SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0071
         (637 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5C0F6 Cluster: Putative uncharacterized protein; n=1; ...   107   2e-22
UniRef50_Q59KL1 Cluster: Putative uncharacterized protein; n=1; ...    84   3e-15
UniRef50_A7RNM9 Cluster: Predicted protein; n=4; Eumetazoa|Rep: ...    73   6e-12
UniRef50_UPI0000F2E2E1 Cluster: PREDICTED: similar to SH2-B homo...    68   2e-10
UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;...    67   4e-10
UniRef50_A3LSK4 Cluster: Predicted protein; n=4; Ascomycota|Rep:...    66   5e-10
UniRef50_Q6NKM5 Cluster: LD48059p; n=1; Drosophila melanogaster|...    64   4e-09
UniRef50_Q652R5 Cluster: Putative uncharacterized protein P0603C...    56   9e-07
UniRef50_UPI0000F2EBE7 Cluster: PREDICTED: similar to COL5A2 pro...    49   8e-05
UniRef50_Q7RN94 Cluster: Putative uncharacterized protein PY0192...    43   0.007
UniRef50_A3LSK3 Cluster: Predicted protein; n=7; Fungi/Metazoa g...    40   0.050
UniRef50_Q7RAD4 Cluster: Putative uncharacterized protein PY0656...    37   0.47 
UniRef50_Q7R7A3 Cluster: Putative uncharacterized protein PY0768...    35   1.9  
UniRef50_Q9RXX4 Cluster: Putative uncharacterized protein; n=1; ...    33   4.4  
UniRef50_Q6QIS8 Cluster: Tail sheath protein gp18; n=1; Klebsiel...    33   7.6  

>UniRef50_Q5C0F6 Cluster: Putative uncharacterized protein; n=1;
           Schistosoma japonicum|Rep: Putative uncharacterized
           protein - Schistosoma japonicum (Blood fluke)
          Length = 102

 Score =  107 bits (258), Expect = 2e-22
 Identities = 52/77 (67%), Positives = 59/77 (76%)
 Frame = -2

Query: 492 SHSRGVSFPISE*RRALSTNAGTRKMVNYAWSGRSQGKP*WRTVAILTCKSIVGTGYRGE 313
           +H R VS P +  R + S    TRKMVNYAW+GRSQ K  WR+VA+LTCKS+V  GYRGE
Sbjct: 27  AHHRPVS-PAAPGRWSTSARVRTRKMVNYAWAGRSQRKLWWRSVAVLTCKSVVRPGYRGE 85

Query: 312 RLIEPSSSWFRPKFPSG 262
           RLIEPSSSWF PKFPSG
Sbjct: 86  RLIEPSSSWFPPKFPSG 102


>UniRef50_Q59KL1 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 108

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 40/49 (81%), Positives = 41/49 (83%)
 Frame = +3

Query: 297 MVRLVFRPYTQFRRSICTSESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 443
           MVRLVFRPYTQ RRSICTSE LR+S RVS  F L RHSSPSFGSQ LCS
Sbjct: 1   MVRLVFRPYTQIRRSICTSEPLRASTRVSSGFTLFRHSSPSFGSQQLCS 49


>UniRef50_A7RNM9 Cluster: Predicted protein; n=4; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 53

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 33/44 (75%), Positives = 34/44 (77%)
 Frame = +1

Query: 310 SFAPIPSSDDRFARQNRYGPPSGFPLTST*PGIVHHLSGPSICA 441
           SFAPIP  DDRFARQNRY PP  FPL S   GIVHHLSGP+ CA
Sbjct: 1   SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNRCA 44


>UniRef50_UPI0000F2E2E1 Cluster: PREDICTED: similar to SH2-B
           homolog,; n=2; Mammalia|Rep: PREDICTED: similar to SH2-B
           homolog, - Monodelphis domestica
          Length = 394

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 41/73 (56%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +1

Query: 244 FISTQLS*GKLRTEPATRWF-D*SFAPIPS--SDDRFARQNRYGPPSGFPLTST*PGIVH 414
           F+S QLS  KL     TRW  D    P  +  SDDRFARQ+RYGPP  FPL S  PGIVH
Sbjct: 25  FVS-QLS-SKLSYSGPTRWVPDSRVLPDTTMGSDDRFARQDRYGPPPEFPLASPCPGIVH 82

