SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0032
         (636 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B5274 Cluster: PREDICTED: similar to ENSANGP000...   163   2e-39
UniRef50_UPI000051A740 Cluster: PREDICTED: similar to atlastin C...   161   1e-38
UniRef50_Q9BMU4 Cluster: Putative guanylate-binding protein; n=3...   146   3e-34
UniRef50_Q8NHH9 Cluster: Atlastin-2; n=122; Eumetazoa|Rep: Atlas...   141   1e-32
UniRef50_UPI0000F2DAB7 Cluster: PREDICTED: similar to RIKEN cDNA...   141   1e-32
UniRef50_Q4REF5 Cluster: Chromosome 10 SCAF15123, whole genome s...   134   1e-30
UniRef50_Q4RP94 Cluster: Chromosome 1 SCAF15008, whole genome sh...   100   1e-28
UniRef50_UPI0000D56A7A Cluster: PREDICTED: similar to CG6668-PA,...   119   7e-26
UniRef50_UPI00015A3DBD Cluster: ADP-ribosylation factor-like 6 i...   108   1e-22
UniRef50_O62433 Cluster: Putative uncharacterized protein; n=2; ...   106   4e-22
UniRef50_UPI0001554FFF Cluster: PREDICTED: similar to zinc finge...    78   2e-13
UniRef50_UPI0001554E6D Cluster: PREDICTED: similar to zinc finge...    75   2e-12
UniRef50_UPI00015B48CD Cluster: PREDICTED: similar to karyopheri...    74   3e-12
UniRef50_Q2VPQ0 Cluster: LOC432253 protein; n=6; Xenopus|Rep: LO...    74   3e-12
UniRef50_UPI00006A0E2B Cluster: UPI00006A0E2B related cluster; n...    69   7e-11
UniRef50_UPI00006A0E29 Cluster: Zinc finger protein 179 (Brain f...    69   9e-11
UniRef50_UPI0000F2DA65 Cluster: PREDICTED: similar to zinc finge...    64   2e-09
UniRef50_UPI0001554E35 Cluster: PREDICTED: similar to brain fing...    64   3e-09
UniRef50_A7SNS4 Cluster: Predicted protein; n=1; Nematostella ve...    59   1e-07
UniRef50_O70418 Cluster: Zinc finger protein 179; n=12; Eutheria...    55   2e-06
UniRef50_Q9ULX5 Cluster: Zinc finger protein 179; n=9; Eutheria|...    55   2e-06
UniRef50_Q0D863 Cluster: Os07g0181700 protein; n=6; Oryza sativa...    53   7e-06
UniRef50_A2YIT0 Cluster: Putative uncharacterized protein; n=2; ...    53   7e-06
UniRef50_Q9D873 Cluster: Adult male small intestine cDNA, RIKEN ...    49   8e-05
UniRef50_A2Y7G2 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_Q54TN9 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_A0D4V9 Cluster: Chromosome undetermined scaffold_38, wh...    45   0.002
UniRef50_Q2V6D6 Cluster: Guanylate binding protein 8; n=2; Mus m...    44   0.003
UniRef50_Q66J21 Cluster: MGC82824 protein; n=3; Xenopus|Rep: MGC...    43   0.005
UniRef50_A0BIV5 Cluster: Chromosome undetermined scaffold_11, wh...    43   0.005
UniRef50_UPI0000EBE8A3 Cluster: PREDICTED: hypothetical protein;...    43   0.007
UniRef50_Q238R8 Cluster: Guanylate-binding protein, N-terminal d...    43   0.007
UniRef50_UPI0000E8244A Cluster: PREDICTED: similar to guanylate ...    42   0.009
UniRef50_Q0V7P3 Cluster: Guanylate binding protein family, membe...    42   0.009
UniRef50_A0CCI6 Cluster: Chromosome undetermined scaffold_167, w...    42   0.012
UniRef50_Q96PP9 Cluster: Guanylate-binding protein 4; n=70; Mamm...    42   0.012
UniRef50_UPI00006CEB57 Cluster: Guanylate-binding protein, N-ter...    42   0.016
UniRef50_A0BP55 Cluster: Chromosome undetermined scaffold_12, wh...    42   0.016
UniRef50_A0DQT8 Cluster: Chromosome undetermined scaffold_6, who...    41   0.022
UniRef50_Q8CFB4 Cluster: Guanylate-binding protein 5; n=17; Euth...    41   0.022
UniRef50_UPI0000F1FCFA Cluster: PREDICTED: similar to LOC446944 ...    41   0.029
UniRef50_Q5BKG3 Cluster: MGC108424 protein; n=3; Xenopus|Rep: MG...    40   0.050
UniRef50_UPI000155BFFE Cluster: PREDICTED: hypothetical protein;...    40   0.066
UniRef50_A2VD69 Cluster: LOC100037176 protein; n=12; Xenopus|Rep...    40   0.066
UniRef50_A3A5Z0 Cluster: Putative uncharacterized protein; n=2; ...    40   0.066
UniRef50_A0DE81 Cluster: Chromosome undetermined scaffold_47, wh...    40   0.066
UniRef50_Q24F54 Cluster: Guanylate-binding protein, N-terminal d...    39   0.088
UniRef50_UPI0000D99A1D Cluster: PREDICTED: guanylate binding pro...    38   0.15 
UniRef50_Q6BGA8 Cluster: Guanylate-binding protein, putative; n=...    38   0.15 
UniRef50_P32456 Cluster: Interferon-induced guanylate-binding pr...    38   0.15 
UniRef50_Q6DHP7 Cluster: Zgc:92185; n=22; cellular organisms|Rep...    38   0.20 
UniRef50_UPI0001552CDF Cluster: PREDICTED: similar to guanylate ...    38   0.27 
UniRef50_UPI00006CAA7C Cluster: Guanylate-binding protein, N-ter...    38   0.27 
UniRef50_UPI0000F2BB21 Cluster: PREDICTED: similar to guanylate ...    37   0.35 
UniRef50_P32455 Cluster: Interferon-induced guanylate-binding pr...    36   0.62 
UniRef50_UPI0000E80E09 Cluster: PREDICTED: similar to guanylate ...    36   0.82 
UniRef50_Q9H0R5 Cluster: Guanylate-binding protein 3; n=16; Euth...    35   1.9  
UniRef50_Q90892 Cluster: Guanylate binding protein; n=10; Amniot...    34   2.5  
UniRef50_A0BW08 Cluster: Chromosome undetermined scaffold_130, w...    34   2.5  
UniRef50_A4F9C7 Cluster: Putative uncharacterized protein; n=1; ...    34   3.3  
UniRef50_Q4REF6 Cluster: Chromosome 10 SCAF15123, whole genome s...    33   4.4  
UniRef50_Q5BB13 Cluster: Putative uncharacterized protein; n=1; ...    33   5.8  
UniRef50_Q2JGL4 Cluster: ABC transporter related; n=1; Frankia s...    33   7.6  
UniRef50_Q01DQ7 Cluster: Chromosome 02 contig 1, DNA sequence; n...    33   7.6  
UniRef50_Q0D1W6 Cluster: Predicted protein; n=1; Aspergillus ter...    33   7.6  

>UniRef50_UPI00015B5274 Cluster: PREDICTED: similar to
           ENSANGP00000019861; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000019861 - Nasonia
           vitripennis
          Length = 611

 Score =  163 bits (397), Expect = 2e-39
 Identities = 76/85 (89%), Positives = 82/85 (96%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSERDTTGILMWS++F ATL +GEKVA+IL+DTQGAFDS+STVRDCATVFA
Sbjct: 155 PLGGFSWRGGSERDTTGILMWSKVFPATLANGEKVAVILMDTQGAFDSQSTVRDCATVFA 214

