SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0021
         (673 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...    97   5e-19
UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;...    87   5e-16
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    84   3e-15
UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ...    81   3e-14
UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa...    78   2e-13
UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo...    78   2e-13
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    73   6e-12
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    69   1e-10
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    60   4e-08
UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47...    51   3e-05
UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1; ...    44   0.004
UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221...    40   0.041
UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3; ...    40   0.055
UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;...    39   0.13 
UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|R...    38   0.29 
UniRef50_Q317L0 Cluster: Putative uncharacterized protein; n=1; ...    34   2.7  
UniRef50_A4QII0 Cluster: Putative uncharacterized protein; n=1; ...    34   2.7  
UniRef50_UPI0000F3066B Cluster: UPI0000F3066B related cluster; n...    34   3.6  
UniRef50_Q4WNX0 Cluster: Pentatricopeptide repeat protein; n=3; ...    34   3.6  
UniRef50_A6SB47 Cluster: Putative uncharacterized protein; n=1; ...    33   6.3  
UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2; ...    33   8.3  
UniRef50_Q54KK9 Cluster: Putative uncharacterized protein; n=2; ...    33   8.3  
UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ...    33   8.3  
UniRef50_Q59VG8 Cluster: Putative uncharacterized protein; n=1; ...    33   8.3  

>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 77/165 (46%), Positives = 90/165 (54%), Gaps = 3/165 (1%)
 Frame = -2

Query: 672 SQSLCVLNIWIKPA--LPFAPREVSVLSELALGHLRYSLTDVPPQSNSPPGSVLEPDTRE 499
           S+ + VL I IK A  L F  R +  LS  +LGHLRY LTDVPPQ NSPP +V  PD   
Sbjct: 139 SRFVFVLEIRIKRAFTLLFHTRFLFSLSS-SLGHLRYLLTDVPPQPNSPPDNVFRPDR-- 195

Query: 498 F*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSN-ETMKVVVFQRRSRETISHLC 322
               T VS       L  K         R P   N+++N ++  +  F   S    SHL 
Sbjct: 196 ---PTKVS-------LWIKKEGQR----RPPDSRNKLNNVKSSGISTFAVSS----SHLS 237

Query: 321 YTSHVSLQCQTXVKLNRVFFPRYSPKPVPLAVVSLDSR*GQWESR 187
           YTS V  Q +T VKLNRVFFP  S K VPL +VSLDSR GQWE R
Sbjct: 238 YTSQVISQSRTRVKLNRVFFPADSAKAVPLLLVSLDSRKGQWEFR 282


>UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 70

 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 43/58 (74%), Positives = 44/58 (75%)
 Frame = -3

Query: 335 SPTYATPLMSPYNARLXSSSTGSSFPAILPSPFPWLWFR*IVDRDSGNLVNPFMRVTN 162
           SPTYATPLMSPYNARL SSSTGSSFPA    P P       + RDSGNLVNPFMRVTN
Sbjct: 13  SPTYATPLMSPYNARLESSSTGSSFPANFSKPVPLAVVSLDMGRDSGNLVNPFMRVTN 70


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 37/40 (92%), Positives = 39/40 (97%)
 Frame = -2

Query: 159 DDEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVN 40
           +DEAFGYLKRVIVTPAVYPRL+EFLH DIQSTGQKSHCVN
Sbjct: 113 NDEAFGYLKRVIVTPAVYPRLVEFLHFDIQSTGQKSHCVN 152



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 28/42 (66%), Positives = 30/42 (71%)
 Frame = -2

Query: 627 PFAPREVSVLSELALGHLRYSLTDVPPQSNSPPGSVLEPDTR 502
           PF   E+SVL EL LGHLRY LTDVPPQ NSPP +V   D R
Sbjct: 50  PFVLHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFHLDRR 91


>UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC
           50803
          Length = 329

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 46/84 (54%), Positives = 51/84 (60%)
 Frame = -2

Query: 261 PRYSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVYPRLLEFLH 82
           P   P PVP A  S     GQW+ R SIHAR  L DEAFGYLKRVIVTPAVY      LH
Sbjct: 188 PAGRPSPVPEAGGSRRRGSGQWDPRWSIHARRKLPDEAFGYLKRVIVTPAVYQGFGGSLH 247

Query: 81  VDIQSTGQKSHCVNTREGHRNALF 10
            D + TGQKS   +   G R+A+F
Sbjct: 248 SDGRGTGQKSRRASAGCGPRDAVF 271


>UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa
           group|Rep: Zgc:165536 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 55

