SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0039
         (826 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P41658 Cluster: Late expression factor 5; n=13; Nucleop...   127   4e-28
UniRef50_UPI00015B4486 Cluster: PREDICTED: similar to pol polypr...   106   6e-22
UniRef50_A1YGR9 Cluster: Putative pol protein; n=1; Philodina ro...   106   6e-22
UniRef50_UPI0000F1DEA3 Cluster: PREDICTED: hypothetical protein;...   104   2e-21
UniRef50_UPI0000E471C8 Cluster: PREDICTED: similar to zinc finge...   104   2e-21
UniRef50_UPI00015B4620 Cluster: PREDICTED: similar to pol polypr...   101   2e-20
UniRef50_UPI00005480D8 Cluster: PREDICTED: similar to LReO_3; n=...   100   4e-20
UniRef50_Q8UUM8 Cluster: LReO_3 protein; n=1; Oryzias latipes|Re...   100   9e-20
UniRef50_UPI00015B4B9B Cluster: PREDICTED: hypothetical protein,...    99   1e-19
UniRef50_UPI0000F21214 Cluster: PREDICTED: similar to LReO_3; n=...    97   6e-19
UniRef50_UPI0000E49FEF Cluster: PREDICTED: similar to LReO_3; n=...    96   1e-18
UniRef50_UPI0000E4971F Cluster: PREDICTED: similar to LReO_3; n=...    96   1e-18
UniRef50_Q4T678 Cluster: Chromosome undetermined SCAF8884, whole...    95   2e-18
UniRef50_UPI0000660CC2 Cluster: Homolog of Oryzias latipes "LReO...    95   3e-18
UniRef50_Q54AM8 Cluster: Putative uncharacterized protein; n=1; ...    95   3e-18
UniRef50_UPI0000E471ED Cluster: PREDICTED: similar to zinc finge...    94   3e-18
UniRef50_A1YGS2 Cluster: Putative pol protein; n=4; Adineta vaga...    94   3e-18
UniRef50_UPI0000F1FF62 Cluster: signal transduction and activati...    94   4e-18
UniRef50_A4HHK8 Cluster: Putative uncharacterized protein; n=3; ...    93   6e-18
UniRef50_UPI00015B440C Cluster: PREDICTED: hypothetical protein;...    92   2e-17
UniRef50_UPI00015A72F6 Cluster: UPI00015A72F6 related cluster; n...    92   2e-17
UniRef50_UPI00015B468C Cluster: PREDICTED: hypothetical protein;...    91   4e-17
UniRef50_UPI0000F211A4 Cluster: PREDICTED: similar to LReO_3; n=...    89   2e-16
UniRef50_UPI0000F1F28A Cluster: PREDICTED: similar to LReO_3; n=...    89   2e-16
UniRef50_UPI0000F1FAA0 Cluster: PREDICTED: hypothetical protein;...    88   2e-16
UniRef50_UPI0000F2096A Cluster: exosome component 2; n=15; Danio...    88   3e-16
UniRef50_UPI0000F1D351 Cluster: PREDICTED: similar to zinc finge...    88   3e-16
UniRef50_UPI0000E46005 Cluster: PREDICTED: similar to zinc finge...    87   4e-16
UniRef50_Q1RL39 Cluster: Zinc finger protein; n=1; Ciona intesti...    87   4e-16
UniRef50_A5BTS7 Cluster: Putative uncharacterized protein; n=2; ...    87   5e-16
UniRef50_UPI00006611DC Cluster: Homolog of Oryzias latipes "LReO...    86   9e-16
UniRef50_A5AG41 Cluster: Putative uncharacterized protein; n=1; ...    86   1e-15
UniRef50_Q4QQD3 Cluster: Gag-pol polyprotein; n=3; Schistosoma|R...    86   1e-15
UniRef50_Q9GQ51 Cluster: Polyprotein; n=10; Dictyostelium discoi...    85   2e-15
UniRef50_P10394 Cluster: Retrovirus-related Pol polyprotein from...    85   2e-15
UniRef50_A5BVZ5 Cluster: Putative uncharacterized protein; n=3; ...    84   4e-15
UniRef50_Q9ZPF9 Cluster: F5K24.1 protein; n=2; Arabidopsis thali...    84   5e-15
UniRef50_UPI0000F1DB0A Cluster: PREDICTED: hypothetical protein,...    83   8e-15
UniRef50_UPI0000F20443 Cluster: PREDICTED: similar to pol polypr...    82   1e-14
UniRef50_A5BDT7 Cluster: Putative uncharacterized protein; n=2; ...    82   1e-14
UniRef50_UPI00015B455C Cluster: PREDICTED: hypothetical protein;...    82   2e-14
UniRef50_Q0ZCD2 Cluster: Integrase; n=1; Populus trichocarpa|Rep...    81   3e-14
UniRef50_Q0ZCC0 Cluster: Gag protein; n=2; Populus trichocarpa|R...    81   3e-14
UniRef50_Q0DJL7 Cluster: Os05g0263200 protein; n=13; Eukaryota|R...    81   3e-14
UniRef50_A5APW4 Cluster: Putative uncharacterized protein; n=3; ...    81   3e-14
UniRef50_UPI0000F1FB51 Cluster: PREDICTED: hypothetical protein;...    81   3e-14
UniRef50_UPI00005848C8 Cluster: PREDICTED: similar to OSJNBa0059...    81   3e-14
UniRef50_Q9LQH2 Cluster: F15O4.13; n=7; Eukaryota|Rep: F15O4.13 ...    81   3e-14
UniRef50_Q5MG92 Cluster: Putative retrotransposon polyprotein; n...    81   3e-14
UniRef50_A5B7N0 Cluster: Putative uncharacterized protein; n=21;...    81   3e-14
UniRef50_UPI0000F1FD8F Cluster: PREDICTED: hypothetical protein,...    81   4e-14
UniRef50_Q0ZCB7 Cluster: Integrase; n=3; Populus trichocarpa|Rep...    81   4e-14
UniRef50_A5C6G8 Cluster: Putative uncharacterized protein; n=4; ...    81   4e-14
UniRef50_A5C4R5 Cluster: Putative uncharacterized protein; n=1; ...    81   4e-14
UniRef50_A5C0S7 Cluster: Putative uncharacterized protein; n=2; ...    81   4e-14
UniRef50_A5BFS9 Cluster: Putative uncharacterized protein; n=15;...    81   4e-14
UniRef50_Q9Y8H1 Cluster: Reverse transcriptase-RNase H-integrase...    81   4e-14
UniRef50_UPI0000F1F902 Cluster: PREDICTED: similar to pol polypr...    80   6e-14
UniRef50_UPI0000F1DF9A Cluster: PREDICTED: similar to pol polypr...    80   6e-14
UniRef50_Q0GYC3 Cluster: Putative uncharacterized protein; n=2; ...    80   6e-14
UniRef50_Q5NRP7 Cluster: Putative gag-pol polyprotein, identical...    80   6e-14
UniRef50_Q5NRP3 Cluster: Gag-pol polyprotein, putative; n=1; Sol...    80   6e-14
UniRef50_Q9HFY7 Cluster: Pol protein; n=1; Glomerella cingulata|...    80   6e-14
UniRef50_A5BJN2 Cluster: Putative uncharacterized protein; n=4; ...    80   8e-14
UniRef50_A5B2X9 Cluster: Putative uncharacterized protein; n=3; ...    80   8e-14
UniRef50_A4RGB0 Cluster: Putative uncharacterized protein; n=23;...    80   8e-14
UniRef50_A4R3D0 Cluster: Putative uncharacterized protein; n=1; ...    80   8e-14
UniRef50_A7QXC8 Cluster: Chromosome undetermined scaffold_220, w...    79   1e-13
UniRef50_A5BY07 Cluster: Putative uncharacterized protein; n=3; ...    79   1e-13
UniRef50_A5BJP7 Cluster: Putative uncharacterized protein; n=6; ...    79   1e-13
UniRef50_Q53JQ7 Cluster: Retrotransposon protein, putative, Ty3-...    79   1e-13
UniRef50_Q53J67 Cluster: Retrotransposon protein, putative, Ty3-...    79   1e-13
UniRef50_Q9FZN9 Cluster: Retroelement pol polyprotein-like; n=7;...    79   2e-13
UniRef50_A5C2R0 Cluster: Putative uncharacterized protein; n=13;...    79   2e-13
UniRef50_A5BYC4 Cluster: Putative uncharacterized protein; n=4; ...    79   2e-13
UniRef50_A5BT93 Cluster: Putative uncharacterized protein; n=1; ...    79   2e-13
UniRef50_A5BFP8 Cluster: Putative uncharacterized protein; n=4; ...    79   2e-13
UniRef50_A5AY91 Cluster: Putative uncharacterized protein; n=3; ...    79   2e-13
UniRef50_A5ASD2 Cluster: Putative uncharacterized protein; n=8; ...    79   2e-13
UniRef50_A5ACN5 Cluster: Putative uncharacterized protein; n=6; ...    79   2e-13
UniRef50_Q7XPW2 Cluster: OSJNBa0032F06.19 protein; n=4; Eukaryot...    78   2e-13
UniRef50_Q2AA50 Cluster: Retrotransposon gag protein; n=6; Aspar...    78   2e-13
UniRef50_A5CBC2 Cluster: Putative uncharacterized protein; n=2; ...    78   2e-13
UniRef50_A5B5G8 Cluster: Putative uncharacterized protein; n=2; ...    78   2e-13
UniRef50_A5B346 Cluster: Putative uncharacterized protein; n=3; ...    78   2e-13
UniRef50_UPI0000F1ED4F Cluster: PREDICTED: similar to pol polypr...    78   3e-13
UniRef50_Q7XMR4 Cluster: OSJNBa0029L02.23 protein; n=8; Magnolio...    78   3e-13
UniRef50_Q53M59 Cluster: Retrotransposon protein, putative, Ty3-...    78   3e-13
UniRef50_A5C215 Cluster: Putative uncharacterized protein; n=2; ...    78   3e-13
UniRef50_A5BKJ4 Cluster: Putative uncharacterized protein; n=1; ...    78   3e-13
UniRef50_Q5AY31 Cluster: Putative uncharacterized protein; n=1; ...    78   3e-13
UniRef50_A4RKZ9 Cluster: Putative uncharacterized protein; n=3; ...    78   3e-13
UniRef50_Q9SUK5 Cluster: Retrotransposon like protein; n=3; Arab...    77   4e-13
UniRef50_Q9AYB6 Cluster: Polyprotein; n=47; Magnoliophyta|Rep: P...    77   4e-13
UniRef50_Q6WAY3 Cluster: Gag/pol polyprotein; n=7; core eudicoty...    77   4e-13
UniRef50_Q6MWI9 Cluster: B1159F04.11 protein; n=7; Oryza sativa|...    77   4e-13
UniRef50_A5B281 Cluster: Putative uncharacterized protein; n=2; ...    77   4e-13
UniRef50_Q9UVC1 Cluster: Pol polyprotein; n=2; Capnodiales|Rep: ...    77   4e-13
UniRef50_Q75LZ2 Cluster: Putative polyprotein; n=2; Oryza sativa...    77   5e-13