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTMLSSVQIYNLSQNIQEDDLQHL
Sbjct: 215 LSTMLSSVQIYNLSQNIQEDDLQHL 239



 Score =  153 bits (371), Expect = 3e-36
 Identities = 66/84 (78%), Positives = 75/84 (89%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLALE  G TPFQRLQFLVRDWS+PYEA YGA+GG +IL RRL++SD QHPELQ
Sbjct: 241 LFTEYGRLALEKSGSTPFQRLQFLVRDWSYPYEAAYGAEGGHKILKRRLEISDMQHPELQ 300

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           SLRKHI +CFS ++CFLMPHPGL+
Sbjct: 301 SLRKHIASCFSNISCFLMPHPGLR 324



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 24/27 (88%), Positives = 26/27 (96%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYKY 555
           V+SVAGAFRKGKSFLLDFFLRYM+ KY
Sbjct: 113 VVSVAGAFRKGKSFLLDFFLRYMNSKY 139


>UniRef50_UPI000051A740 Cluster: PREDICTED: similar to atlastin
           CG6668-PA, isoform A; n=1; Apis mellifera|Rep:
           PREDICTED: similar to atlastin CG6668-PA, isoform A -
           Apis mellifera
          Length = 578

 Score =  161 bits (391), Expect = 1e-38
 Identities = 72/85 (84%), Positives = 82/85 (96%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL+GFSW+GGSERDTTGILMWS++F+ TL DGE VA+IL+DTQGAFDS+STV+DCATVFA
Sbjct: 124 PLRGFSWKGGSERDTTGILMWSKVFRGTLPDGENVAVILMDTQGAFDSQSTVKDCATVFA 183

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTMLSS+QIYNLSQNIQEDDLQHL
Sbjct: 184 LSTMLSSLQIYNLSQNIQEDDLQHL 208



 Score =  155 bits (375), Expect = 1e-36
 Identities = 65/83 (78%), Positives = 78/83 (93%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLAL++ GR PFQ+LQFLVRDWS+PYEA YGA+GG +IL+RRL++SDKQHPELQ
Sbjct: 210 LFTEYGRLALQNSGRKPFQKLQFLVRDWSYPYEAKYGAEGGKEILNRRLEISDKQHPELQ 269

Query: 73  SLRKHITACFSELACFLMPHPGL 5
           SLRKHI +CFS+++CFLMPHPGL
Sbjct: 270 SLRKHIKSCFSDISCFLMPHPGL 292



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/51 (52%), Positives = 33/51 (64%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYKYXXXXXXXXXXXXXEDPSRASAGEG 483
           V+SVAGAFRKGKSFLLDFFLRYM+ KY             ++P R  + +G
Sbjct: 82  VVSVAGAFRKGKSFLLDFFLRYMNSKYNNNNQTDSWLGKEDEPLRGFSWKG 132


>UniRef50_Q9BMU4 Cluster: Putative guanylate-binding protein; n=3;
           Caenorhabditis|Rep: Putative guanylate-binding protein -
           Caenorhabditis elegans
          Length = 573

 Score =  146 bits (355), Expect = 3e-34
 Identities = 66/85 (77%), Positives = 77/85 (90%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSERDT GIL+WSE F     +GE++A++L+DTQGAFDS+STV+DCAT+FA
Sbjct: 117 PLSGFSWRGGSERDTNGILIWSEPFIMKDKNGEEIAVLLMDTQGAFDSQSTVKDCATIFA 176

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM+SSVQIYNLSQNIQEDDLQHL
Sbjct: 177 LSTMISSVQIYNLSQNIQEDDLQHL 201



 Score =  136 bits (330), Expect = 3e-31
 Identities = 59/84 (70%), Positives = 68/84 (80%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLALED    PFQ L FLVRDWSFPYEA +G  GG ++L RRL+VS+KQH ELQ
Sbjct: 203 LFTEYGRLALEDSASKPFQSLLFLVRDWSFPYEAEFGFQGGQRVLDRRLEVSEKQHAELQ 262

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
            LR+HI +CF ++ CFLMPHPGLK
Sbjct: 263 QLRQHIRSCFEDIRCFLMPHPGLK 286



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/26 (73%), Positives = 24/26 (92%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYK 558
           VI VAGA+RKGKSFLL+FFLRY+ ++
Sbjct: 69  VIGVAGAYRKGKSFLLNFFLRYLTWR 94


>UniRef50_Q8NHH9 Cluster: Atlastin-2; n=122; Eumetazoa|Rep:
           Atlastin-2 - Homo sapiens (Human)
          Length = 583

 Score =  141 bits (342), Expect = 1e-32
 Identities = 62/85 (72%), Positives = 75/85 (88%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GF+WRGG ER+TTGI +W+E+F     +G KVA++L+DTQGAFDS+ST++DCATVFA
Sbjct: 133 PLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFA 192

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM SSVQ+YNLSQNIQEDDLQHL
Sbjct: 193 LSTMTSSVQVYNLSQNIQEDDLQHL 217



 Score =  126 bits (304), Expect = 4e-28
 Identities = 54/84 (64%), Positives = 65/84 (77%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+  + PFQ L FL+RDWS+PYE  YG +GG Q L +RL+V   QH ELQ
Sbjct: 219 LFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQ 278

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI  CFS L CFL+PHPGLK
Sbjct: 279 NVRKHIHNCFSNLGCFLLPHPGLK 302



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 22/26 (84%), Positives = 24/26 (92%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYK 558
           V+SVAGAFRKGKSFLLDF LRYM+ K
Sbjct: 96  VVSVAGAFRKGKSFLLDFMLRYMYNK 121


>UniRef50_UPI0000F2DAB7 Cluster: PREDICTED: similar to RIKEN cDNA
           5730596K20 gene; n=2; Mammalia|Rep: PREDICTED: similar
           to RIKEN cDNA 5730596K20 gene - Monodelphis domestica
          Length = 693

 Score =  141 bits (341), Expect = 1e-32
 Identities = 64/85 (75%), Positives = 73/85 (85%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGS+ DTTGI +WSE+F     DG+KVA++L+DTQGAFD  STV+DCAT+FA
Sbjct: 253 PLTGFSWRGGSDPDTTGIQIWSEVFIVKKPDGKKVAVVLMDTQGAFDCHSTVKDCATIFA 312

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM SSVQIYNLSQNIQEDDLQ L
Sbjct: 313 LSTMTSSVQIYNLSQNIQEDDLQQL 337



 Score =  123 bits (296), Expect = 4e-27
 Identities = 51/83 (61%), Positives = 66/83 (79%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLAL++  + PFQ L FL+RDWSFPYE  +G  GGMQ L +RL+V ++QH E+Q
Sbjct: 339 LFTEYGRLALDEIFQKPFQTLMFLIRDWSFPYEYRFGLKGGMQFLEKRLQVKEQQHEEIQ 398

Query: 73  SLRKHITACFSELACFLMPHPGL 5
           ++R HI +CFS + CFL+PHPGL
Sbjct: 399 NVRNHIRSCFSRVTCFLLPHPGL 421



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 19/24 (79%), Positives = 23/24 (95%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMH 564
           V+SVAGAFRKGKSFLLDF LR+++
Sbjct: 213 VVSVAGAFRKGKSFLLDFMLRFLY 236


>UniRef50_Q4REF5 Cluster: Chromosome 10 SCAF15123, whole genome
           shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 10
           SCAF15123, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 589

