SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0038
         (703 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q09JM0 Cluster: 10 kDa putative secreted protein; n=1; ...   107   3e-22
UniRef50_A3LSK3 Cluster: Predicted protein; n=7; Fungi/Metazoa g...    56   1e-06
UniRef50_Q7RFQ2 Cluster: Putative uncharacterized protein PY0465...    52   1e-05
UniRef50_Q7RN94 Cluster: Putative uncharacterized protein PY0192...    46   0.001
UniRef50_Q5C0F6 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_Q652R5 Cluster: Putative uncharacterized protein P0603C...    40   0.059
UniRef50_UPI000155D43F Cluster: PREDICTED: similar to Phosphatid...    39   0.14 
UniRef50_Q7RAD4 Cluster: Putative uncharacterized protein PY0656...    37   0.55 
UniRef50_Q6IND9 Cluster: MGC81165 protein; n=4; Xenopus|Rep: MGC...    36   0.73 
UniRef50_UPI0000D99A8A Cluster: PREDICTED: hypothetical protein;...    36   0.96 
UniRef50_UPI0000660B21 Cluster: Homolog of Brachydanio rerio "E-...    35   2.2  
UniRef50_UPI0000660666 Cluster: Homolog of Brachydanio rerio "E-...    35   2.2  
UniRef50_A0A3F1 Cluster: Putative uncharacterized protein; n=1; ...    34   3.9  
UniRef50_Q17063 Cluster: Hemolysin; n=2; Eukaryota|Rep: Hemolysi...    34   3.9  
UniRef50_UPI0000EBC37A Cluster: PREDICTED: hypothetical protein;...    33   5.1  
UniRef50_O74871 Cluster: Uncharacterized protein C31H12.03c; n=1...    33   5.1  
UniRef50_UPI000023E947 Cluster: hypothetical protein FG09317.1; ...    33   6.8  
UniRef50_Q74FZ7 Cluster: Rare lipoprotein A domain protein; n=2;...    33   6.8  
UniRef50_Q7SFZ9 Cluster: Putative uncharacterized protein NCU026...    33   6.8  
UniRef50_UPI000069F44B Cluster: Mastermind-like protein 2 (Mam-2...    33   9.0  
UniRef50_Q5T253 Cluster: OTTHUMP00000017000; n=19; Euteleostomi|...    33   9.0  

>UniRef50_Q09JM0 Cluster: 10 kDa putative secreted protein; n=1;
           Argas monolakensis|Rep: 10 kDa putative secreted protein
           - Argas monolakensis
          Length = 102

 Score =  107 bits (257), Expect = 3e-22
 Identities = 60/106 (56%), Positives = 66/106 (62%)
 Frame = -3

Query: 368 MGHHERRWSLMTAGRWPWKSESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF* 189
           M  HE  W L TAGRWPWK ESAKEC TTHLPKQ A K         +     R +L++ 
Sbjct: 1   MRSHEGCWLLRTAGRWPWKLESAKECVTTHLPKQLAPKMDGAIASNLSQAAAGRRVLSY- 59

Query: 188 FGIIKP*RVGRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED 51
               KP RVG  +R A K  GVSP GA+ GADLGGSSKYSSE LED
Sbjct: 60  ---CKPQRVGGPQRCALKVSGVSPPGAAAGADLGGSSKYSSETLED 102


>UniRef50_A3LSK3 Cluster: Predicted protein; n=7; Fungi/Metazoa
           group|Rep: Predicted protein - Pichia stipitis (Yeast)
          Length = 94

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 30/57 (52%), Positives = 33/57 (57%)
 Frame = +2

Query: 377 FRRLNTTFGSSHSASSAYQNWPTWHRHQISGFIVRVSRSSHPFKFENRLRSFRPQCL 547
           FR  N TFGSS  ASSAYQ WPT     I    ++        KFENRLRSF+PQ L
Sbjct: 38  FRHFNFTFGSSRIASSAYQKWPTKSSSFICPRSIKQQGLLTYLKFENRLRSFQPQDL 94



 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 24/35 (68%), Positives = 27/35 (77%)
 Frame = +3

Query: 270 LRQVSRCTLLSGFRLPWPPSCCHERPTPFMVSHER 374
           +R VS  TLLSGFRLPWPPS C +  TPF+VS ER
Sbjct: 2   IRPVSCYTLLSGFRLPWPPSGCLDELTPFVVSDER 36