UniRef50_Q01L72 Cluster: H0321H01.8 protein; n=3; Eukaryota|Rep:...    77   5e-13
UniRef50_A5JSC4 Cluster: Polyprotein; n=8; Poaceae|Rep: Polyprot...    77   5e-13
UniRef50_A5BI07 Cluster: Putative uncharacterized protein; n=6; ...    77   5e-13
UniRef50_A5AQ81 Cluster: Putative uncharacterized protein; n=3; ...    77   5e-13
UniRef50_A5AHC2 Cluster: Putative uncharacterized protein; n=3; ...    77   5e-13
UniRef50_A5AH69 Cluster: Putative uncharacterized protein; n=1; ...    77   5e-13
UniRef50_A7K6N0 Cluster: Putative uncharacterized protein; n=11;...    77   5e-13
UniRef50_UPI0000F1E1CA Cluster: PREDICTED: hypothetical protein;...    77   7e-13
UniRef50_A5B284 Cluster: Putative uncharacterized protein; n=1; ...    77   7e-13
UniRef50_A6SRY0 Cluster: Putative uncharacterized protein; n=11;...    77   7e-13
UniRef50_UPI0000F1FC2A Cluster: PREDICTED: similar to LReO_3; n=...    76   9e-13
UniRef50_UPI0000E46419 Cluster: PREDICTED: similar to OSJNBa0011...    76   9e-13
UniRef50_Q53JH7 Cluster: Retrotransposon protein, putative, Ty3-...    76   9e-13
UniRef50_A5C0S4 Cluster: Putative uncharacterized protein; n=1; ...    76   9e-13
UniRef50_A5AH70 Cluster: Putative uncharacterized protein; n=3; ...    76   9e-13
UniRef50_A4RP66 Cluster: Putative uncharacterized protein; n=17;...    76   9e-13
UniRef50_A4QRY3 Cluster: Putative uncharacterized protein; n=35;...    76   9e-13
UniRef50_UPI0000E49332 Cluster: PREDICTED: similar to OSJNBa0011...    76   1e-12
UniRef50_Q7X7A3 Cluster: OSJNBa0014F04.1 protein; n=19; Poaceae|...    76   1e-12
UniRef50_A5C7V3 Cluster: Putative uncharacterized protein; n=2; ...    76   1e-12
UniRef50_UPI0000F1D47E Cluster: PREDICTED: similar to pol polypr...    75   2e-12
UniRef50_Q9LJS9 Cluster: Retroelement pol polyprotein-like; n=1;...    75   2e-12
UniRef50_A5BWD8 Cluster: Putative uncharacterized protein; n=1; ...    75   2e-12
UniRef50_A5AKV0 Cluster: Putative uncharacterized protein; n=13;...    75   2e-12
UniRef50_A5AJJ6 Cluster: Putative uncharacterized protein; n=4; ...    75   2e-12
UniRef50_A7BIS0 Cluster: Pro-pol protein; n=1; Lentinula edodes|...    75   2e-12
UniRef50_UPI0000E47C82 Cluster: PREDICTED: similar to LReO_3; n=...    75   2e-12
UniRef50_Q9ZS84 Cluster: Polyprotein; n=1; Solanum lycopersicum|...    75   2e-12
UniRef50_Q8RU68 Cluster: Putative 22 kDa kafirin cluster; Ty3-Gy...    75   2e-12
UniRef50_Q7XR39 Cluster: OSJNBa0014F04.8 protein; n=53; Magnolio...    75   2e-12
UniRef50_Q53NA3 Cluster: Retrotransposon protein, putative, uncl...    75   2e-12
UniRef50_Q53J91 Cluster: Retrotransposon protein, putative, Ty3-...    75   2e-12
UniRef50_Q2QSH3 Cluster: Retrotransposon protein, putative, Ty3-...    75   2e-12
UniRef50_Q0DC29 Cluster: Os06g0493000 protein; n=8; Eukaryota|Re...    75   2e-12
UniRef50_A5B1R6 Cluster: Putative uncharacterized protein; n=1; ...    75   2e-12
UniRef50_A5B0Q3 Cluster: Putative uncharacterized protein; n=2; ...    75   2e-12
UniRef50_UPI00015B47C8 Cluster: PREDICTED: similar to AT07338p; ...    75   3e-12
UniRef50_UPI0000E4917A Cluster: PREDICTED: similar to zinc finge...    75   3e-12
UniRef50_Q9SHM3 Cluster: F7F22.17; n=10; Arabidopsis thaliana|Re...    75   3e-12
UniRef50_Q8SB62 Cluster: Putative polyprotein; n=1; Oryza sativa...    75   3e-12
UniRef50_Q7XQM2 Cluster: OSJNBa0089E12.2 protein; n=79; Eukaryot...    75   3e-12
UniRef50_Q7XKP3 Cluster: OSJNBa0032N05.6 protein; n=3; Oryza sat...    75   3e-12
UniRef50_Q2QZV5 Cluster: Retrotransposon protein, putative, Ty3-...    75   3e-12
UniRef50_Q01N53 Cluster: OSIGBa0102B11.1 protein; n=47; Magnolio...    75   3e-12
UniRef50_Q01N00 Cluster: OSIGBa0132I10.1 protein; n=58; Magnolio...    75   3e-12
UniRef50_Q01JD2 Cluster: OSIGBa0130P02.7 protein; n=23; Oryza sa...    75   3e-12
UniRef50_A5BIJ0 Cluster: Putative uncharacterized protein; n=3; ...    75   3e-12
UniRef50_A5BI69 Cluster: Putative uncharacterized protein; n=1; ...    75   3e-12
UniRef50_A5AHJ4 Cluster: Putative uncharacterized protein; n=2; ...    75   3e-12
UniRef50_Q7XWI0 Cluster: OSJNBa0085C10.14 protein; n=25; Oryza s...    74   4e-12
UniRef50_Q7XW39 Cluster: OSJNBb0062H02.17 protein; n=5; Oryza sa...    74   4e-12
UniRef50_Q01JC4 Cluster: OSIGBa0122F23.6 protein; n=116; cellula...    74   4e-12
UniRef50_A5X2S4 Cluster: Polyprotein; n=3; Spermatophyta|Rep: Po...    74   4e-12
UniRef50_A5C6M0 Cluster: Putative uncharacterized protein; n=2; ...    74   4e-12
UniRef50_A5BKG7 Cluster: Putative uncharacterized protein; n=9; ...    74   4e-12
UniRef50_A5APQ1 Cluster: Putative uncharacterized protein; n=2; ...    74   4e-12
UniRef50_A5ACR1 Cluster: Putative uncharacterized protein; n=5; ...    74   4e-12
UniRef50_Q99315 Cluster: Transposon Ty3-G Gag-Pol polyprotein (G...    74   4e-12
UniRef50_Q94LP8 Cluster: Putative polyprotein; n=1; Oryza sativa...    74   5e-12
UniRef50_Q6VPE6 Cluster: Putative integrase; n=1; Petunia x hybr...    74   5e-12
UniRef50_Q6MWH2 Cluster: B1160F02.4 protein; n=2; Oryza sativa (...    74   5e-12
UniRef50_Q60ET2 Cluster: Putative polyprotein; n=1; Oryza sativa...    74   5e-12
UniRef50_Q2R3G0 Cluster: Retrotransposon protein, putative, uncl...    74   5e-12
UniRef50_A5C747 Cluster: Putative uncharacterized protein; n=1; ...    74   5e-12
UniRef50_A5AHS1 Cluster: Putative uncharacterized protein; n=2; ...    74   5e-12
UniRef50_Q2H755 Cluster: Putative uncharacterized protein; n=1; ...    74   5e-12
UniRef50_Q8JIZ1 Cluster: Polyprotein; n=1; Danio rerio|Rep: Poly...    73   7e-12
UniRef50_Q8S6W4 Cluster: Putative pol polyprotein; n=1; Oryza sa...    73   7e-12
UniRef50_Q7XQR0 Cluster: OSJNBa0091D06.9 protein; n=9; Oryza sat...    73   7e-12
UniRef50_Q7XPJ7 Cluster: OSJNBa0087O24.13 protein; n=5; Oryza sa...    73   7e-12
UniRef50_Q6L3M7 Cluster: Gag-pol protein, putative; n=4; Magnoli...    73   7e-12
UniRef50_Q53LW4 Cluster: Retrotransposon protein, putative, Ty3-...    73   7e-12
UniRef50_Q01JF4 Cluster: H0502G05.12 protein; n=33; Oryza sativa...    73   7e-12
UniRef50_A5BVP5 Cluster: Putative uncharacterized protein; n=5; ...    73   7e-12
UniRef50_A5B213 Cluster: Putative uncharacterized protein; n=1; ...    73   7e-12
UniRef50_A5AY22 Cluster: Putative uncharacterized protein; n=6; ...    73   7e-12
UniRef50_Q9AYC2 Cluster: Polyprotein; n=37; Oryza sativa|Rep: Po...    73   9e-12
UniRef50_Q94BM2 Cluster: Gag-pol polyprotein; n=29; Magnoliophyt...    73   9e-12
UniRef50_Q7XXG1 Cluster: OSJNBb0089K24.9 protein; n=1; Oryza sat...    73   9e-12
UniRef50_Q7F9N8 Cluster: OSJNBa0041M06.5 protein; n=2; Oryza sat...    73   9e-12
UniRef50_Q2QRZ1 Cluster: Retrotransposon protein, putative, Ty3-...    73   9e-12
UniRef50_A5CBL5 Cluster: Putative uncharacterized protein; n=3; ...    73   9e-12
UniRef50_A5AVY5 Cluster: Putative uncharacterized protein; n=2; ...    73   9e-12
UniRef50_Q9XZR7 Cluster: Protease, reverse transcriptase, ribonu...    73   9e-12
UniRef50_Q15F66 Cluster: Pol polyprotein; n=1; Nosema bombycis|R...    73   9e-12
UniRef50_UPI0000E49205 Cluster: PREDICTED: similar to novel tran...    73   1e-11
UniRef50_Q7XGB8 Cluster: Retrotransposon protein, putative, Ty3-...    73   1e-11
UniRef50_Q53KY4 Cluster: Retrotransposon protein, putative, Ty3-...    73   1e-11
UniRef50_A5CA05 Cluster: Putative uncharacterized protein; n=2; ...    73   1e-11
UniRef50_A5BXG2 Cluster: Putative uncharacterized protein; n=1; ...    73   1e-11
UniRef50_A5BSG6 Cluster: Putative uncharacterized protein; n=1; ...    73   1e-11
UniRef50_A5BQR4 Cluster: Putative uncharacterized protein; n=2; ...    73   1e-11
UniRef50_A5AIU0 Cluster: Putative uncharacterized protein; n=4; ...    73   1e-11
UniRef50_A2Q2J0 Cluster: RNA-directed DNA polymerase (Reverse tr...    73   1e-11
UniRef50_A1BPH1 Cluster: Pol polyprotein; n=4; cellular organism...    73   1e-11
UniRef50_Q6RYC6 Cluster: Gag-pol polyprotein; n=5; Dikarya|Rep: ...    73   1e-11
UniRef50_Q8S656 Cluster: Putative Sorghum bicolor 22 kDa kafirin...    72   2e-11
UniRef50_Q2R3R3 Cluster: Retrotransposon protein, putative, uncl...    72   2e-11
UniRef50_Q25AL5 Cluster: H0102C09.1 protein; n=5; Oryza sativa|R...    72   2e-11
UniRef50_Q10PF2 Cluster: Retrotransposon protein, putative, uncl...    72   2e-11