 Score =  134 bits (325), Expect = 1e-30
 Identities = 57/84 (67%), Positives = 70/84 (83%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+    PFQ L FLVRDWSFPYE PYG +GGM+ L +RLK+S+ QH ELQ
Sbjct: 221 LFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFPYGQEGGMKFLEKRLKISENQHEELQ 280

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI +CF+ ++CFLMPHPGLK
Sbjct: 281 NVRKHIHSCFTNISCFLMPHPGLK 304



 Score =  113 bits (273), Expect = 3e-24
 Identities = 63/113 (55%), Positives = 75/113 (66%), Gaps = 28/113 (24%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSER+TTGI +WSE+F     DG KVA++L+DTQG FDS+ST+RD ATVFA
Sbjct: 107 PLTGFSWRGGSERETTGIQIWSEVFLVDKPDGRKVAVLLMDTQGTFDSQSTLRDSATVFA 166

Query: 330 LSTML-------------------SSV---------QIYNLSQNIQEDDLQHL 256
           LSTM+                   SSV         Q+YN+SQN+QEDDLQHL
Sbjct: 167 LSTMISSMQVRPLSPSSPPVRSFSSSVSDLLNPLVFQVYNISQNVQEDDLQHL 219



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/23 (82%), Positives = 22/23 (95%)
 Frame = -2

Query: 632 ISVAGAFRKGKSFLLDFFLRYMH 564
           +SVAGAFRKGKSFL+DF LRYM+
Sbjct: 71  VSVAGAFRKGKSFLMDFMLRYMY 93


>UniRef50_Q4RP94 Cluster: Chromosome 1 SCAF15008, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 1
           SCAF15008, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 579

 Score = 99.5 bits (237), Expect = 6e-20
 Identities = 51/110 (46%), Positives = 67/110 (60%), Gaps = 26/110 (23%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRR------------ 110
           LFTEYGRLA+++    PFQ L FL+RDWSFPYE PYG  GG   L +R            
Sbjct: 202 LFTEYGRLAMDEIFLKPFQSLMFLIRDWSFPYEYPYGFKGGSDFLDKRLQVPVQLRRTCQ 261

Query: 109 --------------LKVSDKQHPELQSLRKHITACFSELACFLMPHPGLK 2
                         L+V + QH ELQ++R+HI +CF++++CFL+PHPGLK
Sbjct: 262 KCLCRHVCVTLRLFLQVKENQHEELQTVREHIHSCFTKISCFLLPHPGLK 311



 Score = 93.9 bits (223), Expect(2) = 1e-28
 Identities = 42/52 (80%), Positives = 50/52 (96%)
 Frame = -1

Query: 411 KVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHL 256
           +VA++L+DTQGAFD++STV+DCAT+FALSTM SSVQIYNLSQNIQEDDLQ L
Sbjct: 149 QVAVVLMDTQGAFDTQSTVKDCATIFALSTMTSSVQIYNLSQNIQEDDLQQL 200



 Score = 55.6 bits (128), Expect(2) = 1e-28
 Identities = 22/35 (62%), Positives = 28/35 (80%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKV 406
           PL+GFSWRGGSE +TTGI +WS++F     DGE+V
Sbjct: 77  PLKGFSWRGGSEPETTGIQLWSQVFPIRKSDGEEV 111



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/26 (84%), Positives = 24/26 (92%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYK 558
           V+SVAGAFRKGKSFLLDF LRYM+ K
Sbjct: 40  VLSVAGAFRKGKSFLLDFMLRYMYRK 65


>UniRef50_UPI0000D56A7A Cluster: PREDICTED: similar to CG6668-PA,
           isoform A isoform 3; n=2; Tribolium castaneum|Rep:
           PREDICTED: similar to CG6668-PA, isoform A isoform 3 -
           Tribolium castaneum
          Length = 477

 Score =  119 bits (286), Expect = 7e-26
 Identities = 51/88 (57%), Positives = 68/88 (77%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVF 334
           GPL+GFSW  GS+R TTGI MWSE+F      GE+VAI+L+DTQG FD ++T  DCA +F
Sbjct: 81  GPLKGFSWSSGSKRHTTGIHMWSEVFLTEKPTGERVAILLIDTQGGFDHQTTFEDCARIF 140

Query: 333 ALSTMLSSVQIYNLSQNIQEDDLQHLHC 250
           A ST++SSVQI+N+ ++I++ DL HL C
Sbjct: 141 AFSTLISSVQIFNVMRSIKQYDLTHLQC 168



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 35/81 (43%), Positives = 50/81 (61%)
 Frame = -3

Query: 250 FTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQS 71
           F  YG L + +    PFQ L FLVRDW+ PYE PYGA+GG   L    +V +    E++ 
Sbjct: 169 FGGYGSL-MTNCMSVPFQNLCFLVRDWACPYEKPYGAEGGSAYLQ---EVFNSPQKEVKD 224

Query: 70  LRKHITACFSELACFLMPHPG 8
             +++   F+EL+CFL+P+PG
Sbjct: 225 QIENLKGLFNELSCFLLPYPG 245



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/27 (66%), Positives = 23/27 (85%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYKY 555
           +IS+AG FR+GKSFLL+F LRY+  KY
Sbjct: 40  IISIAGVFRQGKSFLLNFLLRYLRIKY 66


>UniRef50_UPI00015A3DBD Cluster: ADP-ribosylation factor-like 6
           interacting protein 2; n=3; Danio rerio|Rep:
           ADP-ribosylation factor-like 6 interacting protein 2 -
           Danio rerio
          Length = 345

 Score =  108 bits (259), Expect = 1e-22
 Identities = 43/67 (64%), Positives = 55/67 (82%)
 Frame = -3

Query: 202 FQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQSLRKHITACFSELACFL 23
           FQ L FL+RDWS+PYE PYG +GG Q L +RL+V+  QH ELQS+RKHI +CFS ++CFL
Sbjct: 1   FQSLMFLIRDWSYPYEHPYGLEGGNQFLEKRLQVTQNQHEELQSVRKHIHSCFSSISCFL 60

Query: 22  MPHPGLK 2
           +PHPGL+
Sbjct: 61  LPHPGLR 67


>UniRef50_O62433 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 520

 Score =  106 bits (255), Expect = 4e-22
 Identities = 49/84 (58%), Positives = 59/84 (70%)
 Frame = -1

Query: 507 LQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFAL 328
           L GF WR G +RDT GI +W E        GE  A++L+DTQG FD+ ST + C TVFAL
Sbjct: 110 LHGFHWRAGVKRDTVGIWLWGEPIMIESVTGEMFAVVLMDTQGTFDNNSTYQQCMTVFAL 169

Query: 327 STMLSSVQIYNLSQNIQEDDLQHL 256
           ST++SSVQIYN+  NIQED LQHL
Sbjct: 170 STIVSSVQIYNVVDNIQEDALQHL 193



 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 34/87 (39%), Positives = 52/87 (59%), Gaps = 2/87 (2%)
 Frame = -3

Query: 256 SLFTEYGRLALEDGGR--TPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHP 83
           SLF EYGR+A+E       PFQ+L F VRD+    E  +G +GG   L   L+ + +Q  
Sbjct: 194 SLFVEYGRIAMEQPHNFGKPFQQLVFCVRDFKNQEEYEFGENGGTDFLDNVLQTNPEQPE 253

Query: 82  ELQSLRKHITACFSELACFLMPHPGLK 2
           E++ +R+ +   F ++ C+L+PHPG K
Sbjct: 254 EIKQVRELLREYFEDIQCYLLPHPGYK 280



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 19/24 (79%), Positives = 23/24 (95%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMH 564
           +ISVAGAFRKGKSFLL+FFL Y++
Sbjct: 66  IISVAGAFRKGKSFLLNFFLEYLY 89