Query: 415 HLSGPSICAQSAP 453
           HLSGP+  A + P
Sbjct: 83  HLSGPNTHAHAPP 95


>UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 440

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 29/44 (65%), Positives = 34/44 (77%)
 Frame = +1

Query: 322 IPSSDDRFARQNRYGPPSGFPLTST*PGIVHHLSGPSICAQSAP 453
           +  SDDRFARQ+RYGPP  FPL S  PGIVHHLSGP+  A++ P
Sbjct: 115 LTGSDDRFARQDRYGPPPEFPLASPCPGIVHHLSGPNAYARAPP 158


>UniRef50_A3LSK4 Cluster: Predicted protein; n=4; Ascomycota|Rep:
           Predicted protein - Pichia stipitis (Yeast)
          Length = 81

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 30/41 (73%), Positives = 31/41 (75%)
 Frame = +1

Query: 310 SFAPIPSSDDRFARQNRYGPPSGFPLTST*PGIVHHLSGPS 432
           SFAPIP  DDRFARQNRY PP  FP  S   GIVHHLSGP+
Sbjct: 1   SFAPIPKFDDRFARQNRYEPPPEFPSASPYSGIVHHLSGPN 41


>UniRef50_Q6NKM5 Cluster: LD48059p; n=1; Drosophila
           melanogaster|Rep: LD48059p - Drosophila melanogaster
           (Fruit fly)
          Length = 46

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 29/38 (76%), Positives = 32/38 (84%)
 Frame = -1

Query: 442 EHKCWDPKDGELCLVRSKSGETLMEDRSDSDVQIDRRN 329
           EH C DPKDGEL L+R KSGETLMEDR+ SDVQID +N
Sbjct: 9   EHICCDPKDGELYLIRLKSGETLMEDRNSSDVQIDCQN 46


>UniRef50_Q652R5 Cluster: Putative uncharacterized protein
           P0603C10.50; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0603C10.50 - Oryza sativa subsp. japonica (Rice)
          Length = 248

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 24/39 (61%), Positives = 27/39 (69%)
 Frame = +1

Query: 319 PIPSSDDRFARQNRYGPPSGFPLTST*PGIVHHLSGPSI 435
           PIP SD RF RQ R+ PP  FPLTS    I+HHLSGP +
Sbjct: 38  PIPKSDKRFVRQYRFEPPLDFPLTSPRSSIIHHLSGPDM 76



 Score = 40.7 bits (91), Expect = 0.029
 Identities = 17/21 (80%), Positives = 18/21 (85%)
 Frame = +2

Query: 260 YPEGNFGRNQLLDGSISLSPL 322
           YPEGNFG NQLLDGSI L P+
Sbjct: 19  YPEGNFGGNQLLDGSIGLIPI 39


>UniRef50_UPI0000F2EBE7 Cluster: PREDICTED: similar to COL5A2
           protein; n=9; Monodelphis domestica|Rep: PREDICTED:
           similar to COL5A2 protein - Monodelphis domestica
          Length = 774

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 21/27 (77%), Positives = 22/27 (81%)
 Frame = +1

Query: 334 DDRFARQNRYGPPSGFPLTST*PGIVH 414
           DDRFARQ+RYGPP  FPL S  PGIVH
Sbjct: 20  DDRFARQDRYGPPPEFPLASPCPGIVH 46


>UniRef50_Q7RN94 Cluster: Putative uncharacterized protein PY01927;
           n=2; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY01927 - Plasmodium yoelii yoelii
          Length = 193

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 44/120 (36%), Positives = 59/120 (49%), Gaps = 4/120 (3%)
 Frame = +2

Query: 59  GSSHSASSAYQNWPTWHRHQISGFIVR-VSRSSHPFKV*E*VEVV--SAPM-PLIIRFTG 226
           G+S  ASSAYQ WPT    + S FI+R +    +P      + +   + P+ PLII  T 
Sbjct: 93  GASLIASSAYQKWPT----RSSLFIMRKLQLRYYPMLRIGSLRIGQWNVPLGPLIIISTS 148

Query: 227 *DCFKILYRPSYPEGNFGRNQLLDGSISLSPLYPVPTIDLHVRIATVLHQGFP*LRPDQA 406
                          +F  NQL+  SISLSPL  +   DLHV I ++LHQ F  L+   A
Sbjct: 149 ---------------SFENNQLIGFSISLSPLNVIEMNDLHVSINSILHQAFTRLQSHHA 193


