SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0002
         (720 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n...    67   4e-10
UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513...    48   2e-04
UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: ...    40   0.062
UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ...    38   0.19 
UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lu...    36   1.3  
UniRef50_P22814 Cluster: Segmentation protein Runt; n=25; Dipter...    36   1.3  
UniRef50_Q0QMQ1 Cluster: Polyketide synthase type I; n=1; Strept...    33   5.4  
UniRef50_A4AUX2 Cluster: Transaldolase; n=1; Flavobacteriales ba...    33   9.4  

>UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1;
           Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry -
           Gallus gallus
          Length = 103

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 39/70 (55%), Positives = 44/70 (62%)
 Frame = -2

Query: 257 SRRTNATTSFLTATILVYXXXXXXXXXXXTRLALQLFLVKIFKVYSFRLRGLVRVPYRYF 78
           +R  + TTSFLTA  L+Y           TRLALQ  LVK FKV SF+L+GL RV Y YF
Sbjct: 34  ARSQDPTTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFKVDSFQLQGLERVLYCYF 93

Query: 77  SSLPPVPGVG 48
           SSLPP  G G
Sbjct: 94  SSLPPRVGSG 103


>UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130;
           n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY05130 - Plasmodium yoelii yoelii
          Length = 402

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 3/53 (5%)
 Frame = -2

Query: 608 GKCFR*CSSCDDPRISPLTSQYECPQLSLL---IITWSSENQQNRTEIIFYYS 459
           GKCFR C S ++ RISPLTS+Y+CPQ + +   +I  +    Q  TE+ F+ S
Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQATPINWPVIKRTPSRIQTMTEVTFFPS 311


>UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep:
           Predicted protein - Nematostella vectensis
          Length = 79

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 18/23 (78%), Positives = 18/23 (78%)
 Frame = +2

Query: 617 FHQSRTKVRGSKAIRYRPSSNRK 685
           F   RTKVRGSK IRYRPSSN K
Sbjct: 6   FRCQRTKVRGSKTIRYRPSSNHK 28


>UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 76

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 23/65 (35%), Positives = 36/65 (55%)
 Frame = -1

Query: 195 SWNYRGCWHQTCPPIVPR*NI*SVLIPITRPRKSPVSLFFVTTSRAGSG*FARLLPSLDV 16
           SWNYR CWHQT  P++    +     PI   ++   + + +   +  SG  +RLL  +D+
Sbjct: 7   SWNYRSCWHQT-GPLLGFGTV-ENRTPIHSTKRHQWN-WSLPPPKVSSGKVSRLLLPVDI 63

Query: 15  VAVSQ 1
           VA+SQ
Sbjct: 64  VAISQ 68


>UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 72

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/23 (69%), Positives = 16/23 (69%)
 Frame = +2

Query: 617 FHQSRTKVRGSKAIRYRPSSNRK 685
           FH  RTKV GSK IRY PS N K
Sbjct: 6   FHCQRTKVGGSKMIRYHPSLNHK 28


>UniRef50_P22814 Cluster: Segmentation protein Runt; n=25;
           Diptera|Rep: Segmentation protein Runt - Drosophila
           melanogaster (Fruit fly)
          Length = 510

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>UniRef50_Q0QMQ1 Cluster: Polyketide synthase type I; n=1;
            Streptomyces aculeolatus|Rep: Polyketide synthase type I
            - Streptomyces aculeolatus
          Length = 4308

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 15/48 (31%), Positives = 20/48 (41%)
 Frame = -1

Query: 195  SWNYRGCWHQTCPPIVPR*NI*SVLIPITRPRKSPVSLFFVTTSRAGS 52
            SW Y   WH   PP  PR  +    + +T P  SP +        AG+
Sbjct: 3664 SWRYTVTWHPHTPPAAPRAVLTGTWLLLTPPEASPPAALVAALEAAGA 3711


>UniRef50_A4AUX2 Cluster: Transaldolase; n=1; Flavobacteriales
           bacterium HTCC2170|Rep: Transaldolase - Flavobacteriales
           bacterium HTCC2170
          Length = 461

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 24/113 (21%), Positives = 50/113 (44%), Gaps = 4/113 (3%)
 Frame = -2

Query: 569 RISPLTSQYECPQLSLLIITWSSENQQNRTEIIFYYSMHEIFKQHF*PALSTLICSK*NC 390
           R   ++ + E P+LS     + +E   N  ++ +    +E    HF   LS + CS   C
Sbjct: 192 RHKKVSKKKEVPKLSKGFYAYRNELTYNNKDLTYLRPYYEYMVNHF-GNLSYMSCSH-GC 249

Query: 389 RPTSTLTEEH----RDRILILNRRFLERRLTDDMSANVSVSPRMRCTDSRRTN 243
                + + H    + ++ +++    E+ L D++  NV++   ++  DS   N
Sbjct: 250 DIKDKMAKNHLHFNKHKLKLIDSLVEEKELKDNLFRNVAIDYLLKVHDSEANN 302


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 697,218,456
Number of Sequences: 1657284
Number of extensions: 13645845
Number of successful extensions: 29775
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 28965
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29771
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 58264468239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).