UniRef50_Q01LW3 Cluster: OSIGBa0139I12.1 protein; n=2; Oryza sat...    72   2e-11
UniRef50_A5BIQ2 Cluster: Putative uncharacterized protein; n=1; ...    72   2e-11
UniRef50_Q8L7J3 Cluster: Gag-pol polyprotein; n=30; Magnoliophyt...    72   2e-11
UniRef50_Q5JPZ2 Cluster: OSJNBa0004L19.22 protein; n=8; Oryza sa...    72   2e-11
UniRef50_A5BST7 Cluster: Putative uncharacterized protein; n=7; ...    72   2e-11
UniRef50_A5BJ88 Cluster: Putative uncharacterized protein; n=1; ...    72   2e-11
UniRef50_A5B5Q5 Cluster: Putative uncharacterized protein; n=2; ...    72   2e-11
UniRef50_A5B3D7 Cluster: Putative uncharacterized protein; n=12;...    72   2e-11
UniRef50_A5AVK2 Cluster: Putative uncharacterized protein; n=1; ...    72   2e-11
UniRef50_Q6CHG3 Cluster: Ylt1 protein; n=6; Yarrowia lipolytica|...    72   2e-11
UniRef50_Q68YT0 Cluster: Putative reverse transcriptase-RNaseH-i...    72   2e-11
UniRef50_Q1KTA8 Cluster: Pol polyprotein; n=1; Nosema bombycis|R...    72   2e-11
UniRef50_Q2VF30 Cluster: Polyprotein; n=1; Atlantic salmon swim ...    71   3e-11
UniRef50_Q9LP90 Cluster: T32E20.30; n=1; Arabidopsis thaliana|Re...    71   3e-11
UniRef50_Q7XR40 Cluster: OSJNBa0014F04.7 protein; n=8; Oryza sat...    71   3e-11
UniRef50_Q01MU8 Cluster: OSIGBa0102O13.8 protein; n=1; Oryza sat...    71   3e-11
UniRef50_A5APS1 Cluster: Putative uncharacterized protein; n=2; ...    71   3e-11
UniRef50_Q1EBQ6 Cluster: Putative uncharacterized protein; n=1; ...    71   3e-11
UniRef50_O93209 Cluster: Pro-Pol polyprotein (Pr125Pol) [Contain...    71   3e-11
UniRef50_Q53L81 Cluster: Retrotransposon protein, putative, Ty3-...    71   4e-11
UniRef50_Q0KIP3 Cluster: Polyprotein, 3'-partial, putative; n=4;...    71   4e-11
UniRef50_A5CA67 Cluster: Putative uncharacterized protein; n=1; ...    71   4e-11
UniRef50_UPI0000F1E5A7 Cluster: PREDICTED: similar to pol polypr...    71   5e-11
UniRef50_Q7XL81 Cluster: OSJNBb0014D23.8 protein; n=4; Oryza sat...    71   5e-11
UniRef50_Q53NJ3 Cluster: Retrotransposon protein, putative, uncl...    71   5e-11
UniRef50_Q2R3E6 Cluster: Retrotransposon protein, putative, Ty3-...    71   5e-11
UniRef50_A5C046 Cluster: Putative uncharacterized protein; n=3; ...    71   5e-11
UniRef50_A5BSX6 Cluster: Putative uncharacterized protein; n=1; ...    71   5e-11
UniRef50_A5B9Y2 Cluster: Putative uncharacterized protein; n=1; ...    71   5e-11
UniRef50_Q6H8S0 Cluster: Polyprotein; n=2; Yarrowia lipolytica|R...    71   5e-11
UniRef50_A4QZT8 Cluster: Putative uncharacterized protein; n=1; ...    71   5e-11
UniRef50_A4QQG5 Cluster: Putative uncharacterized protein; n=16;...    71   5e-11
UniRef50_UPI0000F1F6B2 Cluster: PREDICTED: similar to pol polypr...    70   6e-11
UniRef50_Q77K58 Cluster: Lef5; n=4; Nucleopolyhedrovirus|Rep: Le...    70   6e-11
UniRef50_Q65353 Cluster: ORF B; n=7; root|Rep: ORF B - Autograph...    70   6e-11
UniRef50_A5C623 Cluster: Putative uncharacterized protein; n=5; ...    70   6e-11
UniRef50_A5BWT5 Cluster: Putative uncharacterized protein; n=2; ...    70   6e-11
UniRef50_A5BSN7 Cluster: Putative uncharacterized protein; n=20;...    70   6e-11
UniRef50_Q8T4B4 Cluster: AT07338p; n=1; Drosophila melanogaster|...    70   6e-11
UniRef50_Q2QSI5 Cluster: Retrotransposon protein, putative, uncl...    70   8e-11
UniRef50_Q0ITS1 Cluster: Os11g0224300 protein; n=2; Oryza sativa...    70   8e-11
UniRef50_A5BQ80 Cluster: Putative uncharacterized protein; n=1; ...    70   8e-11
UniRef50_A5BCV2 Cluster: Putative uncharacterized protein; n=2; ...    70   8e-11
UniRef50_A5B385 Cluster: Putative uncharacterized protein; n=2; ...    70   8e-11
UniRef50_A5B326 Cluster: Putative uncharacterized protein; n=2; ...    70   8e-11
UniRef50_A5AQQ3 Cluster: Putative uncharacterized protein; n=1; ...    70   8e-11
UniRef50_A5APH5 Cluster: Putative uncharacterized protein; n=3; ...    70   8e-11
UniRef50_A5AJZ3 Cluster: Putative uncharacterized protein; n=1; ...    70   8e-11
UniRef50_A5AGD8 Cluster: Putative uncharacterized protein; n=3; ...    70   8e-11
UniRef50_Q9NL36 Cluster: Pol polyprotein; n=7; Bombyx mori|Rep: ...    70   8e-11
UniRef50_Q2HHU5 Cluster: Putative uncharacterized protein; n=2; ...    70   8e-11
UniRef50_UPI0000E46473 Cluster: PREDICTED: similar to Os07g04442...    69   1e-10
UniRef50_Q01JF9 Cluster: H0502G05.7 protein; n=16; Spermatophyta...    69   1e-10
UniRef50_Q2H3F3 Cluster: Putative uncharacterized protein; n=4; ...    69   1e-10
UniRef50_Q2GZI9 Cluster: Putative uncharacterized protein; n=1; ...    69   1e-10
UniRef50_A6SDN1 Cluster: Putative uncharacterized protein; n=3; ...    69   1e-10
UniRef50_Q0DHM6 Cluster: Os05g0456700 protein; n=1; Oryza sativa...    69   1e-10
UniRef50_A5BTF9 Cluster: Putative uncharacterized protein; n=1; ...    69   1e-10
UniRef50_A5BSR4 Cluster: Putative uncharacterized protein; n=1; ...    69   1e-10
UniRef50_A5BH93 Cluster: Putative uncharacterized protein; n=2; ...    69   1e-10
UniRef50_A5BGD9 Cluster: Putative uncharacterized protein; n=1; ...    69   1e-10
UniRef50_A5AZV8 Cluster: Putative uncharacterized protein; n=2; ...    69   1e-10
UniRef50_A5AWB8 Cluster: Putative uncharacterized protein; n=1; ...    69   1e-10
UniRef50_A5AVT2 Cluster: Putative uncharacterized protein; n=3; ...    69   1e-10
UniRef50_Q6GV81 Cluster: Pol protein; n=1; Oikopleura dioica|Rep...    69   1e-10
UniRef50_Q5AIP8 Cluster: Putative uncharacterized protein; n=1; ...    69   1e-10
UniRef50_Q05654 Cluster: Retrotransposable element Tf2 155 kDa p...    69   1e-10
UniRef50_UPI00015B4589 Cluster: PREDICTED: similar to protease, ...    69   2e-10
UniRef50_Q9AXC5 Cluster: Putative uncharacterized protein; n=1; ...    69   2e-10
UniRef50_Q2QTW2 Cluster: Retrotransposon protein, putative, Ty3-...    69   2e-10
UniRef50_A5BJ10 Cluster: Putative uncharacterized protein; n=3; ...    69   2e-10
UniRef50_A5B753 Cluster: Putative uncharacterized protein; n=2; ...    69   2e-10
UniRef50_A5B5S6 Cluster: Putative uncharacterized protein; n=2; ...    69   2e-10
UniRef50_A5B1F8 Cluster: Putative uncharacterized protein; n=1; ...    69   2e-10
UniRef50_A5AWI1 Cluster: Putative uncharacterized protein; n=1; ...    69   2e-10
UniRef50_A5AMC9 Cluster: Putative uncharacterized protein; n=1; ...    69   2e-10
UniRef50_A2Q2C7 Cluster: RNA-directed DNA polymerase (Reverse tr...    69   2e-10
UniRef50_A6R7Z7 Cluster: Putative uncharacterized protein; n=3; ...    69   2e-10
UniRef50_A6QZR6 Cluster: Putative uncharacterized protein; n=1; ...    69   2e-10
UniRef50_UPI0000F1F7D8 Cluster: PREDICTED: similar to pol polypr...    68   2e-10
UniRef50_Q2QUM2 Cluster: Retrotransposon protein, putative, uncl...    68   2e-10
UniRef50_Q0J3B5 Cluster: Os09g0135100 protein; n=1; Oryza sativa...    68   2e-10
UniRef50_A7TGN7 Cluster: Tkp3 protein; n=1; Vanderwaltozyma poly...    68   2e-10
UniRef50_UPI0000F1FA6A Cluster: PREDICTED: similar to pol polypr...    68   3e-10
UniRef50_Q6L428 Cluster: Putative integrase, identical; n=1; Sol...    68   3e-10
UniRef50_Q0J684 Cluster: Os08g0355100 protein; n=1; Oryza sativa...    68   3e-10
UniRef50_A5BRL2 Cluster: Putative uncharacterized protein; n=1; ...    68   3e-10
UniRef50_A5AZA3 Cluster: Putative uncharacterized protein; n=1; ...    68   3e-10
UniRef50_A5AKZ7 Cluster: Putative uncharacterized protein; n=1; ...    68   3e-10
UniRef50_Q2HHR9 Cluster: Putative uncharacterized protein; n=1; ...    68   3e-10
UniRef50_Q2H1S5 Cluster: Putative uncharacterized protein; n=2; ...    68   3e-10
UniRef50_Q6L4N0 Cluster: Putative uncharacterized protein P0530H...    67   4e-10
UniRef50_Q0DIN4 Cluster: Os05g0374700 protein; n=2; Oryza sativa...    67   4e-10
UniRef50_Q01KK6 Cluster: OSIGBa0118P15.5 protein; n=1; Oryza sat...    67   4e-10
UniRef50_A5C3V8 Cluster: Putative uncharacterized protein; n=2; ...    67   4e-10
UniRef50_A5C3T8 Cluster: Putative uncharacterized protein; n=1; ...    67   4e-10
UniRef50_A5BRB4 Cluster: Putative uncharacterized protein; n=2; ...    67   4e-10
UniRef50_A5BER9 Cluster: Putative uncharacterized protein; n=1; ...    67   4e-10
UniRef50_A5AFN1 Cluster: Putative uncharacterized protein; n=2; ...    67   4e-10
UniRef50_A2I5E5 Cluster: Retrotransposon protein; n=1; Beta vulg...    67   4e-10