>UniRef50_UPI0001554FFF Cluster: PREDICTED: similar to zinc finger
           protein 179; n=1; Ornithorhynchus anatinus|Rep:
           PREDICTED: similar to zinc finger protein 179 -
           Ornithorhynchus anatinus
          Length = 611

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 38/87 (43%), Positives = 54/87 (62%)
 Frame = -1

Query: 516 GGPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATV 337
           G  LQGF W GGS+  T G+ +WS  F     + EKVA+ LLDT+G    +    +   +
Sbjct: 217 GEDLQGFQWGGGSDTITKGVWIWSHPFLLE-KNAEKVAVFLLDTEGTMAPDQNKENSVKL 275

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHL 256
            ALS +LSS QI+N+S+ ++E DL+HL
Sbjct: 276 SALSMLLSSYQIFNISRMLKETDLEHL 302


>UniRef50_UPI0001554E6D Cluster: PREDICTED: similar to zinc finger
           protein 179, partial; n=1; Ornithorhynchus anatinus|Rep:
           PREDICTED: similar to zinc finger protein 179, partial -
           Ornithorhynchus anatinus
          Length = 749

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 37/87 (42%), Positives = 55/87 (63%)
 Frame = -1

Query: 516 GGPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATV 337
           G  LQGF W GGS+  T G+ +WS  F      GEKVA+ LLDT+G    + +  +   +
Sbjct: 337 GEDLQGFEWGGGSDAITRGVWIWSHPFLLE-KKGEKVAVFLLDTEGFMAPDQSKENTVKL 395

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHL 256
            AL+T+LSS QI ++S+ ++E DL++L
Sbjct: 396 LALTTLLSSHQILSVSKRLKEPDLEYL 422


>UniRef50_UPI00015B48CD Cluster: PREDICTED: similar to karyopherin
           alpha 6; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to karyopherin alpha 6 - Nasonia vitripennis
          Length = 232

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 30/45 (66%), Positives = 39/45 (86%)
 Frame = -3

Query: 184 LVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQSLRKHITA 50
           +VRDWS+PYEA YGA+GG +IL RR ++SD Q+PELQSL+KHI +
Sbjct: 37  VVRDWSYPYEAAYGAEGGHKILKRRFEISDMQYPELQSLKKHIAS 81


>UniRef50_Q2VPQ0 Cluster: LOC432253 protein; n=6; Xenopus|Rep:
           LOC432253 protein - Xenopus laevis (African clawed frog)
          Length = 612

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 35/85 (41%), Positives = 52/85 (61%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL+GF W  G+E  T GI MW+  F      G K+A+ LLDT+G+ D ES    C  + A
Sbjct: 226 PLKGFKWSPGTETTTKGIWMWNRPFLLN-HKGGKIAVFLLDTEGSLDIESDRETCIKLSA 284

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LS  +SS  I+N++ N++E +L ++
Sbjct: 285 LSLFISSHLIFNVASNLKETELDYM 309



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = -3

Query: 223 EDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQSLRKHITACF 44
           E+ G    Q L  LVRDW   +   +  D     +SR ++  +K    L S  K + +  
Sbjct: 317 EECGPKNLQHLDILVRDWY--HSKKWDRDVARSYISREIEKLEK----LNSYPKVLWSLK 370

Query: 43  S-ELACFLMPHPG 8
           S +  CFL+PHPG
Sbjct: 371 SNQTRCFLLPHPG 383


>UniRef50_UPI00006A0E2B Cluster: UPI00006A0E2B related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A0E2B UniRef100 entry -
           Xenopus tropicalis
          Length = 559

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 32/85 (37%), Positives = 55/85 (64%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GF W+ G +  T GI +W++ F   L+ GEK+A+ +LDT+G+ D   ++ +C  + A
Sbjct: 178 PLSGFEWKAGVDTITRGIWIWNKPFILELN-GEKMAVFVLDTEGSLDIGGSLENCLKMSA 236

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LS +LSS  I+N++  ++  +L +L
Sbjct: 237 LSMILSSYLIFNVNSFLKTTELDYL 261


>UniRef50_UPI00006A0E29 Cluster: Zinc finger protein 179 (Brain
           finger protein) (RING finger protein 112).; n=1; Xenopus
           tropicalis|Rep: Zinc finger protein 179 (Brain finger
           protein) (RING finger protein 112). - Xenopus tropicalis
          Length = 596

 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 34/85 (40%), Positives = 55/85 (64%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GF WR G+E  T GI +W++ F    + GEK+A+ +LDT+G+ D ES+      + A
Sbjct: 211 PLSGFEWRAGTESITKGIWIWNKPFVLERN-GEKMAVFVLDTEGSLDIESSRDISIKLSA 269

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LS +LSS  I+N++ +++  +L +L
Sbjct: 270 LSMILSSYLIFNVNSSLKTTELDYL 294


>UniRef50_UPI0000F2DA65 Cluster: PREDICTED: similar to zinc finger
           protein 179,; n=3; Monodelphis domestica|Rep: PREDICTED:
           similar to zinc finger protein 179, - Monodelphis
           domestica
          Length = 644

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 33/83 (39%), Positives = 52/83 (62%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALS 325
           QGF  + G++  T G+ +WS+ F    + G++VA+ L+DT+G    E+     A + ALS
Sbjct: 263 QGFQCKPGAQSITKGLWIWSQPF-ILKEKGKEVAVFLVDTEGTISLETDKEMNAKLIALS 321

Query: 324 TMLSSVQIYNLSQNIQEDDLQHL 256
            +LSS QI N+S+ ++E DL HL
Sbjct: 322 MLLSSFQILNVSRMLKETDLDHL 344



 Score = 39.9 bits (89), Expect = 0.050
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = -3

Query: 205 PFQRLQFLVRDWSFPYEAPYGADGGMQILSRRL-KVSDKQHPELQSLRKHITACFSELAC 29
           P Q L  LVRDW +P    +G + G   ++  + K+SDK +P +Q   +       +  C
Sbjct: 362 PIQHLDLLVRDWFYP--TTFGEEAGETHMNDVMQKISDK-YPRIQKAFRS-----KQTRC 413

Query: 28  FLMPHPGLK 2
           +L+P PG+K
Sbjct: 414 YLLPFPGIK 422


>UniRef50_UPI0001554E35 Cluster: PREDICTED: similar to brain finger
           protein; n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           similar to brain finger protein - Ornithorhynchus
           anatinus
          Length = 630

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 33/87 (37%), Positives = 53/87 (60%)
 Frame = -1

Query: 516 GGPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATV 337
           G  LQGF W GGS+  T G+ +W++ F    ++ EKVA+ LLD +G+   +        +
Sbjct: 178 GEDLQGFQWGGGSDTITKGLWIWNKPFLLKKNE-EKVAVFLLDIEGSMALDECKESNVKL 236

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHL 256
            AL+ +LSS QI N+ + ++E DL++L
Sbjct: 237 SALTMLLSSYQILNVFRILKEADLEYL 263


>UniRef50_A7SNS4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 779

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 29/72 (40%), Positives = 45/72 (62%)
 Frame = -1

Query: 471 DTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNL 292
           +T GI MW +  K  L DG++VA++ LDT+G   +  +    A VFA++T+LSS  IYN 
Sbjct: 154 ETMGIWMWGKPLKIKLQDGQEVALVFLDTEGFAATNVSESYDAKVFAVATLLSSYLIYNS 213