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 147 MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWEN 254
           MPRHLISDAHEW+NEIPTVP  YLAKPQPRERAW+N
Sbjct: 1   MPRHLISDAHEWMNEIPTVPTCYLAKPQPRERAWQN 36



 Score = 39.9 bits (89), Expect = 0.055
 Identities = 16/18 (88%), Positives = 17/18 (94%)
 Frame = +2

Query: 257 RGKKTLLSLTXVWHCKET 310
           RGKKTLLSLT VWHC+ET
Sbjct: 38  RGKKTLLSLTLVWHCEET 55


>UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10;
           Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana
           tabacum (Common tobacco)
          Length = 530

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 63/139 (45%), Positives = 76/139 (54%), Gaps = 2/139 (1%)
 Frame = -2

Query: 411 APLPPNRVSNETMKVVVFQ-RRSRETISHLCYTSH-VSLQCQTXVKLNRVFFPRYSPKPV 238
           APLP + +S  T+KVVVF  R S  T +    + H V L+  +        FP  S KPV
Sbjct: 31  APLPIHGISKITLKVVVFHFRLSAPTYTTPLKSFHKVGLESSS----TGSSFPADSAKPV 86

Query: 237 PLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQ 58
           PL VVSLDSR     S  SIHA           L+    +P VYPRL+EFLH DIQSTG+
Sbjct: 87  PLVVVSLDSRQDSGISL-SIHAVTNKMTRHLATLRESCYSP-VYPRLVEFLHFDIQSTGR 144

Query: 57  KSHCVNTREGHRNALF*LD 1
            +   N R  HRNALF L+
Sbjct: 145 IT-LRNIRRDHRNALFKLN 162



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 42/93 (45%), Positives = 52/93 (55%)
 Frame = -3

Query: 335 SPTYATPLMSPYNARLXSSSTGSSFPAILPSPFPWLWFR*IVDRDSGNLVNPFMRVTN*M 156
           +PTY TPL S +   L SSSTGSSFPA    P P +       +DSG  ++    VTN M
Sbjct: 54  APTYTTPLKSFHKVGLESSSTGSSFPADSAKPVPLVVVSLDSRQDSGISLS-IHAVTNKM 112

Query: 155 TRHLATLRES*LLPPFTRACLNFFTLTFRALGR 57
           TRHLATLRES   P + R  + F     ++ GR
Sbjct: 113 TRHLATLRESCYSPVYPR-LVEFLHFDIQSTGR 144


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 56/122 (45%), Positives = 63/122 (51%)
 Frame = -2

Query: 627 PFAPREVSVLSELALGHLRYSLTDVPPQSNSPPGSVLEPDTREF*TATSVSATSPLCTLG 448
           PF   E+SVL E  LGHLRY LTDVPPQ NSP      PD        +VS +     L 
Sbjct: 50  PFVLLEISVLHESPLGHLRYRLTDVPPQPNSP------PD--------NVSNSDQAYMLL 95

Query: 447 TKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTXVKLNRV 268
           T              P + +S ETM+VVVF RR     SHL YT HVS QCQT VKLN  
Sbjct: 96  T--------------PLHWISKETMEVVVFHRRRS---SHLFYTLHVSSQCQTRVKLNHA 138

Query: 267 FF 262
            +
Sbjct: 139 AY 140


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 32/43 (74%), Positives = 33/43 (76%)
 Frame = -2

Query: 156 DEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREG 28
           DE FGYLKRVIVTPAVY   +EF  VDI  TGQKSHCVNT  G
Sbjct: 144 DETFGYLKRVIVTPAVYLCFIEFHQVDIHGTGQKSHCVNTISG 186



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = -2

Query: 627 PFAPREVSVLSELALGHLRYSLTDVPPQSNSPPGSV 520
           PF+ +E+SVL EL  GHL Y LTDVPPQSNSP G V
Sbjct: 50  PFSLQEISVLFELVFGHLCYFLTDVPPQSNSPSGYV 85


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = -2

Query: 627 PFAPREVSVLSELALGHLRYSLTDVPPQSNSPPGSV 520
           PF+ +E+SVLSEL  GHLRY LTDVPPQSNSPP  V
Sbjct: 72  PFSLQEISVLSELVFGHLRYYLTDVPPQSNSPPDYV 107


>UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 421

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 32/75 (42%), Positives = 42/75 (56%)
 Frame = +3

Query: 3   LIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGKRRE*L*LS*GSQMPRHLISDAHEW 182
           L K K+C+GP GC RNVIS+Q    +  +++ S                  HLISDAHEW
Sbjct: 368 LAKIKNCNGPCGCSRNVISSQ----RNVKVKKS-----------------NHLISDAHEW 406