UniRef50_Q5K8X3 Cluster: Retrotransposon nucleocapsid protein, p...    67   4e-10
UniRef50_Q55HB2 Cluster: Putative uncharacterized protein; n=1; ...    67   4e-10
UniRef50_UPI00015B43CA Cluster: PREDICTED: similar to protease, ...    67   6e-10
UniRef50_Q7Y006 Cluster: Putative polyprotein; n=2; Oryza sativa...    67   6e-10
UniRef50_Q7XCD6 Cluster: Retrotransposon protein, putative, uncl...    67   6e-10
UniRef50_Q2QPU3 Cluster: Retrotransposon protein, putative, uncl...    67   6e-10
UniRef50_A5B8V2 Cluster: Putative uncharacterized protein; n=1; ...    67   6e-10
UniRef50_A5ATI1 Cluster: Putative uncharacterized protein; n=1; ...    67   6e-10
UniRef50_Q54AL0 Cluster: Putative uncharacterized protein; n=1; ...    67   6e-10
UniRef50_UPI00015B4A3C Cluster: PREDICTED: similar to pol polypr...    66   8e-10
UniRef50_Q94GJ7 Cluster: Putative polyprotein; n=1; Oryza sativa...    66   8e-10
UniRef50_Q53L90 Cluster: Retrotransposon protein, putative, uncl...    66   8e-10
UniRef50_Q0JI68 Cluster: Os01g0820300 protein; n=1; Oryza sativa...    66   8e-10
UniRef50_A5AFF2 Cluster: Putative uncharacterized protein; n=3; ...    66   8e-10
UniRef50_A5AD56 Cluster: Putative uncharacterized protein; n=1; ...    66   8e-10
UniRef50_Q55TA9 Cluster: Putative uncharacterized protein; n=2; ...    66   8e-10
UniRef50_Q45W61 Cluster: Polyprotein; n=1; Phanerochaete chrysos...    66   8e-10
UniRef50_UPI0000E46771 Cluster: PREDICTED: similar to retrotrans...    66   1e-09
UniRef50_Q9ZPG1 Cluster: F5K24.7 protein; n=2; Arabidopsis thali...    66   1e-09
UniRef50_Q2R2N6 Cluster: Retrotransposon protein, putative, uncl...    66   1e-09
UniRef50_A5B5S8 Cluster: Putative uncharacterized protein; n=2; ...    66   1e-09
UniRef50_Q9BM80 Cluster: Gag-pol polyprotein; n=15; Bilateria|Re...    66   1e-09
UniRef50_Q7Y1L5 Cluster: Putative polyprotein; n=2; Oryza sativa...    66   1e-09
UniRef50_Q7XBS7 Cluster: Retrotransposon protein, putative, uncl...    66   1e-09
UniRef50_Q75J00 Cluster: Retrotransposon protein, putative, Ty3-...    66   1e-09
UniRef50_Q5MGC0 Cluster: Pol protein; n=2; Phytophthora|Rep: Pol...    66   1e-09
UniRef50_Q9XIG6 Cluster: T10P12.2 protein; n=1; Arabidopsis thal...    65   2e-09
UniRef50_Q7F9M4 Cluster: OSJNBa0017P10.11 protein; n=1; Oryza sa...    65   2e-09
UniRef50_Q8TFI2 Cluster: Pol protein; n=2; Kazachstania exigua|R...    65   2e-09
UniRef50_Q2H877 Cluster: Putative uncharacterized protein; n=2; ...    65   2e-09
UniRef50_UPI00015B47F6 Cluster: PREDICTED: similar to pol polypr...    65   2e-09
UniRef50_UPI00015B45BB Cluster: PREDICTED: similar to protease, ...    65   2e-09
UniRef50_UPI0000F1E568 Cluster: PREDICTED: similar to pol polypr...    65   2e-09
UniRef50_UPI00005A964A Cluster: PREDICTED: similar to Retrovirus...    65   2e-09
UniRef50_Q9LHM4 Cluster: Retroelement pol polyprotein; n=2; Arab...    65   2e-09
UniRef50_Q0ZCD3 Cluster: Integrase; n=1; Populus trichocarpa|Rep...    65   2e-09
UniRef50_A5BH73 Cluster: Putative uncharacterized protein; n=1; ...    65   2e-09
UniRef50_A5B2Q4 Cluster: Putative uncharacterized protein; n=1; ...    65   2e-09
UniRef50_A5B0T5 Cluster: Putative uncharacterized protein; n=1; ...    65   2e-09
UniRef50_A5AUP2 Cluster: Putative uncharacterized protein; n=39;...    65   2e-09
UniRef50_A5AI18 Cluster: Putative uncharacterized protein; n=2; ...    65   2e-09
UniRef50_O10344 Cluster: Late expression factor 5; n=8; Nucleopo...    65   2e-09
UniRef50_UPI00015B618C Cluster: PREDICTED: similar to protease, ...    64   3e-09
UniRef50_UPI00015B484B Cluster: PREDICTED: similar to protease, ...    64   3e-09
UniRef50_UPI00015B479F Cluster: PREDICTED: similar to gag-pol po...    64   3e-09
UniRef50_Q2QSH9 Cluster: Retrotransposon protein, putative, uncl...    64   3e-09
UniRef50_Q0INM7 Cluster: Os12g0428300 protein; n=1; Oryza sativa...    64   3e-09
UniRef50_A5C9I5 Cluster: Putative uncharacterized protein; n=2; ...    64   3e-09
UniRef50_Q9P262 Cluster: KIAA1466 protein; n=2; Homo sapiens|Rep...    64   3e-09
UniRef50_Q45W58 Cluster: Polyprotein; n=1; Phanerochaete chrysos...    64   3e-09
UniRef50_Q15F61 Cluster: Pol polyprotein; n=1; Nosema bombycis|R...    64   3e-09
UniRef50_UPI00015B48CA Cluster: PREDICTED: similar to protease, ...    64   4e-09
UniRef50_UPI00015B43DC Cluster: PREDICTED: similar to gag-pol po...    64   4e-09
UniRef50_UPI00015B487C Cluster: PREDICTED: similar to protease, ...    64   5e-09
UniRef50_Q8W0X6 Cluster: Putative prpol; n=1; Zea mays|Rep: Puta...    64   5e-09
UniRef50_Q8S744 Cluster: Putative retroelement; n=2; Oryza sativ...    64   5e-09
UniRef50_Q7XLE6 Cluster: OSJNBa0013A04.23 protein; n=1; Oryza sa...    64   5e-09
UniRef50_A5B5G7 Cluster: Putative uncharacterized protein; n=1; ...    64   5e-09
UniRef50_A5ALX4 Cluster: Putative uncharacterized protein; n=1; ...    64   5e-09
UniRef50_A5AGH9 Cluster: Putative uncharacterized protein; n=1; ...    64   5e-09
UniRef50_Q55HB4 Cluster: Putative uncharacterized protein; n=7; ...    64   5e-09
UniRef50_UPI00015B443A Cluster: PREDICTED: similar to protease, ...    63   7e-09
UniRef50_UPI00015B440F Cluster: PREDICTED: similar to protease, ...    63   7e-09
UniRef50_UPI0001556335 Cluster: PREDICTED: similar to pol protei...    63   7e-09
UniRef50_UPI0000F1E7B2 Cluster: PREDICTED: hypothetical protein;...    63   7e-09
UniRef50_Q7XWM4 Cluster: OSJNBb0052B05.5 protein; n=29; Oryza sa...    63   7e-09
UniRef50_Q0IR52 Cluster: Os11g0677100 protein; n=2; Oryza sativa...    63   7e-09
UniRef50_Q0DR72 Cluster: Os03g0411900 protein; n=8; Oryza sativa...    63   7e-09
UniRef50_A5BUN0 Cluster: Putative uncharacterized protein; n=2; ...    63   7e-09
UniRef50_A5B960 Cluster: Putative uncharacterized protein; n=1; ...    63   7e-09
UniRef50_UPI00015B47EB Cluster: PREDICTED: similar to pol polypr...    63   9e-09
UniRef50_UPI0000F21643 Cluster: PREDICTED: similar to pol polypr...    63   9e-09
UniRef50_O93284 Cluster: Pol polyprotein; n=57; Eukaryota|Rep: P...    63   9e-09
UniRef50_Q53PP0 Cluster: Retrotransposon protein, putative, uncl...    63   9e-09
UniRef50_A5C462 Cluster: Putative uncharacterized protein; n=6; ...    63   9e-09
UniRef50_A5C0Y9 Cluster: Putative uncharacterized protein; n=1; ...    63   9e-09
UniRef50_A5BVZ6 Cluster: Putative uncharacterized protein; n=1; ...    63   9e-09
UniRef50_A5BR83 Cluster: Putative uncharacterized protein; n=3; ...    63   9e-09
UniRef50_A5AZ22 Cluster: Putative uncharacterized protein; n=4; ...    63   9e-09
UniRef50_Q6GV77 Cluster: Pol protein; n=1; Oikopleura dioica|Rep...    63   9e-09
UniRef50_Q9NXP7 Cluster: CDNA FLJ20125 fis, clone COL06152; n=29...    63   9e-09
UniRef50_Q9UVD8 Cluster: Pol; n=1; Alternaria alternata|Rep: Pol...    63   9e-09
UniRef50_A4RNQ6 Cluster: Putative uncharacterized protein; n=3; ...    63   9e-09
UniRef50_UPI00015B4654 Cluster: PREDICTED: similar to reverse tr...    62   1e-08
UniRef50_UPI00015B43C6 Cluster: PREDICTED: similar to pol polypr...    62   1e-08
UniRef50_Q8SB48 Cluster: Putative polyprotein; n=1; Oryza sativa...    62   1e-08
UniRef50_Q84ZV5 Cluster: Polyprotein; n=2; Papilionoideae|Rep: P...    62   1e-08
UniRef50_Q7XQC1 Cluster: OSJNBb0060M15.10 protein; n=2; Oryza sa...    62   1e-08
UniRef50_A5BRX9 Cluster: Putative uncharacterized protein; n=9; ...    62   1e-08
UniRef50_A5BLS3 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_UPI00015B4C81 Cluster: PREDICTED: similar to polyprotei...    62   2e-08
UniRef50_Q9ZVK4 Cluster: Putative retroelement pol polyprotein; ...    62   2e-08
UniRef50_Q2QWF9 Cluster: Retrotransposon protein, putative, uncl...    62   2e-08
UniRef50_Q10RT2 Cluster: Retrotransposon protein, putative, uncl...    62   2e-08
UniRef50_UPI0000F1FB27 Cluster: PREDICTED: similar to novel tran...    62   2e-08
UniRef50_UPI0000F1EFFF Cluster: PREDICTED: hypothetical protein;...    62   2e-08
UniRef50_Q9ZVK3 Cluster: Putative retroelement pol polyprotein; ...    62   2e-08
UniRef50_A5C995 Cluster: Putative uncharacterized protein; n=1; ...    62   2e-08
UniRef50_A5BBU5 Cluster: Putative uncharacterized protein; n=1; ...    62   2e-08
UniRef50_A5B0D2 Cluster: Putative uncharacterized protein; n=1; ...    62   2e-08
UniRef50_A5ATZ0 Cluster: Putative uncharacterized protein; n=1; ...    62   2e-08
