SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0067
         (605 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes ...    63   4e-09
UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: ...    48   2e-04
UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;...    42   0.015
UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513...    39   0.080
UniRef50_A0PLJ5 Cluster: Putative uncharacterized protein; n=1; ...    37   0.43 
UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|...    36   0.74 
UniRef50_Q5DDG7 Cluster: SJCHGC07011 protein; n=1; Schistosoma j...    36   0.98 
UniRef50_A5P028 Cluster: Putative uncharacterized protein; n=1; ...    34   2.3  
UniRef50_O60079 Cluster: Probable ubiquitin carboxyl-terminal hy...    33   4.0  
UniRef50_P32483 Cluster: Para-aminobenzoate synthase; n=11; Bact...    33   4.0  
UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; ...    33   5.2  
UniRef50_A1FX86 Cluster: Putative uncharacterized protein; n=1; ...    33   6.9  
UniRef50_A2D9Z7 Cluster: Putative uncharacterized protein; n=1; ...    33   6.9  
UniRef50_Q4WNB0 Cluster: Von Willebrand and RING finger domain p...    33   6.9  
UniRef50_UPI0000EBCF0D Cluster: PREDICTED: hypothetical protein;...    32   9.2  
UniRef50_UPI0000E4A253 Cluster: PREDICTED: similar to Vacuolar p...    32   9.2  

>UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes
           scapularis|Rep: Putative secreted protein - Ixodes
           scapularis (Black-legged tick) (Deer tick)
          Length = 65

 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 30/53 (56%), Positives = 35/53 (66%)
 Frame = +3

Query: 33  PY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSDGMSAFIRSKPI 191
           P  G+TANGS+ Q WFLRS+  TWITV ILELIHA+         AFIR + I
Sbjct: 2   PKQGETANGSLNQLWFLRSFLPTWITVAILELIHAVSPKPLGATGAFIRPRSI 54


>UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep:
           LRRG00114 - Rattus norvegicus (Rat)
          Length = 223

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -2

Query: 412 LLPSLDVVAVSQAPSPESNPDSP 344
           LLPSLDVVAVSQAPSPE NPDSP
Sbjct: 167 LLPSLDVVAVSQAPSPELNPDSP 189


>UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;
           n=2; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 508

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 19/31 (61%), Positives = 20/31 (64%)
 Frame = +2

Query: 98  YLDNCGNSRANTCNQNSDQ*WDECFY*IKTN 190
           YLDNCGNSRANTC +      D C Y  KTN
Sbjct: 468 YLDNCGNSRANTCRRAPTS-GDACIYQTKTN 497


>UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130;
           n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY05130 - Plasmodium yoelii yoelii
          Length = 402

 Score = 39.1 bits (87), Expect = 0.080
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = -2

Query: 391 VAVSQAPSPESNPDSPLPVTTMVVAETTIES 299
           +A+SQAPSPESN +SPLPV  M+     I+S
Sbjct: 372 LAISQAPSPESNSNSPLPVKAMLGQYPNIKS 402


>UniRef50_A0PLJ5 Cluster: Putative uncharacterized protein; n=1;
           Mycobacterium ulcerans Agy99|Rep: Putative
           uncharacterized protein - Mycobacterium ulcerans (strain
           Agy99)
          Length = 478

 Score = 36.7 bits (81), Expect = 0.43
 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 4/58 (6%)
 Frame = +1

Query: 328 WLSR----VTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHAD 489
           WL R    V  N G  P+R P +  P P  A  A   +    S   + GPLG   +AD
Sbjct: 229 WLRRHETYVRANSGKPPDRPPPRPKPQPNPARPAWTAYDTFSSLGDITGPLGMLRYAD 286


>UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus
           tropicalis|Rep: Novel protein - Xenopus tropicalis
           (Western clawed frog) (Silurana tropicalis)
          Length = 118

 Score = 35.9 bits (79), Expect = 0.74
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +2

Query: 284 MSALSTFDGSFCDYHG 331
           MSALSTFDG+FC YHG
Sbjct: 1   MSALSTFDGTFCAYHG 16


>UniRef50_Q5DDG7 Cluster: SJCHGC07011 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC07011 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 101

 Score = 35.5 bits (78), Expect = 0.98
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +2

Query: 101 LDNCGNSRANTCNQNSDQ*WDECFY*IKTNRRRASRPKSLILMNLDNFCRSLVKYR 268
           +DNC NSRANTC ++  +     F   +TNR +       +  ++D  C +++  R
Sbjct: 1   MDNCSNSRANTCLESLTRKGTGAFIRTETNRVQRLMTSVPVTSSVDELCDNVILSR 56


>UniRef50_A5P028 Cluster: Putative uncharacterized protein; n=1;
           Methylobacterium sp. 4-46|Rep: Putative uncharacterized
           protein - Methylobacterium sp. 4-46
          Length = 494

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +1

Query: 346 GNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSG-LPGPLGQGEHA 486
           G  GS    EP++       AAGA+   S  G+ +G LPG  G+G+HA
Sbjct: 441 GRAGSGRPAEPDRAARRAASAAGAEAVPSPLGAETGRLPGRFGRGDHA 488