Query: 183 INEIPTVPIYYLAKP 227
           IN+ PT+ +YY  KP
Sbjct: 407 INKNPTILVYYPTKP 421


>UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47;
           Eukaryota|Rep: Uncharacterized protein YLR162W-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 62

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = -2

Query: 627 PFAPREVSVLSELALGHLRYSLTDVPPQSNSP 532
           PF   E+SVL E  LGHLRY LTDVPPQ NSP
Sbjct: 16  PFVLLEISVLHESPLGHLRYRLTDVPPQPNSP 47


>UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 108

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/41 (56%), Positives = 27/41 (65%)
 Frame = -2

Query: 624 FAPREVSVLSELALGHLRYSLTDVPPQSNSPPGSVLEPDTR 502
           F   E+ VL +L LGHLRY LTDV PQ NSPP +V   + R
Sbjct: 49  FVLHEIFVLVKLILGHLRYLLTDVSPQPNSPPDNVFRLNRR 89


>UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1;
           Crassostrea gigas|Rep: Tyrosine-protein kinase receptor
           - Crassostrea gigas (Pacific oyster) (Crassostrea
           angulata)
          Length = 804

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 20/25 (80%), Positives = 21/25 (84%)
 Frame = +3

Query: 45  RNVISAQCSECQREEIQASAGKRRE 119
           RNVISAQCSECQ EEIQ+S GK  E
Sbjct: 1   RNVISAQCSECQSEEIQSSEGKGGE 25


>UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221;
           n=2; Pyrococcus|Rep: Putative uncharacterized protein
           PH0221 - Pyrococcus horikoshii
          Length = 235

 Score = 40.3 bits (90), Expect = 0.041
 Identities = 21/33 (63%), Positives = 23/33 (69%)
 Frame = -2

Query: 204 GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 106
           GQ   R +IHA   L D+ F YLKRVIVTPAVY
Sbjct: 25  GQRGPRYAIHAGRHLTDKEFRYLKRVIVTPAVY 57


>UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3;
           Thermoproteaceae|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-061
          Length = 234

 Score = 39.9 bits (89), Expect = 0.055
 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 165 SDAHEWINEIPTVPIYYLAKPQPRERAWE-NSGER 266
           S  HEWINE+PTVP    A P P  ++W+   GE+
Sbjct: 177 SGVHEWINEVPTVPARGPANPPPGAQSWDPRRGEK 211


>UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 440

 Score = 38.7 bits (86), Expect = 0.13
 Identities = 15/26 (57%), Positives = 16/26 (61%)
 Frame = -1

Query: 556 CTAPVKLPAWQCPRTGHAGVLNGDER 479
           CTAPVKLP W CPR+G       D R
Sbjct: 75  CTAPVKLPTWHCPRSGSRPPARADGR 100


>UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|Rep:
           Lipoprotein, putative - Campylobacter lari RM2100
          Length = 97

 Score = 37.5 bits (83), Expect = 0.29
 Identities = 21/40 (52%), Positives = 25/40 (62%)
 Frame = -2

Query: 225 VSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 106
           +SLD    Q  SR +IHA   L D+ F YL+ VIVT AVY
Sbjct: 50  ISLDPSLRQLPSRYAIHAGRYLTDKEFRYLRTVIVTAAVY 89


>UniRef50_Q317L0 Cluster: Putative uncharacterized protein; n=1;
           Desulfovibrio desulfuricans G20|Rep: Putative
           uncharacterized protein - Desulfovibrio desulfuricans
           (strain G20)
          Length = 409

 Score = 34.3 bits (75), Expect = 2.7
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 4/48 (8%)
 Frame = +3

Query: 435 HGVSFQACRVVTWRKRS----SPFKTPACPVRGHCQAGSLTGAVHLSK 566
           HG+ F AC ++ WR  +     P      PV G C  G L G +HL +
Sbjct: 246 HGLQFHACGMLLWRLHNRYGLRPLVLTTFPVLGLCLLGLLAGNLHLPR 293


>UniRef50_A4QII0 Cluster: Putative uncharacterized protein; n=1;
           Corynebacterium glutamicum R|Rep: Putative
           uncharacterized protein - Corynebacterium glutamicum
           (strain R)
          Length = 170

 Score = 34.3 bits (75), Expect = 2.7
 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 5/46 (10%)
 Frame = -1

Query: 571 LFFDRCTAPVKLPAWQCPRTGHAGVLNG---DERFRHVTTL--HAW 449
           L  D CT P   P W  P  GH+GV+     D R   +TT   H W
Sbjct: 46  LTLDGCTYPDGTPVWDAPLVGHSGVVTAYFRDGRIEKLTTEDGHTW 91