UniRef50_A5AHC0 Cluster: Putative uncharacterized protein; n=3; ...    62   2e-08
UniRef50_Q2H2Q7 Cluster: Putative uncharacterized protein; n=1; ...    62   2e-08
UniRef50_Q15F65 Cluster: Pol polyprotein; n=1; Nosema bombycis|R...    62   2e-08
UniRef50_A6QU58 Cluster: Predicted protein; n=10; Ajellomyces ca...    62   2e-08
UniRef50_UPI00015B4786 Cluster: PREDICTED: hypothetical protein;...    61   3e-08
UniRef50_UPI0000F1DD74 Cluster: PREDICTED: hypothetical protein;...    61   3e-08
UniRef50_Q6MWC6 Cluster: B1292H11.5 protein; n=1; Oryza sativa (...    61   3e-08
UniRef50_Q2R0G5 Cluster: Retrotransposon protein, putative, uncl...    61   3e-08
UniRef50_A5BMD2 Cluster: Putative uncharacterized protein; n=1; ...    61   3e-08
UniRef50_A5B7W0 Cluster: Putative uncharacterized protein; n=1; ...    61   3e-08
UniRef50_A5ALE1 Cluster: Putative uncharacterized protein; n=1; ...    61   3e-08
UniRef50_Q2H7V8 Cluster: Putative uncharacterized protein; n=1; ...    61   3e-08
UniRef50_A6RWX4 Cluster: Putative uncharacterized protein; n=1; ...    61   3e-08
UniRef50_P32542 Cluster: Pol polyprotein [Contains: Protease (Re...    61   3e-08
UniRef50_Q53KC9 Cluster: Retrotransposon protein, putative, uncl...    61   4e-08
UniRef50_Q10I05 Cluster: Retrotransposon protein, putative, uncl...    61   4e-08
UniRef50_Q0D7Z1 Cluster: Os07g0195900 protein; n=1; Oryza sativa...    61   4e-08
UniRef50_Q01M82 Cluster: H0622G10.2 protein; n=47; Oryza|Rep: H0...    61   4e-08
UniRef50_UPI00015B4647 Cluster: PREDICTED: similar to pol polypr...    60   5e-08
UniRef50_UPI00015B43F4 Cluster: PREDICTED: similar to pol polypr...    60   5e-08
UniRef50_Q0IL15 Cluster: Lef-5; n=5; Nucleopolyhedrovirus|Rep: L...    60   5e-08
UniRef50_Q8LLB6 Cluster: Sukkula-1b polyprotein; n=3; Hordeum vu...    60   5e-08
UniRef50_Q53J28 Cluster: Reverse transcriptase (RNA-dependent DN...    60   5e-08
UniRef50_A5C4S0 Cluster: Putative uncharacterized protein; n=1; ...    60   5e-08
UniRef50_A5BWP6 Cluster: Putative uncharacterized protein; n=1; ...    60   5e-08
UniRef50_A5AZY6 Cluster: Putative uncharacterized protein; n=5; ...    60   5e-08
UniRef50_Q8NJU6 Cluster: Pol; n=4; Candida albicans|Rep: Pol - C...    60   5e-08
UniRef50_UPI0000E470CF Cluster: PREDICTED: hypothetical protein;...    60   7e-08
UniRef50_Q5H9V4 Cluster: B1168G10.16 protein; n=2; Oryza sativa|...    60   7e-08
UniRef50_Q88285 Cluster: Gag-pol polyprotein; n=3; Snakehead ret...    60   9e-08
UniRef50_Q9XIG5 Cluster: T10P12.3 protein; n=1; Arabidopsis thal...    60   9e-08
UniRef50_Q8SA85 Cluster: Prpol; n=6; Andropogoneae|Rep: Prpol - ...    60   9e-08
UniRef50_Q2GUG1 Cluster: Putative uncharacterized protein; n=1; ...    60   9e-08
UniRef50_UPI00015B4B68 Cluster: PREDICTED: similar to SD02026p; ...    59   1e-07
UniRef50_UPI00015B47AA Cluster: PREDICTED: similar to pol polypr...    59   1e-07
UniRef50_Q2R431 Cluster: Retrotransposon protein, putative, Ty3-...    59   1e-07
UniRef50_Q2QV23 Cluster: Retrotransposon protein, putative, uncl...    59   1e-07
UniRef50_Q2QTA7 Cluster: Retrotransposon protein, putative, Ty3-...    59   1e-07
UniRef50_Q2QT03 Cluster: Retrotransposon protein, putative, uncl...    59   1e-07
UniRef50_Q2QSA6 Cluster: Retrotransposon protein, putative, uncl...    59   1e-07
UniRef50_A5B3V3 Cluster: Putative uncharacterized protein; n=2; ...    59   1e-07
UniRef50_A5AKD6 Cluster: Putative uncharacterized protein; n=1; ...    59   1e-07
UniRef50_Q967S6 Cluster: Reverse transcriptase-like polymerase; ...    59   1e-07
UniRef50_Q6IFT8 Cluster: Pol polyprotein; n=1; Schistosoma manso...    59   1e-07
UniRef50_Q2GN40 Cluster: Putative uncharacterized protein; n=2; ...    59   1e-07
UniRef50_UPI00015B47C1 Cluster: PREDICTED: similar to gag-pol po...    59   2e-07
UniRef50_Q9SKV5 Cluster: F5J5.15; n=3; Arabidopsis thaliana|Rep:...    59   2e-07
UniRef50_Q5C1R3 Cluster: SJCHGC05324 protein; n=2; Schistosoma j...    59   2e-07
UniRef50_UPI0000F1E445 Cluster: PREDICTED: similar to pol polypr...    58   2e-07
UniRef50_Q8SB13 Cluster: Putative gag-pol polyprotein; n=1; Oryz...    58   2e-07
UniRef50_Q6MWI5 Cluster: B1159F04.15 protein; n=18; Oryza sativa...    58   2e-07
UniRef50_Q53KZ6 Cluster: Retrotransposon protein, putative, uncl...    58   2e-07
UniRef50_Q53JS9 Cluster: Retrotransposon protein, putative, Ty3-...    58   2e-07
UniRef50_Q2RB69 Cluster: Retrotransposon protein, putative, uncl...    58   2e-07
UniRef50_Q0J6I3 Cluster: Os08g0317200 protein; n=2; Oryza sativa...    58   2e-07
UniRef50_Q01M69 Cluster: OSIGBa0114M03.4 protein; n=10; Oryza sa...    58   2e-07
UniRef50_A5B7N2 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q24262 Cluster: Blastopia polyprotein; n=2; Drosophila ...    58   2e-07
UniRef50_Q6UUI7 Cluster: Putative gag-pol; n=1; Oryza sativa (ja...    58   3e-07
UniRef50_Q53L38 Cluster: Retrotransposon protein, putative, uncl...    58   3e-07
UniRef50_Q2R233 Cluster: Retrotransposon protein, putative, uncl...    58   3e-07
UniRef50_Q2QVT0 Cluster: Retrotransposon protein, putative, uncl...    58   3e-07
UniRef50_Q10I89 Cluster: Retrotransposon protein, putative, uncl...    58   3e-07
UniRef50_Q01IP3 Cluster: H0115B09.9 protein; n=3; Magnoliophyta|...    58   3e-07
UniRef50_A5B6D9 Cluster: Putative uncharacterized protein; n=2; ...    58   3e-07
UniRef50_Q5KTM2 Cluster: Reverse transcriptase; n=1; Bombyx mori...    58   3e-07
UniRef50_UPI0000F2D71A Cluster: PREDICTED: similar to hCG2041411...    58   4e-07
UniRef50_Q7XU19 Cluster: OSJNBa0091D06.19 protein; n=18; Oryza s...    58   4e-07
UniRef50_Q7X8Q5 Cluster: OSJNBa0079A21.2 protein; n=57; Oryza sa...    58   4e-07
UniRef50_Q7G776 Cluster: Putative retrotransposon polyprotein; n...    58   4e-07
UniRef50_Q75I41 Cluster: Retrotransposon protein, putative, uncl...    58   4e-07
UniRef50_Q3I6J4 Cluster: Pol-polyprotein; n=3; Caryophyllales|Re...    58   4e-07
UniRef50_Q2QU12 Cluster: Retrotransposon protein, putative, Ty3-...    58   4e-07
UniRef50_Q2QMM2 Cluster: Retrotransposon protein, putative, uncl...    58   4e-07
UniRef50_Q0DFM2 Cluster: Os05g0582200 protein; n=4; Oryza sativa...    58   4e-07
UniRef50_A5C4G7 Cluster: Putative uncharacterized protein; n=1; ...    58   4e-07
UniRef50_A5C1Z6 Cluster: Putative uncharacterized protein; n=1; ...    58   4e-07
UniRef50_A5C043 Cluster: Putative uncharacterized protein; n=5; ...    58   4e-07
UniRef50_UPI00015B440E Cluster: PREDICTED: similar to AT07338p; ...    57   5e-07
UniRef50_Q5H9V9 Cluster: B1168G10.11 protein; n=4; Oryza sativa|...    57   5e-07
UniRef50_Q01LE0 Cluster: OSIGBa0096P03.5 protein; n=31; Eukaryot...    57   5e-07
UniRef50_A5C7Y5 Cluster: Putative uncharacterized protein; n=1; ...    57   5e-07
UniRef50_A5AYF0 Cluster: Putative uncharacterized protein; n=1; ...    57   5e-07
UniRef50_UPI00015B488B Cluster: PREDICTED: hypothetical protein;...    57   6e-07
UniRef50_Q9SQW9 Cluster: Putative retroelement pol polyprotein; ...    57   6e-07
UniRef50_Q53JT7 Cluster: Retrotransposon protein, putative, uncl...    57   6e-07
UniRef50_Q01N27 Cluster: OSIGBa0124C14.4 protein; n=15; Oryza sa...    57   6e-07
UniRef50_A5C7Y9 Cluster: Putative uncharacterized protein; n=1; ...    57   6e-07
UniRef50_A5AEK4 Cluster: Putative uncharacterized protein; n=2; ...    57   6e-07
UniRef50_Q5C1N6 Cluster: SJCHGC03096 protein; n=1; Schistosoma j...    57   6e-07
UniRef50_P34431 Cluster: Uncharacterized protein F44E2.2; n=5; C...    57   6e-07
UniRef50_Q2QZU9 Cluster: Retrotransposon protein, putative, Ty3-...    56   8e-07
UniRef50_Q2QR46 Cluster: Retrotransposon protein, putative, uncl...    56   8e-07
UniRef50_A5BY14 Cluster: Putative uncharacterized protein; n=1; ...    56   8e-07
UniRef50_A5BP54 Cluster: Putative uncharacterized protein; n=1; ...    56   8e-07
UniRef50_A5AUK0 Cluster: Putative uncharacterized protein; n=3; ...    56   8e-07
UniRef50_A5ANL6 Cluster: Putative uncharacterized protein; n=1; ...    56   8e-07
UniRef50_Q5D9T2 Cluster: SJCHGC06920 protein; n=1; Schistosoma j...    56   8e-07
UniRef50_Q5EMU5 Cluster: Retrotransposable element Tf2 protein-l...    56   8e-07
UniRef50_UPI0000F2BD89 Cluster: PREDICTED: similar to polyprotei...    56   1e-06