Query: 291 SQNIQEDDLQHL 256
            + I + D+ +L
Sbjct: 214 VKIIDQGDIDYL 225


>UniRef50_O70418 Cluster: Zinc finger protein 179; n=12;
           Eutheria|Rep: Zinc finger protein 179 - Rattus
           norvegicus (Rat)
          Length = 631

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 34/86 (39%), Positives = 46/86 (53%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVF 334
           G L G  W  G+   T GI MWS  F     +G+KVA+ L+DT      E +      + 
Sbjct: 208 GSLPGIRW--GANGLTRGIWMWSHPFLLG-KEGKKVAVFLVDTGDVMSPELSRETRVKLC 264

Query: 333 ALSTMLSSVQIYNLSQNIQEDDLQHL 256
           AL+ MLSS QI N SQ +++ DL +L
Sbjct: 265 ALTMMLSSYQILNTSQELKDTDLGYL 290


>UniRef50_Q9ULX5 Cluster: Zinc finger protein 179; n=9;
           Eutheria|Rep: Zinc finger protein 179 - Homo sapiens
           (Human)
          Length = 632

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 34/84 (40%), Positives = 47/84 (55%)
 Frame = -1

Query: 507 LQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFAL 328
           LQG  W  G+     GI MWS  F     +G+KVA+ L+DT  A   E +      + AL
Sbjct: 211 LQGCRW--GANGLARGIWMWSHPFLLG-KEGKKVAVFLVDTGDAMSPELSRETRIKLCAL 267

Query: 327 STMLSSVQIYNLSQNIQEDDLQHL 256
           +TMLSS QI + SQ +++ DL +L
Sbjct: 268 TTMLSSYQILSTSQELKDTDLDYL 291


>UniRef50_Q0D863 Cluster: Os07g0181700 protein; n=6; Oryza
           sativa|Rep: Os07g0181700 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 607

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 33/85 (38%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDS--ESTVRDCATVFA 331
           +GF      +  T GI +W    +  ++ G KV+++ LDT+G F+S  +S V D   +FA
Sbjct: 92  KGFGVGHMRDTKTKGIWVWGTPIELDVN-GSKVSVLYLDTEG-FESIGKSNVYD-DRIFA 148

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           L+T+LSS+ IYNL + I+E D+  L
Sbjct: 149 LATVLSSILIYNLPETIREADISRL 173


>UniRef50_A2YIT0 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 587

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 33/85 (38%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDS--ESTVRDCATVFA 331
           +GF      +  T GI +W    +  ++ G KV+++ LDT+G F+S  +S V D   +FA
Sbjct: 92  KGFGVGHMRDTKTKGIWVWGTPIELDVN-GSKVSVLYLDTEG-FESIGKSNVYD-DRIFA 148

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           L+T+LSS+ IYNL + I+E D+  L
Sbjct: 149 LATVLSSILIYNLPETIREADISRL 173


>UniRef50_Q9D873 Cluster: Adult male small intestine cDNA, RIKEN
           full-length enriched library, clone:2010110I21
           product:hypothetical protein, full insert sequence; n=1;
           Mus musculus|Rep: Adult male small intestine cDNA, RIKEN
           full-length enriched library, clone:2010110I21
           product:hypothetical protein, full insert sequence - Mus
           musculus (Mouse)
          Length = 131

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 22/26 (84%), Positives = 24/26 (92%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYK 558
           V+SVAGAFRKGKSFLLDF LRYM+ K
Sbjct: 96  VVSVAGAFRKGKSFLLDFMLRYMYNK 121


>UniRef50_A2Y7G2 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 924

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = -1

Query: 468 TTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLS 289
           T G+ MWS   K T  DG +  ++LLDT+G    + T      +F+L+ +LSS+ IYN  
Sbjct: 95  TKGLWMWSAPLKRTGLDGTEYNLVLLDTEGIDAYDQTGTYSIQIFSLAVLLSSMFIYNQM 154

Query: 288 QNIQEDDLQHLH-CSQSTVGWRSRTGAG 208
             I E  L  L   ++ T   R R   G
Sbjct: 155 GGIDEAALDRLSLVTEMTKHIRVRASGG 182


>UniRef50_Q54TN9 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 796

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 27/71 (38%), Positives = 44/71 (61%)
 Frame = -1

Query: 468 TTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLS 289
           T GI MW+   K   D+G++  ++LLDT+G + S  +    A +FA++T+LSS  IYN  
Sbjct: 107 TIGIWMWACRIKD--DNGKQHNLLLLDTEGFYSSNVSETYDAKIFAITTLLSSHLIYNSV 164

Query: 288 QNIQEDDLQHL 256
           + I +  L++L
Sbjct: 165 KIIDQSALEYL 175


>UniRef50_A0D4V9 Cluster: Chromosome undetermined scaffold_38, whole
           genome shotgun sequence; n=5; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_38, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 1636

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 2/73 (2%)
 Frame = -1

Query: 468 TTGILMWSEIFKATLDDGEKVAIILLDTQ--GAFDSESTVRDCATVFALSTMLSSVQIYN 295
           T G+ MW +       DGE  +I+++D++  GA D +ST  D   +F+L+ +L+S  IYN
Sbjct: 77  TKGLWMWGKPLLGQTSDGESCSILVVDSEGLGAPDEDST-HD-IRIFSLTILLTSCFIYN 134

Query: 294 LSQNIQEDDLQHL 256
              +I E+ LQ+L
Sbjct: 135 SVGSIDENALQNL 147


>UniRef50_Q2V6D6 Cluster: Guanylate binding protein 8; n=2; Mus
           musculus|Rep: Guanylate binding protein 8 - Mus musculus
           (Mouse)
          Length = 525

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 30/88 (34%), Positives = 40/88 (45%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G   GF      +  T GI MW        +      ++LLDT+G  D E    ++   +
Sbjct: 58  GQNHGFPLGSTVQSQTKGIWMWCMPHPTKPEH----TLVLLDTEGLGDVEKGDPKNDLWI 113

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FALS +LSS  IYN    I  D L+ LH
Sbjct: 114 FALSVLLSSTFIYNSMNTISHDSLEKLH 141


>UniRef50_Q66J21 Cluster: MGC82824 protein; n=3; Xenopus|Rep:
           MGC82824 protein - Xenopus laevis (African clawed frog)
          Length = 620

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 1/91 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G   GF      E  T GI MW           +K  ++LLDT+G  D  +   ++   +
Sbjct: 55  GKNAGFDLGATVESKTKGIWMWCVPHPTK----KKHTLVLLDTEGLGDVQKGDKKNDIWI 110

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLHCSQ 244
           F L+ +LSS  +YN    I +D ++ LH  Q
Sbjct: 111 FCLTVLLSSAMVYNSKGTIDQDAIEKLHYVQ 141


>UniRef50_A0BIV5 Cluster: Chromosome undetermined scaffold_11, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_11,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 703

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = -1

Query: 468 TTGILMWSE-IFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNL 292
           T G+ MWSE I+  +    E +  IL+DT+G    E  +     VF L+ ++SS  IYN 
Sbjct: 76  TKGLWMWSELIYFESSRSKEPIPAILIDTEGIGSVEEDMNHDVKVFLLAMLMSSYFIYNS 135

Query: 291 SQNIQEDDLQHL 256
              I +  LQ+L
Sbjct: 136 VGTIDDMALQNL 147


>UniRef50_UPI0000EBE8A3 Cluster: PREDICTED: hypothetical protein;
           n=1; Bos taurus|Rep: PREDICTED: hypothetical protein -
           Bos taurus
          Length = 555

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 29/88 (32%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G   GF      + +T GI MW     +     E   ++LLDT+G  D E    ++ + +
Sbjct: 109 GQNHGFCLGSTVQSETKGIWMWYVPHPSK----ENHTLVLLDTEGLGDMEKGDSKNDSWI 164