>UniRef50_O60079 Cluster: Probable ubiquitin carboxyl-terminal
           hydrolase 12; n=1; Schizosaccharomyces pombe|Rep:
           Probable ubiquitin carboxyl-terminal hydrolase 12 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 979

 Score = 33.5 bits (73), Expect = 4.0
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
 Frame = +1

Query: 205 ASEVVNFDESG*LLQIAGQVPATHLSNVCLINFRW*F---LRLPWLSRVTGNQGSIPERE 375
           + E+++F E    L   G   +  L   C+IN  W     LRL +L +   NQ S  E++
Sbjct: 243 SKEIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEEQK 302

Query: 376 PEKRLP 393
            EKR+P
Sbjct: 303 QEKRVP 308


>UniRef50_P32483 Cluster: Para-aminobenzoate synthase; n=11;
           Bacteria|Rep: Para-aminobenzoate synthase - Streptomyces
           griseus
          Length = 723

 Score = 33.5 bits (73), Expect = 4.0
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 1/51 (1%)
 Frame = +1

Query: 319 RLPWLSRVTGNQG-SIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPL 468
           RLP L    G+QG ++       R P PR    + + H   G F GLP PL
Sbjct: 75  RLPVLGVCLGHQGMALAHGARVGRAPEPRHGRTSAVRHDGTGLFEGLPQPL 125


>UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1;
           Roseovarius sp. HTCC2601|Rep: Putative uncharacterized
           protein - Roseovarius sp. HTCC2601
          Length = 507

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 16/40 (40%), Positives = 24/40 (60%)
 Frame = +3

Query: 90  YSVTWITVVILELIHAIRTLTSDGMSAFIRSKPIDGGPRV 209
           YS T + VV+ EL+    T+ SD  +A I + P+DG  R+
Sbjct: 139 YSATSMAVVLSELVVDDETIPSDNAAAQISAGPVDGETRI 178


>UniRef50_A1FX86 Cluster: Putative uncharacterized protein; n=1;
           Stenotrophomonas maltophilia R551-3|Rep: Putative
           uncharacterized protein - Stenotrophomonas maltophilia
           R551-3
          Length = 1258

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +1

Query: 397 PRKAAGAQITHSRHGSFSGLPGPLGQGEHAD 489
           P++AAG ++T    G+  G P  LGQG+ AD
Sbjct: 667 PKRAAGGRLTVHSSGNHPGQPVGLGQGDQAD 697


>UniRef50_A2D9Z7 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 872

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = -2

Query: 409 LPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES**GRHLKD 275
           +PSL  V++SQ   P+  P +PLP    +++E   E   G  + D
Sbjct: 67  IPSLPPVSISQTIKPQIIPQNPLPTMNHIISEPLDEPASGEEMAD 111


>UniRef50_Q4WNB0 Cluster: Von Willebrand and RING finger domain
           protein; n=7; Pezizomycotina|Rep: Von Willebrand and
           RING finger domain protein - Aspergillus fumigatus
           (Sartorya fumigata)
          Length = 1037

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 28/90 (31%), Positives = 41/90 (45%)
 Frame = +1

Query: 334 SRVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHADSFSVARGG 513
           SR TGN GS  ERE  +R+       G++  HSR+GS +G  G       A   S  R  
Sbjct: 168 SRDTGNAGSHRERERVERM-----TTGSRQQHSRNGSAAGSSGEY----DAQQQSNGRRH 218

Query: 514 PGHLRASQTCYCSISCGSKTPVPLRRILIR 603
              ++A ++     +   K P+P   + IR
Sbjct: 219 DYDVQAMESDLSPRAAPMKNPIPAPTVTIR 248


>UniRef50_UPI0000EBCF0D Cluster: PREDICTED: hypothetical protein;
           n=1; Bos taurus|Rep: PREDICTED: hypothetical protein -
           Bos taurus
          Length = 217

 Score = 32.3 bits (70), Expect = 9.2
 Identities = 25/83 (30%), Positives = 32/83 (38%), Gaps = 2/83 (2%)
 Frame = +1

Query: 346 GNQGSI-PEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQ-GEHADSFSVARGGPG 519
           G QG + P  + E    HPR +A A  T    G F G P   G    H     +    P 
Sbjct: 23  GPQGRVSPRVQAEGTQRHPRGSAAADKTKQDWGQFEGRPENTGSIPGHTPGRPLTPPAPT 82

Query: 520 HLRASQTCYCSISCGSKTPVPLR 588
              A +TC  +    S  P P+R
Sbjct: 83  ARLAPRTCSGAGEMASSPPGPVR 105


>UniRef50_UPI0000E4A253 Cluster: PREDICTED: similar to Vacuolar
           protein sorting protein 36 (ELL-associated protein of 45
           kDa), partial; n=3; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Vacuolar protein sorting protein
           36 (ELL-associated protein of 45 kDa), partial -
           Strongylocentrotus purpuratus
          Length = 349

 Score = 32.3 bits (70), Expect = 9.2
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = -1

Query: 347 PVTRDNHGSRRNYHRKLIRQTFERCVA 267
           PVTR+ HGS   YH +L +Q  E  +A
Sbjct: 190 PVTRETHGSGLKYHEELAKQLSEALIA 216


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 622,490,766
Number of Sequences: 1657284
Number of extensions: 13444981
Number of successful extensions: 38948
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 36797
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38926
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 43147568152
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).