>UniRef50_P41658 Cluster: Late expression factor 5; n=13;
           Nucleopolyhedrovirus|Rep: Late expression factor 5 -
           Autographa californica nuclear polyhedrosis virus
           (AcMNPV)
          Length = 265

 Score =  127 bits (306), Expect = 4e-28
 Identities = 57/59 (96%), Positives = 59/59 (100%)
 Frame = +3

Query: 9   LNDKVIYLQNSNKNKLFELSGLSLKSCRHDFVTVESQTRAGDEIASFLRYCRMCGMSGC 185
           LNDKVIYLQNSNKNKLFELSGLSLKSCRHDFVTVESQTRAGDEIASF+RYCR+CGMSGC
Sbjct: 207 LNDKVIYLQNSNKNKLFELSGLSLKSCRHDFVTVESQTRAGDEIASFIRYCRLCGMSGC 265


>UniRef50_UPI00015B4486 Cluster: PREDICTED: similar to pol
            polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
            similar to pol polyprotein - Nasonia vitripennis
          Length = 1743

 Score =  106 bits (255), Expect = 6e-22
 Identities = 51/135 (37%), Positives = 78/135 (57%), Gaps = 1/135 (0%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P  +++DQG++F ++++++  R+F I     + YHPQ  G++ER H TL EYLR Y V
Sbjct: 932  GPPAALVSDQGSHFQNKILEEFARIFKINKFCTTAYHPQANGSIERMHHTLTEYLRKY-V 990