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  IYN    I    L+ LH
Sbjct: 165 FALAVLLSSTCIYNSMGTINHQALEQLH 192


>UniRef50_Q238R8 Cluster: Guanylate-binding protein, N-terminal
           domain containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Guanylate-binding protein, N-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 1192

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 26/83 (31%), Positives = 42/83 (50%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALS 325
           QGF         T G+ +W +  K+  D  E + I+L+DT+G    +  +   + +F  S
Sbjct: 69  QGFQVGPTINPCTKGLWLWKKELKSIED--ENMDILLIDTEGFGGMDENLNHDSRIFLFS 126

Query: 324 TMLSSVQIYNLSQNIQEDDLQHL 256
            +LSS  IYN   +I E+ L +L
Sbjct: 127 LLLSSYFIYNSQGSIDENALNNL 149


>UniRef50_UPI0000E8244A Cluster: PREDICTED: similar to guanylate
           binding protein 1; n=4; Gallus gallus|Rep: PREDICTED:
           similar to guanylate binding protein 1 - Gallus gallus
          Length = 688

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G   GFS     +  T GI MW          G    ++LLDT+G  D  +   ++   +
Sbjct: 67  GQRTGFSLGSNVQGQTKGIWMWC--MPHPRQPGH--TLVLLDTEGLGDVDKGDTKNDTWI 122

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F L+ +LSS  IYN    I +  L++LH
Sbjct: 123 FVLAVLLSSTLIYNSKGTIDQQALENLH 150


>UniRef50_Q0V7P3 Cluster: Guanylate binding protein family, member
           6; n=3; Theria|Rep: Guanylate binding protein family,
           member 6 - Bos taurus (Bovine)
          Length = 211

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 1/85 (1%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATVFAL 328
           +GF      + +T GI MW     +     E   ++LLDT+G  D E    ++ + +FAL
Sbjct: 58  RGFCLGSTVQSETKGIWMWYVPHPSK----ENHTLVLLDTEGLGDMEKGDSKNDSWIFAL 113

Query: 327 STMLSSVQIYNLSQNIQEDDLQHLH 253
           + +LSS  IYN    I    L+ LH
Sbjct: 114 AVLLSSTCIYNSMGTINHQALEQLH 138


>UniRef50_A0CCI6 Cluster: Chromosome undetermined scaffold_167,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_167,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1051

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = -1

Query: 468 TTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLS 289
           T G+ +WS+   A   +   +  I++DT+G    +  V     +F  S +LSS  IYN  
Sbjct: 74  TKGLWIWSQTITAQNAEFPDMKAIIIDTEGFGGMDENVNHDTRIFLFSLLLSSYFIYNSV 133

Query: 288 QNIQEDDLQHLH 253
            NI E+ L  L+
Sbjct: 134 GNIDENALNTLN 145


>UniRef50_Q96PP9 Cluster: Guanylate-binding protein 4; n=70;
           Mammalia|Rep: Guanylate-binding protein 4 - Homo sapiens
           (Human)
          Length = 640

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSE-STVRDCATV 337
           G   GF      + +T GI MW     +  +      ++LLDT+G  D E S  ++ + +
Sbjct: 75  GKRNGFPLGSTVQSETKGIWMWCVPHLSKPNH----TLVLLDTEGLGDVEKSNPKNDSWI 130

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I    L+ LH
Sbjct: 131 FALAVLLSSSFVYNSVSTINHQALEQLH 158


>UniRef50_UPI00006CEB57 Cluster: Guanylate-binding protein,
           N-terminal domain containing protein; n=1; Tetrahymena
           thermophila SB210|Rep: Guanylate-binding protein,
           N-terminal domain containing protein - Tetrahymena
           thermophila SB210
          Length = 1132

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVF 334
           G   GFS        T G+ +W E   +  +  E V +IL+DT+G    +      + +F
Sbjct: 66  GKKAGFSVGPTINPCTKGLWIWKETLYSE-ELSEDVDVILIDTEGFGGMDENQNHDSRIF 124

Query: 333 ALSTMLSSVQIYNLSQNIQEDDLQHL 256
             S +LSS  IYN   NI E  L ++
Sbjct: 125 LFSLLLSSYFIYNSQGNIDETALNNI 150


>UniRef50_A0BP55 Cluster: Chromosome undetermined scaffold_12, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_12,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 871

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 1/84 (1%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEI-FKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFAL 328
           QGF+        T G+ MWS+I +  +    E +  IL+DT+G    E        +F L
Sbjct: 67  QGFNVGSTVNACTKGLWMWSDIIYFESGRSKEPIPAILIDTEGIGSLEEEQNHDVKIFLL 126

Query: 327 STMLSSVQIYNLSQNIQEDDLQHL 256
           + ++SS  IYN    I +  LQ+L
Sbjct: 127 AMLMSSYFIYNSVGTIDDMALQNL 150


>UniRef50_A0DQT8 Cluster: Chromosome undetermined scaffold_6, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_6,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 599

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 24/83 (28%), Positives = 42/83 (50%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALS 325
           +GF     ++  T GI M++   K  ++    + I  LDT+G+   E T    A +FAL+
Sbjct: 65  EGFKVDAATDSCTQGIWMYT---KPIINPKTNLQIYFLDTEGSESIERTTNHDAKIFALA 121

Query: 324 TMLSSVQIYNLSQNIQEDDLQHL 256
            ++SS+ ++N    I E  +  L
Sbjct: 122 ILMSSIFVFNSRGCIDETSISQL 144


>UniRef50_Q8CFB4 Cluster: Guanylate-binding protein 5; n=17;
           Eutheria|Rep: Guanylate-binding protein 5 - Mus musculus
           (Mouse)
          Length = 590

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 29/88 (32%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCAT-V 337
           G  +GFS     +  T GI MW        D      ++LLDT+G  D E   +   T +
Sbjct: 60  GKEKGFSVGSTVQSHTKGIWMWCVPHPQKPDH----TLVLLDTEGLGDVEKDDKKNDTQI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALAILLSSTFVYNTMNKIDQGAIDLLH 143


>UniRef50_UPI0000F1FCFA Cluster: PREDICTED: similar to LOC446944
           protein; n=6; Danio rerio|Rep: PREDICTED: similar to
           LOC446944 protein - Danio rerio
          Length = 964

 Score = 40.7 bits (91), Expect = 0.029
 Identities = 28/83 (33%), Positives = 41/83 (49%)
 Frame = -1

Query: 501 GFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALST 322
           GFS     E +T GI MW          G    ++LLDT+G  D +    D   +F L+ 
Sbjct: 65  GFSLGYTIESETKGIWMWC--IPHPTKKGH--TLVLLDTEGLGDVQKEKND-KWIFCLAV 119

Query: 321 MLSSVQIYNLSQNIQEDDLQHLH 253
           +LSSV +YN    I ++ ++ LH
Sbjct: 120 LLSSVLVYNSLGVIDDEAVEKLH 142


>UniRef50_Q5BKG3 Cluster: MGC108424 protein; n=3; Xenopus|Rep:
           MGC108424 protein - Xenopus tropicalis (Western clawed
           frog) (Silurana tropicalis)
          Length = 745

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 1/84 (1%)
 Frame = -1

Query: 501 GFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATVFALS 325
           GF      + +T GI MW         D     ++LLDT+G  D  +   R+ + + +LS
Sbjct: 66  GFPLGHTVQANTKGIWMWC----VPHPDKSARTLVLLDTEGLGDVDKGNTRNDSAILSLS 121