>UniRef50_Q7RFQ2 Cluster: Putative uncharacterized protein PY04653;
           n=2; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY04653 - Plasmodium yoelii yoelii
          Length = 124

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 21/28 (75%), Positives = 23/28 (82%)
 Frame = -3

Query: 338 MTAGRWPWKSESAKECATTHLPKQPALK 255
           MT GRW WKS+SAKEC TTHLP + ALK
Sbjct: 1   MTVGRWSWKSKSAKECVTTHLPNELALK 28



 Score = 32.7 bits (71), Expect = 9.0
 Identities = 17/31 (54%), Positives = 21/31 (67%)
 Frame = -1

Query: 100 VQILVVVANTPARPWRTDVEKGFA*TVVARE 8
           VQILV VA    R  +T+VEKGF  TV+ +E
Sbjct: 83  VQILVEVAIIQMRTLKTEVEKGFLSTVIVQE 113


>UniRef50_Q7RN94 Cluster: Putative uncharacterized protein PY01927;
           n=2; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY01927 - Plasmodium yoelii yoelii
          Length = 193

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 32/63 (50%), Positives = 33/63 (52%)
 Frame = +2

Query: 257 SGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHGVP*AFFRRLNTTFGSSHSASSAYQN 436
           SGLV S GE LHTP RI TSM TVLL                 L    G+S  ASSAYQ 
Sbjct: 61  SGLVHSVGELLHTPWRISTSMITVLL----------------HLIQALGASLIASSAYQK 104

Query: 437 WPT 445
           WPT
Sbjct: 105 WPT 107


>UniRef50_Q5C0F6 Cluster: Putative uncharacterized protein; n=1;
           Schistosoma japonicum|Rep: Putative uncharacterized
           protein - Schistosoma japonicum (Blood fluke)
          Length = 102

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/19 (94%), Positives = 18/19 (94%)
 Frame = -2

Query: 660 GERLIEPSSSWFRPKFPSG 604
           GERLIEPSSSWF PKFPSG
Sbjct: 84  GERLIEPSSSWFPPKFPSG 102


>UniRef50_Q652R5 Cluster: Putative uncharacterized protein
           P0603C10.50; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0603C10.50 - Oryza sativa subsp. japonica (Rice)
          Length = 248

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 17/20 (85%), Positives = 17/20 (85%)
 Frame = +2

Query: 602 YPEGNFGRNQLLDGSISLSP 661
           YPEGNFG NQLLDGSI L P
Sbjct: 19  YPEGNFGGNQLLDGSIGLIP 38


>UniRef50_UPI000155D43F Cluster: PREDICTED: similar to
           Phosphatidylinositol glycan anchor biosynthesis, class
           F, partial; n=1; Ornithorhynchus anatinus|Rep:
           PREDICTED: similar to Phosphatidylinositol glycan anchor
           biosynthesis, class F, partial - Ornithorhynchus
           anatinus
          Length = 403

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 18/28 (64%), Positives = 21/28 (75%)
 Frame = -1

Query: 121 ARLEPPSVQILVVVANTPARPWRTDVEK 38
           AR+EPP VQILVVVAN   R  + +VEK
Sbjct: 28  ARVEPPQVQILVVVANIQTRALKAEVEK 55


>UniRef50_Q7RAD4 Cluster: Putative uncharacterized protein PY06566;
           n=3; cellular organisms|Rep: Putative uncharacterized
           protein PY06566 - Plasmodium yoelii yoelii
          Length = 114

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 17/31 (54%), Positives = 18/31 (58%)
 Frame = +2

Query: 377 FRRLNTTFGSSHSASSAYQNWPTWHRHQISG 469
           FR L    G+S  ASSAYQ WPTW     SG
Sbjct: 8   FRHLIQALGASLIASSAYQKWPTWSYFIYSG 38


>UniRef50_Q6IND9 Cluster: MGC81165 protein; n=4; Xenopus|Rep:
           MGC81165 protein - Xenopus laevis (African clawed frog)
          Length = 327

 Score = 36.3 bits (80), Expect = 0.73
 Identities = 17/49 (34%), Positives = 24/49 (48%)
 Frame = -2

Query: 294 VCNDSPAEATSPEMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCAT 148
           V    PA+  +P+      +C   ++TG C A F  WY+   TS  CAT
Sbjct: 181 VSKPEPAKVQAPKTGSYSEYCAAPSLTGPCRASFSRWYY-DTTSGQCAT 228



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 17/49 (34%), Positives = 24/49 (48%)
 Frame = -2

Query: 294 VCNDSPAEATSPEMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCAT 148
           V    PA+  +P+      +C   ++TG C A F  WY+   TS  CAT
Sbjct: 90  VSKPEPAKVQAPKTVSYSEYCAAPSLTGPCRASFSRWYY-DTTSGQCAT 137


>UniRef50_UPI0000D99A8A Cluster: PREDICTED: hypothetical protein;
           n=1; Macaca mulatta|Rep: PREDICTED: hypothetical protein
           - Macaca mulatta
          Length = 86

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 16/28 (57%), Positives = 19/28 (67%)
 Frame = -1

Query: 118 RLEPPSVQILVVVANTPARPWRTDVEKG 35
           R EPP VQILV+V N   R  + +VEKG
Sbjct: 57  RAEPPQVQILVIVVNIQRRTSKAEVEKG 84


>UniRef50_UPI0000660B21 Cluster: Homolog of Brachydanio rerio
           "E-cadherin.; n=1; Takifugu rubripes|Rep: Homolog of
           Brachydanio rerio "E-cadherin. - Takifugu rubripes
          Length = 925

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = -2

Query: 327 TVAMEVGIR*GVCNDSPAEATSPEMDGAEAFCLYTTVTGT 208
           TV + V  R G+  DS  +AT  +  GAE  C+Y   TGT
Sbjct: 798 TVVLSVSDRQGLEQDSTVQATVCDCTGAEVQCIYCVATGT 837


>UniRef50_UPI0000660666 Cluster: Homolog of Brachydanio rerio
           "E-cadherin.; n=1; Takifugu rubripes|Rep: Homolog of
           Brachydanio rerio "E-cadherin. - Takifugu rubripes
          Length = 694

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = -2

Query: 327 TVAMEVGIR*GVCNDSPAEATSPEMDGAEAFCLYTTVTGT 208
           TV + V  R G+  DS  +AT  +  GAE  C+Y   TGT
Sbjct: 561 TVVLSVSDRHGLEQDSTVQATVCDCTGAEVQCIYCVATGT 600


>UniRef50_A0A3F1 Cluster: Putative uncharacterized protein; n=1;
           Lactobacillus salivarius subsp. salivarius UCC118|Rep:
           Putative uncharacterized protein - Lactobacillus
           salivarius subsp. salivarius (strain UCC118)
          Length = 305

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 31/97 (31%), Positives = 45/97 (46%), Gaps = 3/97 (3%)
 Frame = +2

Query: 383 RLNTTFGSSHSASSAYQNWPTWHRHQISG-FIVRVSRSSHPFKFENRLRSFRPQCL*SFA 559
           +LN+   ++  A  A    P  + HQ  G  IV         + +N+ R++ P    SFA
Sbjct: 37  KLNSEI-TTQKAQLANGQLPKANTHQSDGKTIVSSGTMVLTNQDQNKNRNYLPWM--SFA 93

Query: 560 LPDETV--LKFYIDASYPEGNFGRNQLLDGSISLSPY 664
              ETV  LK++I   Y +GNF     LD    L+PY
Sbjct: 94  ATPETVTTLKYHIGEDYYDGNFRFTFYLDSIEGLAPY 130


>UniRef50_Q17063 Cluster: Hemolysin; n=2; Eukaryota|Rep: Hemolysin -
           Acanthamoeba polyphaga (Amoeba)
          Length = 114

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 20/38 (52%), Positives = 23/38 (60%), Gaps = 2/38 (5%)
 Frame = +1

Query: 19  LLFTRNPSPRQSSRA--SLEYLLLPPRSAPTEAPSGLT 126
           +LFT N SP + S+   S EYLLLPPRSA       LT
Sbjct: 1   MLFTWNLSPLRPSKLCDSFEYLLLPPRSALGSVRPALT 38


>UniRef50_UPI0000EBC37A Cluster: PREDICTED: hypothetical protein;
           n=1; Bos taurus|Rep: PREDICTED: hypothetical protein -
           Bos taurus
          Length = 139