>UniRef50_A3LSK3 Cluster: Predicted protein; n=7; Fungi/Metazoa
           group|Rep: Predicted protein - Pichia stipitis (Yeast)
          Length = 94

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 17/23 (73%), Positives = 17/23 (73%)
 Frame = +2

Query: 35  FRRLNTTFGSSHSASSAYQNWPT 103
           FR  N TFGSS  ASSAYQ WPT
Sbjct: 38  FRHFNFTFGSSRIASSAYQKWPT 60



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 25/67 (37%), Positives = 32/67 (47%)
 Frame = +3

Query: 6   TPFMVSHERFLGALTLRLVHPTAPVLLTKIGPLGTVIRSPASSFE*AGVLTHLKFENRLR 185
           TPF+VS ER                   +  P  +       S +  G+LT+LKFENRLR
Sbjct: 28  TPFVVSDERVFRHFNFTFGSSRIASSAYQKWPTKSSSFICPRSIKQQGLLTYLKFENRLR 87

Query: 186 SFRPQCL 206
           SF+PQ L
Sbjct: 88  SFQPQDL 94


>UniRef50_Q7RAD4 Cluster: Putative uncharacterized protein PY06566;
           n=3; cellular organisms|Rep: Putative uncharacterized
           protein PY06566 - Plasmodium yoelii yoelii
          Length = 114

 Score = 36.7 bits (81), Expect = 0.47
 Identities = 17/31 (54%), Positives = 18/31 (58%)
 Frame = +2

Query: 35  FRRLNTTFGSSHSASSAYQNWPTWHRHQISG 127
           FR L    G+S  ASSAYQ WPTW     SG
Sbjct: 8   FRHLIQALGASLIASSAYQKWPTWSYFIYSG 38



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 263 PEGNFGRNQLLDGSISLSPLYPVPTIDLHV 352
           PE +F  NQL+  SISLSPL  +   DLHV
Sbjct: 45  PERSFENNQLIGFSISLSPLNVIEMNDLHV 74


>UniRef50_Q7R7A3 Cluster: Putative uncharacterized protein PY07685;
           n=1; Plasmodium yoelii yoelii|Rep: Putative
           uncharacterized protein PY07685 - Plasmodium yoelii
           yoelii
          Length = 178

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 4/82 (4%)
 Frame = +1

Query: 268 GKLRTEPATRWFD*SFAPIPSS-DDRF---ARQNRYGPPSGFPLTST*PGIVHHLSGPSI 435
           G+    PA +  D     +P++ DDRF    R  R   P  FP     PG+ H  +GP  
Sbjct: 71  GRGERTPARQGQDQRQGDVPAAGDDRFHDPRRTVRPRHPQPFPQAPYHPGLGHRGAGPEP 130

Query: 436 CAQSAPSFTDWKRDASGVRNHE 501
            AQ+A +  +   +A G ++HE
Sbjct: 131 HAQTARADAENDEEAQGRQHHE 152


>UniRef50_Q9RXX4 Cluster: Putative uncharacterized protein; n=1;
           Deinococcus radiodurans|Rep: Putative uncharacterized
           protein - Deinococcus radiodurans
          Length = 122

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 18/53 (33%), Positives = 26/53 (49%)
 Frame = -1

Query: 184 LNLFSNFKWVRTPAYSNDEAGDLMTVPSGPILVSRTGAVG*TKRSVKAPKKRS 26
           L+L+ N KW RTP  SN   G+     + P +     +VG +K  V+  K  S
Sbjct: 5   LSLYQNPKWSRTPTVSNTGKGETQLQRASPKVTPFISSVGSSKSQVRQYKSFS 57


>UniRef50_Q6QIS8 Cluster: Tail sheath protein gp18; n=1; Klebsiella
           phage KPP95|Rep: Tail sheath protein gp18 - Klebsiella
           phage KPP95
          Length = 657

 Score = 32.7 bits (71), Expect = 7.6
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = -1

Query: 205 RHWGRNDLNLFSNFKWVRTPAYSNDEAGDLMTVPSGPILVSRTGAV 68
           R   +N   L  N +W  T A SN E GD +TV     +V  TG+V
Sbjct: 86  REAAKNASPLVDNIEWTITTAGSNYEVGDKITVKYADQVVDDTGSV 131


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 656,828,643
Number of Sequences: 1657284
Number of extensions: 13781304
Number of successful extensions: 28968
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 28159
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28966
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 47296372782
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).