Query: 324 TMLSSVQIYNLSQNIQEDDLQHLH 253
            +LSS  +YN    I ED ++ L+
Sbjct: 122 LLLSSALVYNSRGTIDEDAVKTLY 145


>UniRef50_UPI000155BFFE Cluster: PREDICTED: hypothetical protein;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein - Ornithorhynchus anatinus
          Length = 588

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G   GFS     +  T GI MW          G    ++LLDT+G  D E     +   +
Sbjct: 34  GKHSGFSMGSTVQSHTKGIWMWPRPHPCR--PGH--TLLLLDTEGLGDVEKGDSENDHWL 89

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F+L+ +LSS  +YN  + I ++ L+ LH
Sbjct: 90  FSLAVLLSSTLVYNSMKTIDQNALEKLH 117


>UniRef50_A2VD69 Cluster: LOC100037176 protein; n=12; Xenopus|Rep:
           LOC100037176 protein - Xenopus laevis (African clawed
           frog)
          Length = 611

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G   GF+     +  T GI MW       +  G    ++LLDT+G  D E    ++ A +
Sbjct: 55  GGKNGFALGSTIQSKTKGIWMWC--VPHPMKQGH--TLVLLDTEGLGDVEKGDSKNDAWI 110

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F+L+ +LSS  +YN    I +  + +LH
Sbjct: 111 FSLAILLSSSLVYNSLGTIDQQAMDNLH 138


>UniRef50_A3A5Z0 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 1107

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 36/117 (30%), Positives = 51/117 (43%), Gaps = 15/117 (12%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQG--AFD---------- 370
           G   GF         T G+ MWS   K T  DG + +++LLDT+G  A+D          
Sbjct: 105 GRSSGFQVASTHRPCTKGLWMWSAPIKRTALDGTEYSLLLLDTEGIDAYDQTRFKTRQQF 164

Query: 369 --SESTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLH-CSQSTVGWRSRTGAG 208
             +E        +F+L+ +LSS+ IYN    I E  L  L   ++ T   R R   G
Sbjct: 165 VLNEFKGTYSIQIFSLAVLLSSMFIYNQMGGIDEAALDRLSLVTEMTKHIRVRANGG 221


>UniRef50_A0DE81 Cluster: Chromosome undetermined scaffold_47, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_47,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 680

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 25/86 (29%), Positives = 43/86 (50%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVF 334
           G   GF+    +   T GI +W +  ++     + + I+LLDT+G    E    + A + 
Sbjct: 59  GQQTGFTLGSSTNPCTKGIWIWGKRVES-----DNLTILLLDTEGLNSYERDQNNDARLL 113

Query: 333 ALSTMLSSVQIYNLSQNIQEDDLQHL 256
            L+ ++SS  +YN+ Q I E  L+ L
Sbjct: 114 VLACLISSNLLYNVMQVIDEKSLETL 139


>UniRef50_Q24F54 Cluster: Guanylate-binding protein, N-terminal
           domain containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Guanylate-binding protein, N-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 760

 Score = 39.1 bits (87), Expect = 0.088
 Identities = 24/83 (28%), Positives = 42/83 (50%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALS 325
           +GF     ++  T GI MWS   +    D ++  I  +DT+G    E   +  A +F+L+
Sbjct: 234 KGFKVDASTQSCTQGIWMWS---RPVPQDNKQ--IFFIDTEGNKSVEGNKKHDAKIFSLA 288

Query: 324 TMLSSVQIYNLSQNIQEDDLQHL 256
            ++SS+ +YN    I +  +Q L
Sbjct: 289 LLISSLFVYNSVGAIDDKSIQEL 311


>UniRef50_UPI0000D99A1D Cluster: PREDICTED: guanylate binding
           protein 1, interferon-inducible, 67kDa; n=1; Macaca
           mulatta|Rep: PREDICTED: guanylate binding protein 1,
           interferon-inducible, 67kDa - Macaca mulatta
          Length = 479

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G  +GFS     +  T GI MW          G    ++LLDT+G  D E    ++ + +
Sbjct: 63  GKKKGFSLGSTVQSHTKGIWMWC--VPHPKKPGH--ILVLLDTEGLGDVEKGNNQNDSWI 118

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 119 FALAVLLSSTFVYNSMGIINQQAMDQLH 146


>UniRef50_Q6BGA8 Cluster: Guanylate-binding protein, putative; n=2;
           Paramecium tetraurelia|Rep: Guanylate-binding protein,
           putative - Paramecium tetraurelia
          Length = 835

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 20/71 (28%), Positives = 40/71 (56%)
 Frame = -1

Query: 468 TTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLS 289
           T GI +WS+     +   E  +I+L+DT+G    +  +     +F++S +LSS+ ++N  
Sbjct: 79  TKGIWLWSQ----PIPLNENTSILLMDTEGLNSVQRDLGVDTKIFSISLLLSSMFVFNQL 134

Query: 288 QNIQEDDLQHL 256
            +I E  +++L
Sbjct: 135 GHIDEQSIENL 145


>UniRef50_P32456 Cluster: Interferon-induced guanylate-binding
           protein 2; n=60; Tetrapoda|Rep: Interferon-induced
           guanylate-binding protein 2 - Homo sapiens (Human)
          Length = 591

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCAT-V 337
           G   GFS     +  T GI MW        +      ++LLDT+G  D E    +  + +
Sbjct: 60  GKKNGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDIEKGDNENDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALAILLSSTFVYNSMGTINQQAMDQLH 143


>UniRef50_Q6DHP7 Cluster: Zgc:92185; n=22; cellular organisms|Rep:
           Zgc:92185 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 621

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G   GF+     E  T GI MW           +   ++LLDT+G  D  +   ++   +
Sbjct: 60  GQQTGFALGNTIESKTKGIWMWC----VPHPKKQGHTLVLLDTEGLGDVDKGDSKNDGWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F L+ +LSS  +YN    I    L+ LH
Sbjct: 116 FCLAVLLSSTLVYNSRGTIDNSALEKLH 143


>UniRef50_UPI0001552CDF Cluster: PREDICTED: similar to guanylate
           binding protein 1; n=2; Mus musculus|Rep: PREDICTED:
           similar to guanylate binding protein 1 - Mus musculus
          Length = 666

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 28/85 (32%), Positives = 38/85 (44%), Gaps = 2/85 (2%)
 Frame = -1

Query: 501 GFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES--TVRDCATVFAL 328
           GFS     +  T GI MW        D      ++L DT+G  D E      DC  +FAL
Sbjct: 34  GFSMGSTVQSQTRGIWMWCVPHPEKPDH----TLVLDDTEGLGDVEKGDNQNDC-WIFAL 88

Query: 327 STMLSSVQIYNLSQNIQEDDLQHLH 253
           + +LSS  +YN    I +  +  LH
Sbjct: 89  AILLSSTFVYNSIGAINQQAMDQLH 113


>UniRef50_UPI00006CAA7C Cluster: Guanylate-binding protein,
           N-terminal domain containing protein; n=1; Tetrahymena
           thermophila SB210|Rep: Guanylate-binding protein,
           N-terminal domain containing protein - Tetrahymena
           thermophila SB210
          Length = 703

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 24/83 (28%), Positives = 36/83 (43%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALS 325
           +GF         T GI MWS       ++ + + I  +DT+G    E T      +F L+
Sbjct: 187 EGFKVDDSVNACTMGIWMWSN---PQYNENDDLYIFFIDTEGLQSVEQTQDHDIKIFTLT 243