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL-DLNTYSDYIRAL 467
                TWD +      AYN   H +T +SP ELLFGFKP  P S   + D  +Y++Y+  +
Sbjct: 991  RRADTWDEWTAVCQHAYNCTEHESTRYSPHELLFGFKPRTPSSFPRVSDDMSYNNYLTEM 1050

Query: 466  NHRLYYSRQKALQNI 422
             + L   +  A  N+
Sbjct: 1051 TNNLTALQTTAAMNL 1065


>UniRef50_A1YGR9 Cluster: Putative pol protein; n=1; Philodina
            roseola|Rep: Putative pol protein - Philodina roseola
          Length = 1269

 Score =  106 bits (255), Expect = 6e-22
 Identities = 52/136 (38%), Positives = 73/136 (53%), Gaps = 2/136 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P +II+DQG++F +E+M  +  L G  HIF++PYHPQT G + R +ST    +     
Sbjct: 1054 GVPGLIISDQGSHFRNELMSSMRTLIGYNHIFSTPYHPQTNGIVGRFNSTFIPQISKLQD 1113

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP--KSIDSLDLNTYSDYIRA 470
               + WD YL+  + AYNS +H TT +SP ELL+G  P +P             +DY   
Sbjct: 1114 SENNNWDEYLQAVVFAYNSGVHKTTNYSPYELLYGRPPRLPFYSKPSHFSFRQPNDYFEQ 1173

Query: 469  LNHRLYYSRQKALQNI 422
            L   L    Q A  NI
Sbjct: 1174 LRKTLKIYNQSARFNI 1189


>UniRef50_UPI0000F1DEA3 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 934

 Score =  104 bits (250), Expect = 2e-21
 Identities = 53/141 (37%), Positives = 84/141 (59%), Gaps = 7/141 (4%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PKII TD+G NF+S++ +++ + FG+ H  +SPYHP++ GA+ER H TLK  LRS+ V
Sbjct: 291 GLPKIIQTDRGTNFTSKMFEKVLKEFGVNHQLSSPYHPESQGAIERFHQTLKTMLRSFCV 350

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDL-------NTYS 485
           E    W+  L   + A    +  + GFSP EL+FG     P  + S  L        T  
Sbjct: 351 ETGKDWEEGLPFLLFAVRETVQESLGFSPAELVFGHTIRGPLKLLSEQLLTEHPTAMTVP 410

Query: 484 DYIRALNHRLYYSRQKALQNI 422
           DY++++  +L+ +R+ A Q++
Sbjct: 411 DYVQSIRQKLHCAREVAKQHL 431


>UniRef50_UPI0000E471C8 Cluster: PREDICTED: similar to zinc finger
            protein; n=6; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to zinc finger protein -
            Strongylocentrotus purpuratus
          Length = 1487

 Score =  104 bits (250), Expect = 2e-21
 Identities = 55/144 (38%), Positives = 79/144 (54%), Gaps = 9/144 (6%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            +GIP+ ++TD+G+ F+SE+MK++ RLF I+ +  +PYHP   G +ER + TLK  LR   
Sbjct: 746  VGIPREVLTDRGSQFTSELMKEVSRLFSIRQMTTTPYHPACNGLVERFNGTLKSMLRKMC 805

Query: 646  VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI---------DSLDLN 494
             E    W  YL   + AY  ++  +TGFSP ELLFG     P +I         D  D  
Sbjct: 806  EERPKDWGRYLNPLLFAYRESVQESTGFSPFELLFGRAVRGPLAILRELWTGEVDEPDTK 865

Query: 493  TYSDYIRALNHRLYYSRQKALQNI 422
            T   Y+  L  RL  + + A QN+
Sbjct: 866  TTYQYVLDLKDRLQLTCEVAQQNL 889


>UniRef50_UPI00015B4620 Cluster: PREDICTED: similar to pol
           polyprotein; n=2; Nasonia vitripennis|Rep: PREDICTED:
           similar to pol polyprotein - Nasonia vitripennis
          Length = 332

 Score =  101 bits (242), Expect = 2e-20
 Identities = 50/129 (38%), Positives = 72/129 (55%), Gaps = 6/129 (4%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  + TDQG N  S+++K L  L GIK    SP HPQ+ G +ER H TL  YL  YI 
Sbjct: 174 GVPLEVNTDQGTNIDSKLIKNLSELLGIKKTRTSPLHPQSNGQVERQHQTLLHYLTKYIH 233

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI------DSLDLNTYSD 482
           +NQ  WD ++   +LAY S+ H+TTG +P E+  GF   +P  +        +++    D
Sbjct: 234 DNQKDWDRWVSLFLLAYRSSKHATTGATPAEMYTGFDLRLPLDLIRGCLPQEVEIKGDRD 293

Query: 481 YIRALNHRL 455
           Y+  L  +L
Sbjct: 294 YVHRLRRKL 302


>UniRef50_UPI00005480D8 Cluster: PREDICTED: similar to LReO_3; n=12;
            Danio rerio|Rep: PREDICTED: similar to LReO_3 - Danio
            rerio
          Length = 1520

 Score =  100 bits (240), Expect = 4e-20
 Identities = 46/98 (46%), Positives = 64/98 (65%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            +G P+ IITDQG NF+S +M+ L +  GI  I  SPYHPQT G +ER + TLK  LR ++
Sbjct: 740  VGFPQEIITDQGTNFTSRLMQLLHKQLGIHSIRTSPYHPQTDGLVERFNQTLKRMLRKFV 799

Query: 646  VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
             +N   WD +L   + AY     ++TGFSP ELL+G++
Sbjct: 800  SDNGKDWDKWLPFLLYAYREVPQASTGFSPFELLYGWQ 837


>UniRef50_Q8UUM8 Cluster: LReO_3 protein; n=1; Oryzias latipes|Rep:
            LReO_3 protein - Oryzias latipes (Medaka fish) (Japanese
            ricefish)
          Length = 1498

 Score = 99.5 bits (237), Expect = 9e-20
 Identities = 46/96 (47%), Positives = 63/96 (65%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            +GIPK I+TD G NF S+++KQ+  L G+K I  +PYHPQT G +ER + TLK  LR ++
Sbjct: 777  VGIPKEILTDCGTNFLSKLLKQVYSLLGVKGIKTTPYHPQTDGLVERFNQTLKTMLRKFV 836

Query: 646  VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             E    WD +L   + AY     ++TGFSP ELL+G
Sbjct: 837  SETGADWDQWLPYLLFAYREVPQASTGFSPFELLYG 872


>UniRef50_UPI00015B4B9B Cluster: PREDICTED: hypothetical protein,
            partial; n=1; Nasonia vitripennis|Rep: PREDICTED:
            hypothetical protein, partial - Nasonia vitripennis
          Length = 2637

 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 55/138 (39%), Positives = 83/138 (60%), Gaps = 4/138 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P++++TDQG NF S++M ++ + F IK I  + +HPQ+ G+LERSH  L E+L+ YI 
Sbjct: 1616 GAPRVVLTDQGQNFLSKLMGRIAKRFKIKRIRTTAFHPQSNGSLERSHHALSEFLKMYI- 1674

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLD----LNTYSDYI 476
            +  + WD +L  AML YN+ +  +T  +P E++FG    +P S D L     L TY+ YI
Sbjct: 1675 DKDNEWDDWLEIAMLNYNTCVQESTKHTPFEVVFGKLARLP-SNDPLREGDLLPTYNGYI 1733

Query: 475  RALNHRLYYSRQKALQNI 422
              L  RL   R+    N+
Sbjct: 1734 VDLVTRLTGIRRLVYDNL 1751


>UniRef50_UPI0000F21214 Cluster: PREDICTED: similar to LReO_3; n=6;
           Danio rerio|Rep: PREDICTED: similar to LReO_3 - Danio
           rerio
          Length = 1293

 Score = 96.7 bits (230), Expect = 6e-19
 Identities = 46/105 (43%), Positives = 63/105 (60%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           +GIP  IITDQG NF S VM Q  +  GIK +  +PYHPQT G +ER + TLK  LR ++
Sbjct: 545 VGIPDEIITDQGTNFMSRVMTQFHQQLGIKALKTTPYHPQTDGLVERFNGTLKSMLRKFV 604

Query: 646 VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
            +    W+ +L   + AY     ++TGF+P ELL+G+    P  I
Sbjct: 605 SDTGKDWNKWLPFLLFAYREVPQASTGFAPFELLYGWPVQGPLDI 649