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = -3

Query: 161 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEG 36
           G+ARR  Q     +P G  +G  LGG +  S E++ED RG G
Sbjct: 52  GKARRTRQAARR-APSGPDLGPGLGGEAAGSGESVEDERGRG 92


>UniRef50_O74871 Cluster: Uncharacterized protein C31H12.03c; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C31H12.03c - Schizosaccharomyces pombe (Fission yeast)
          Length = 245

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +1

Query: 28  TRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALR-RARPTRYGLMIPN 189
           ++NP  R +SR+       PP+SAP++  S +   P  A + R R  R+G+   N
Sbjct: 191 SKNPQNRSNSRSKQRNKNAPPKSAPSKRKSNILDDPIEAEKARKRAERFGVAAKN 245


>UniRef50_UPI000023E947 Cluster: hypothetical protein FG09317.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG09317.1 - Gibberella zeae PH-1
          Length = 291

 Score = 33.1 bits (72), Expect = 6.8
 Identities = 22/75 (29%), Positives = 34/75 (45%)
 Frame = -1

Query: 550 LEALGPKRPQPILKFKWVRTPAYSNDEAGDLMTVPSGPILVSRTGAVG*TKRSVKAPKKR 371
           ++AL P  P  +     +  P YS+ +AGDL  V        R G +   + + +   KR
Sbjct: 178 VKALPPSTPLTLTTMSAISKPRYSSIQAGDLSPVR------RRLGLINYVRDTKEENAKR 231

Query: 370 SWDTMKGVGRS*QQD 326
           SW   + VG+   QD
Sbjct: 232 SWYMFRAVGKFYIQD 246


>UniRef50_Q74FZ7 Cluster: Rare lipoprotein A domain protein; n=2;
           Geobacter|Rep: Rare lipoprotein A domain protein -
           Geobacter sulfurreducens
          Length = 150

 Score = 33.1 bits (72), Expect = 6.8
 Identities = 18/48 (37%), Positives = 24/48 (50%)
 Frame = +2

Query: 80  YYHQDLHRRRLQAGSRPDPSALSVAHVLLVTA**YQIKNLASHVPVTV 223
           YY +  H RR  +G R DP  L+ AH  L      ++ NL +   VTV
Sbjct: 59  YYAKRYHGRRTTSGKRYDPKKLTAAHPTLPLGTKVKVVNLTNDREVTV 106


>UniRef50_Q7SFZ9 Cluster: Putative uncharacterized protein
           NCU02621.1; n=2; Sordariales|Rep: Putative
           uncharacterized protein NCU02621.1 - Neurospora crassa
          Length = 709

 Score = 33.1 bits (72), Expect = 6.8
 Identities = 16/34 (47%), Positives = 19/34 (55%)
 Frame = +1

Query: 31  RNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPR 132
           RNPSP  S+  S   LL P   +P+  P  LTPR
Sbjct: 47  RNPSPSDSTTDSPSSLLHPSSPSPSPTPQPLTPR 80


>UniRef50_UPI000069F44B Cluster: Mastermind-like protein 2 (Mam-2).;
           n=1; Xenopus tropicalis|Rep: Mastermind-like protein 2
           (Mam-2). - Xenopus tropicalis
          Length = 1062

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 88  PRSAPTEAPSGLTPRPFCALRRARPTRYGLMIPN 189
           P S PT +P+GL+PRPF  ++   P R+  + P+
Sbjct: 416 PSSWPTMSPTGLSPRPFGDVKVPSPFRHQQLSPH 449


>UniRef50_Q5T253 Cluster: OTTHUMP00000017000; n=19;
           Euteleostomi|Rep: OTTHUMP00000017000 - Homo sapiens
           (Human)
          Length = 366

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 18/44 (40%), Positives = 22/44 (50%)
 Frame = +1

Query: 43  PRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALRRARPTRYG 174
           PR +SR  + Y+    R+ P    SG TP P C   R RP R G
Sbjct: 65  PRGASRRQVTYVRSGRRAPPGGGGSG-TPEPGCCAPRGRPRRKG 107


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 764,738,097
Number of Sequences: 1657284
Number of extensions: 16849661
Number of successful extensions: 47132
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 44697
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47094
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55785129165
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).