Query: 324 TMLSSVQIYNLSQNIQEDDLQHL 256
            ++SS  IYN    I E  +  L
Sbjct: 244 MLISSFFIYNSKGVIDETSISQL 266


>UniRef50_UPI0000F2BB21 Cluster: PREDICTED: similar to guanylate
           binding protein 8; n=1; Monodelphis domestica|Rep:
           PREDICTED: similar to guanylate binding protein 8 -
           Monodelphis domestica
          Length = 475

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 1/74 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G  +GFS     +  T GI MW        D      ++LLDT+G  D E    ++ + +
Sbjct: 60  GKNKGFSLGSTVQSHTKGIWMWCVPHPRRSDH----TLVLLDTEGLEDPEKGDSKNDSWI 115

Query: 336 FALSTMLSSVQIYN 295
           FAL+ +LSS  +YN
Sbjct: 116 FALAILLSSTFVYN 129


>UniRef50_P32455 Cluster: Interferon-induced guanylate-binding
           protein 1; n=15; Tetrapoda|Rep: Interferon-induced
           guanylate-binding protein 1 - Homo sapiens (Human)
          Length = 592

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G  +GFS     +  T GI MW          G    ++LLDT+G  D E    ++ + +
Sbjct: 60  GKKKGFSLGSTVQSHTKGIWMWC--VPHPKKPGH--ILVLLDTEGLGDVEKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  L+
Sbjct: 116 FALAVLLSSTFVYNSIGTINQQAMDQLY 143


>UniRef50_UPI0000E80E09 Cluster: PREDICTED: similar to guanylate
           binding protein; n=4; Gallus gallus|Rep: PREDICTED:
           similar to guanylate binding protein - Gallus gallus
          Length = 768

 Score = 35.9 bits (79), Expect = 0.82
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = -1

Query: 501 GFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATVFALS 325
           GF      + +T GI MW    +     G  V ++LLDT+G  D  +    + A +F L+
Sbjct: 224 GFPLGPTVQAETKGIWMWC--LQHPRQQG--VTLMLLDTEGLGDPKKGDSHNDAWIFTLA 279

Query: 324 TMLSSVQIYNLSQNIQEDDLQHL 256
            +LSS  +YN    I +  L++L
Sbjct: 280 LLLSSTLVYNSIGTIDQKALENL 302


>UniRef50_Q9H0R5 Cluster: Guanylate-binding protein 3; n=16;
           Eutheria|Rep: Guanylate-binding protein 3 - Homo sapiens
           (Human)
          Length = 563

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G  +GFS     +  T GI MW        +      ++LLDT+G  D  +   ++ + +
Sbjct: 60  GKNKGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDVKKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F L+ +LSS  +YN    I +  +  L+
Sbjct: 116 FTLAVLLSSTLVYNSMGTINQQAMDQLY 143


>UniRef50_Q90892 Cluster: Guanylate binding protein; n=10;
           Amniota|Rep: Guanylate binding protein - Gallus gallus
           (Chicken)
          Length = 576

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = -1

Query: 471 DTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATVFALSTMLSSVQIYN 295
           +T GI MW            +V ++LLDT+G  D ++      A +F L+ +LSS  +YN
Sbjct: 75  ETKGIWMWCLPHPRQ----PRVTLVLLDTEGLEDPNKDNDHSDAWIFTLALLLSSTLVYN 130

Query: 294 LSQNIQEDDLQHL 256
               I +  L+ L
Sbjct: 131 SVGTIDQRALEQL 143


>UniRef50_A0BW08 Cluster: Chromosome undetermined scaffold_130,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_130,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 591

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 22/84 (26%), Positives = 40/84 (47%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALS 325
           +GF     +   T GI +++   K  ++    + I  LDT+G+     +    A +FAL+
Sbjct: 73  EGFQVSPTTNSCTQGIWLYT---KPVINKQSNLQIYFLDTEGSESGVKSQTHDAKIFALA 129

Query: 324 TMLSSVQIYNLSQNIQEDDLQHLH 253
            ++SS  ++N    I E  +  LH
Sbjct: 130 ILMSSTFMFNSIGCIDEQSIIQLH 153


>UniRef50_A4F9C7 Cluster: Putative uncharacterized protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: Putative
           uncharacterized protein - Saccharopolyspora erythraea
           (strain NRRL 23338)
          Length = 476

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 17/30 (56%), Positives = 18/30 (60%)
 Frame = -2

Query: 230 GARGRGPDSLPAAAVPRARLELPLRSALRS 141
           G  G GPD  PAA VP AR E P R + RS
Sbjct: 447 GTGGSGPDDRPAAPVPDARGEEPARYSARS 476


>UniRef50_Q4REF6 Cluster: Chromosome 10 SCAF15123, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10
           SCAF15123, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 592

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 16/32 (50%), Positives = 17/32 (53%)
 Frame = -2

Query: 233 AGARGRGPDSLPAAAVPRARLELPLRSALRSG 138
           A  RGRGP + PA   P AR ELP     R G
Sbjct: 421 AAVRGRGPPTAPAVVRPAARQELPGEHVRRGG 452


>UniRef50_Q5BB13 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 744

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 18/55 (32%), Positives = 29/55 (52%)
 Frame = +2

Query: 323 VDRANTVAQSRTVDSLSKAPCVSSNIIATFSPSSSVALNISDHMSMPVVSLSEPP 487
           ++R NTV  +++ DSLSK        I   +P+SS    +S     PV++ +E P
Sbjct: 269 LERRNTVKSTKSADSLSKGTSAHVEAIEISTPTSSSPTTLSP-TGPPVITTTEAP 322


>UniRef50_Q2JGL4 Cluster: ABC transporter related; n=1; Frankia sp.
           CcI3|Rep: ABC transporter related - Frankia sp. (strain
           CcI3)
          Length = 314

 Score = 32.7 bits (71), Expect = 7.6
 Identities = 20/42 (47%), Positives = 23/42 (54%)
 Frame = -2

Query: 251 VHRVRSAGARGRGPDSLPAAAVPRARLELPLRSALRSGRRHA 126
           +H  R   AR RG   + AAA PR RL    R AL SGRR +
Sbjct: 241 LHLRRPVCARRRGVPCVRAAARPRRRLPRRPRGALPSGRRRS 282


>UniRef50_Q01DQ7 Cluster: Chromosome 02 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 02 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 366

 Score = 32.7 bits (71), Expect = 7.6
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 4/48 (8%)
 Frame = -3

Query: 355 ARLRDRVRSVHDAVVRSDIQP----LAKHPGGRPPAPSLFTEYGRLAL 224
           A+LRD+ RSV DA+ R    P    +   P  RPPA  +F +   L++
Sbjct: 278 AQLRDKARSVADALRRGFPSPARASVVPEPSARPPADDVFAQLSDLSV 325


>UniRef50_Q0D1W6 Cluster: Predicted protein; n=1; Aspergillus
           terreus NIH2624|Rep: Predicted protein - Aspergillus
           terreus (strain NIH 2624)
          Length = 286

 Score = 32.7 bits (71), Expect = 7.6
 Identities = 19/46 (41%), Positives = 24/46 (52%)
 Frame = -2

Query: 212 PDSLPAAAVPRARLELPLRSALRSGRRHADTVKKIKGIRQTASRAA 75
           PD+     V   R+   + SAL+ GRR   T KK KG RQ A + A
Sbjct: 128 PDASQEDPVRTKRVSDAISSALKQGRRRKTTKKKKKGKRQPAPQKA 173


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 608,633,270
Number of Sequences: 1657284
Number of extensions: 11914060
Number of successful extensions: 42427
Number of sequences better than 10.0: 65
Number of HSP's better than 10.0 without gapping: 40426
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42403
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 47296372782
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).