SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0012
         (399 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q05FX4 Cluster: Putative uncharacterized protein; n=1; ...    33   1.6  
UniRef50_A0BDA5 Cluster: Chromosome undetermined scaffold_10, wh...    33   1.6  

>UniRef50_Q05FX4 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Carsonella ruddii PV|Rep: Putative
           uncharacterized protein - Carsonella ruddii (strain PV)
          Length = 45

 Score = 33.5 bits (73), Expect = 1.6
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = +1

Query: 268 LKFYNNFIKKEIYIIYIVNKFYFIINYF 351
           L F  NF+ K+I+  +I  KF+FIINYF
Sbjct: 7   LNFVRNFLIKKIFF-FINKKFFFIINYF 33


>UniRef50_A0BDA5 Cluster: Chromosome undetermined scaffold_10, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_10,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 475

 Score = 33.5 bits (73), Expect = 1.6
 Identities = 18/42 (42%), Positives = 25/42 (59%)
 Frame = +2

Query: 86  LIISYCSINILNN*FEMKCYSFLNISSFYRKKFNFLLIRFSY 211
           LI+SYC++  L N F    Y +  I SFY  +F FL IR ++
Sbjct: 296 LILSYCAV--LFNEFNQSEYLYRKIISFYYPQFRFLQIRQNF 335


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,441,100
Number of Sequences: 1657284
Number of extensions: 1841494
Number of successful extensions: 4877
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4706
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4874
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 16926675320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).