>UniRef50_UPI0000F3066B Cluster: UPI0000F3066B related cluster; n=1;
           Bos taurus|Rep: UPI0000F3066B UniRef100 entry - Bos
           Taurus
          Length = 1120

 Score = 33.9 bits (74), Expect = 3.6
 Identities = 26/65 (40%), Positives = 30/65 (46%)
 Frame = -2

Query: 567 SLTDVPPQSNSPPGSVLEPDTREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRV 388
           S T VP   +SPP +  EP       +TS   TSPL TL TK  AP       P PP  +
Sbjct: 573 SSTSVP---SSPPSTSTEP------ASTSTRNTSPLSTLTTK--APTPHTTSVPSPPTSI 621

Query: 387 SNETM 373
           S   M
Sbjct: 622 STRPM 626


>UniRef50_Q4WNX0 Cluster: Pentatricopeptide repeat protein; n=3;
           Trichocomaceae|Rep: Pentatricopeptide repeat protein -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 854

 Score = 33.9 bits (74), Expect = 3.6
 Identities = 20/56 (35%), Positives = 28/56 (50%)
 Frame = -3

Query: 611 RFLSSLSWP*DTCVIL*QMYRPSQTPRLAVSSNRTRGSFKRRRAFPPRHHSARLER 444
           RFL ++  P  T   + ++YR   +P +A  S RTRG   RR + PP    A   R
Sbjct: 293 RFLEAVGDPKKTNQYIFRLYRDLPSPGVAHLSKRTRGLLLRRMSQPPNRRWADARR 348


>UniRef50_A6SB47 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 1027

 Score = 33.1 bits (72), Expect = 6.3
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -3

Query: 338 RSPTYATPLMSPYNARLXSSSTGSSFPAILPSPFPWL 228
           RSP  + P    +NA     S G +FP +  SP PW+
Sbjct: 195 RSPPGSGPTHYDFNALFEQQSPGGNFPVMQSSPSPWI 231


>UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2;
           Streptococcus pneumoniae|Rep: Putative uncharacterized
           protein - Streptococcus pneumoniae SP3-BS71
          Length = 44

 Score = 32.7 bits (71), Expect = 8.3
 Identities = 16/31 (51%), Positives = 19/31 (61%)
 Frame = +3

Query: 540 LTGAVHLSKNNAGVLRPAQRGQKPRVEQRAK 632
           + GA HL  +NA VLR A   QK  VEQ+ K
Sbjct: 1   MAGAAHLLNDNADVLRGAHGEQKSPVEQKGK 31


>UniRef50_Q54KK9 Cluster: Putative uncharacterized protein; n=2;
            Eukaryota|Rep: Putative uncharacterized protein -
            Dictyostelium discoideum AX4
          Length = 1472

 Score = 32.7 bits (71), Expect = 8.3
 Identities = 22/100 (22%), Positives = 44/100 (44%)
 Frame = -2

Query: 633  ALPFAPREVSVLSELALGHLRYSLTDVPPQSNSPPGSVLEPDTREF*TATSVSATSPLCT 454
            ++P +P   ++ S   +  L  S + +P Q+N+PP S+L     +  ++ + +  SP  T
Sbjct: 1183 SVPLSPPTKTIRSTRGVSSLSNSTSSLPKQTNTPPISILSRKRNQSQSSVTDAPLSP-TT 1241

Query: 453  LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETI 334
              T   +P     R       +  E  K++   +   ET+
Sbjct: 1242 TATTTTSPKPTTRRKGKLQETIPVEETKIIEETKPFEETV 1281


>UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 116

 Score = 32.7 bits (71), Expect = 8.3
 Identities = 18/32 (56%), Positives = 20/32 (62%)
 Frame = +1

Query: 529 RRGV*LGRYICQRITQVS*GQLREDRNLAWSK 624
           R GV LGR  CQ ITQ S  QL E+ NL  +K
Sbjct: 3   RGGVCLGRNACQTITQASQVQLSENGNLTQNK 34


>UniRef50_Q59VG8 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 584

 Score = 32.7 bits (71), Expect = 8.3
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = -2

Query: 567 SLTDVPPQSNSPPGSVLEPDTREF*TATSVSATSPLCT 454
           ++ DVP + N+P G V++P  + F T+T+ + TS   T
Sbjct: 378 TIHDVPDEMNAPKGKVMQPKRKSF-TSTTTTTTSSTTT 414


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 725,531,465
Number of Sequences: 1657284
Number of extensions: 15523482
Number of successful extensions: 42208
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 40358
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42159
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 51652897375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).