
 Frame = +1

Query: 523 GV*LGRYICQRITQVS*GQLSEDRNLAWSKRAK 621
           GV LGR  CQ ITQ S  QLSE+ NL  +KR K
Sbjct: 5   GVCLGRNACQTITQASQVQLSENGNLTQNKRVK 37


>UniRef50_Q580V9 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 1232

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 27/82 (32%), Positives = 36/82 (43%), Gaps = 2/82 (2%)
 Frame = -2

Query: 462 ATSPLCTLGTKHRAPA-DIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 286
           +TSP+    TK   P  D +D   +PP  V  E     VF     +T     ++S V+ Q
Sbjct: 105 STSPVVVRPTKDLPPTKDAVDAPRMPPTAVKREES---VFHDGDGQTPVTSVHSSVVATQ 161

Query: 285 CQTR-VKLNRVSFPADSPKPVP 223
             +  VKL     PA SP P P
Sbjct: 162 SASEAVKLRPPKIPASSPSPSP 183


>UniRef50_Q5BBP8 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 2221

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 26/81 (32%), Positives = 39/81 (48%)
 Frame = -2

Query: 462 ATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQC 283
           A   LC    + R P  +  R  LP N+VS +   +V    RS   ++ L +TS  S+  
Sbjct: 280 AVVELCQSMPELRYP--VAARLALPINQVSGQETDLVGMVLRSM-LVNQLNWTSTTSMLT 336

Query: 282 QTRVKLNRVSFPADSPKPVPL 220
             + +L+RV F  D P P P+
Sbjct: 337 LNKEELSRVEFGLDRPLPPPV 357


>UniRef50_Q2H5Q5 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 604

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = -2

Query: 585 AELALGHLRYSLTDVPPQSNSPHGSVSNRI 496
           A + LGH R S+ D+ P  N PH S SN I
Sbjct: 53  ASVGLGHNRLSINDLSPAGNQPHHSPSNNI 82


>UniRef50_O74086 Cluster: Putative uncharacterized protein PHS003;
           n=1; Pyrococcus horikoshii|Rep: Putative uncharacterized
           protein PHS003 - Pyrococcus horikoshii
          Length = 52

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 18/34 (52%), Positives = 20/34 (58%)
 Frame = +3

Query: 522 GSLTGAVHLSKNNAGVLRPAQRGQKPRVEQKGKT 623
           GSL GA    K   G LR AQ GQ+  VE KGK+
Sbjct: 2   GSLAGAARPRKGIGGALRSAQAGQESAVECKGKS 35


>UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_557_1225 - Giardia lamblia ATCC
           50803
          Length = 222

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 16/30 (53%), Positives = 17/30 (56%)
 Frame = +2

Query: 167 MD*RDSHCPYLLSSETTAKGTGLGESAGKE 256
           MD R SHCP     E  A GTG G  AG+E
Sbjct: 1   MDQRGSHCPEPRLREPPASGTGEGRPAGQE 30


>UniRef50_A7S5E9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 478

 Score = 32.3 bits (70), Expect = 10.0
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 141 RHLISDAHEWINEIPTVPIYYLAKPQPR 224
           +H  +D       +PTVP+ YLA+PQPR
Sbjct: 125 QHKQNDVETHAKPLPTVPMNYLAQPQPR 152


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 634,834,081
Number of Sequences: 1657284
Number of extensions: 12546506
Number of successful extensions: 29302
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 28509
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29290
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46881492319
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).