>UniRef50_UPI0000E49FEF Cluster: PREDICTED: similar to LReO_3; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           LReO_3 - Strongylocentrotus purpuratus
          Length = 1320

 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 45/104 (43%), Positives = 65/104 (62%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  I +DQG+NF+S V +++    GIK I +S YHPQ+ GALER H TLK  ++SY +
Sbjct: 514 GLPHEIQSDQGSNFTSNVFQEVMYQLGIKQINSSAYHPQSQGALERYHQTLKTMIKSYCL 573

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
           EN   WD  +   + A     + +TGF+P EL+FG +P  P  +
Sbjct: 574 ENSGDWDKGIPFLLFASRDTPNDSTGFTPFELVFGHEPRGPLKV 617


>UniRef50_UPI0000E4971F Cluster: PREDICTED: similar to LReO_3; n=2;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            LReO_3 - Strongylocentrotus purpuratus
          Length = 893

 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 48/142 (33%), Positives = 79/142 (55%), Gaps = 7/142 (4%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            +G+PK + +DQG+NF S V+ Q+ +  GIKH+ +S YHP++ GALER H TLK  L++Y 
Sbjct: 590  VGLPKTVQSDQGSNFMSRVVNQVLKELGIKHVVSSAYHPESQGALERFHQTLKNMLKTYC 649

Query: 646  VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI-------DSLDLNTY 488
            +E++  WD  +   + A    +  + GFS  EL++G     P  +       D    N  
Sbjct: 650  MESEKQWDEGVPLLLFAVRDAVQESLGFSSFELVYGHSVRGPLKLLKERLLCDDSQANVL 709

Query: 487  SDYIRALNHRLYYSRQKALQNI 422
             +Y+     R++ + + A QN+
Sbjct: 710  -EYVSTFRERMHKAWEVARQNL 730


>UniRef50_Q4T678 Cluster: Chromosome undetermined SCAF8884, whole
            genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
            Chromosome undetermined SCAF8884, whole genome shotgun
            sequence - Tetraodon nigroviridis (Green puffer)
          Length = 1457

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 49/118 (41%), Positives = 66/118 (55%), Gaps = 3/118 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+ I TDQGANF SE++ +L  L G+     SPYHP   GA ER + TL   LRS   
Sbjct: 1091 GFPQRIHTDQGANFESELLAELLMLSGVSKSHTSPYHPMGNGAAERFNRTLGNMLRSLPP 1150

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI---DSLDLNTYSDY 479
             ++  W   +++   AYN  +H TTGF+P  L+FG  P +P  +   + L  NT  DY
Sbjct: 1151 RSKQKWPQMIQSLTFAYNCTVHETTGFAPFYLMFGRVPRLPVDLMFRNVLQDNTVCDY 1208



 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 45/114 (39%), Positives = 63/114 (55%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+ I TDQGANF SE++ +L  L G+     SPYHP   GA ER + TL   LRS   
Sbjct: 242 GFPQRIHTDQGANFESELLAELLMLSGVSKSHTSPYHPMGNGAAERFNRTLGNMLRSLPP 301

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
            ++  W   +++   A+N  +H TTGF+   L+FG  P +P  +D +  N   D
Sbjct: 302 RSKQKWPQMIQSLTFAHNCTVHETTGFAHFYLMFGRVPRLP--VDLMFRNVLQD 353


>UniRef50_UPI0000660CC2 Cluster: Homolog of Oryzias latipes "LReO_3
           protein.; n=11; Clupeocephala|Rep: Homolog of Oryzias
           latipes "LReO_3 protein. - Takifugu rubripes
          Length = 340

 Score = 94.7 bits (225), Expect = 3e-18
 Identities = 49/142 (34%), Positives = 80/142 (56%), Gaps = 8/142 (5%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK++ TDQG+NF S + +Q+ ++  +KH  +S YHP++ GALER+H  LK  LR Y +
Sbjct: 121 GLPKVVQTDQGSNFLSRLFRQVLKVLKVKHEVSSAYHPESQGALERAHQCLKSLLRIYCL 180

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI-------DSLDLNTY- 488
           +++  WD  L   + A    +  + GFSP +L+FG     P  +       D  D N + 
Sbjct: 181 DSEKDWDDGLPLLLFAIRETVQESLGFSPADLVFGHTVRGPLRLLREQCEADIADRNIHV 240

Query: 487 SDYIRALNHRLYYSRQKALQNI 422
            DY+ +   RL+ + + A  N+
Sbjct: 241 LDYVSSFRERLHKACEIARVNL 262


>UniRef50_Q54AM8 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 421

 Score = 94.7 bits (225), Expect = 3e-18
 Identities = 41/108 (37%), Positives = 68/108 (62%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK +++D G +F ++V+  +  LF +K +  SPYHPQT G +ER + T+   L+S+  
Sbjct: 125 GCPKRLLSDCGTSFLNKVISSVNELFKVKKVNTSPYHPQTDGLVERFNKTIVIMLKSFTQ 184

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLD 500
           E    WDLYL + + AY  ++H++TG SP  +L+G +  IP  + +L+
Sbjct: 185 EVHTMWDLYLDSCLFAYRISVHTSTGASPFSMLYGREATIPSDLGTLN 232


>UniRef50_UPI0000E471ED Cluster: PREDICTED: similar to zinc finger
            protein; n=3; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to zinc finger protein -
            Strongylocentrotus purpuratus
          Length = 1594

 Score = 94.3 bits (224), Expect = 3e-18
 Identities = 38/96 (39%), Positives = 60/96 (62%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            +G P+ ++TD+G  F S+VM+++ RL  ++H+  +PYHP   G +E+ + TLK+ L+   
Sbjct: 864  VGFPREMLTDRGTQFVSDVMQEVNRLMSVRHLTTTPYHPACNGLVEKFNGTLKQMLKKMA 923

Query: 646  VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             E    WD Y+   + AY    H +TGFSP ELL+G
Sbjct: 924  EERPTDWDRYIDALLFAYREAPHDSTGFSPFELLYG 959


>UniRef50_A1YGS2 Cluster: Putative pol protein; n=4; Adineta vaga|Rep:
            Putative pol protein - Adineta vaga
          Length = 1302

 Score = 94.3 bits (224), Expect = 3e-18
 Identities = 39/101 (38%), Positives = 64/101 (63%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I+TD G +F++ +M +L +  G+ H++++PYHP T G +ER ++T+   + +   
Sbjct: 1082 GTPKCILTDNGTHFTASMMTELFKKIGVTHLYSTPYHPMTNGQIERYNATMDAKIAALSN 1141

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            EN+  WD  L      YN++IHSTTG  P E+++G  P +P
Sbjct: 1142 ENRTNWDEQLPFVTFNYNTSIHSTTGQVPFEMMYGRSPTLP 1182


>UniRef50_UPI0000F1FF62 Cluster: signal transduction and activation
           of transcription 3; n=9; Danio rerio|Rep: signal
           transduction and activation of transcription 3 - Danio
           rerio
          Length = 1193

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 45/99 (45%), Positives = 61/99 (61%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           +GIPK I+T QG  F S  M++L  L GIK I  S YHPQT G +ER + TLK  +R ++
Sbjct: 496 VGIPKEILTYQGTAFMSRTMRELYGLLGIKSIRTSVYHPQTDGLVERFNRTLKSMIRKFV 555

Query: 646 VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            E+   WD +L   + A      ++TGFSP ELL+G +P
Sbjct: 556 HEDAKNWDKWLEPLLFAVREVPQASTGFSPFELLYGRQP 594


>UniRef50_A4HHK8 Cluster: Putative uncharacterized protein; n=3;
           Eukaryota|Rep: Putative uncharacterized protein -
           Leishmania braziliensis
          Length = 580

 Score = 93.5 bits (222), Expect = 6e-18
 Identities = 52/141 (36%), Positives = 76/141 (53%), Gaps = 7/141 (4%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+ K+I TDQG+NF+S +  Q+ R   +KH  +S YHP++ G LER H TLK  LR++ V
Sbjct: 144 GLTKVIQTDQGSNFTSTLFSQVLRELTVKHQLSSAYHPESQGVLERFHQTLKFMLRTFCV 203

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI---DSLDLNTYS---- 485
           E    WD  L   M A    +  + GFSP EL+F  K   P  +     L +N +     
Sbjct: 204 ETGRDWDDGLSMMMFAVRETVQESLGFSPAELVFAHKIRGPLKLLQEQLLSVNPHPRFVL 263

Query: 484 DYIRALNHRLYYSRQKALQNI 422
           DY+  +  RL+   + A +N+
Sbjct: 264 DYVNKMRERLHRVCEIARKNL 284


>UniRef50_UPI00015B440C Cluster: PREDICTED: hypothetical protein; n=1;
            Nasonia vitripennis|Rep: PREDICTED: hypothetical protein
            - Nasonia vitripennis
          Length = 1818

 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 49/124 (39%), Positives = 75/124 (60%), Gaps = 1/124 (0%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+ I++D+G +F +++++ L +LF I H+  S Y PQT G+LERSH+ L E++R Y  
Sbjct: 1627 GAPRAILSDRGTSFLTKIVESLLKLFEINHLTTSGYRPQTNGSLERSHAPLIEFIRIY-S 1685

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLD-LNTYSDYIRAL 467
            E     D     A   YN+++H+ T F+P EL++G     P  I S + L TY+ Y+R L
Sbjct: 1686 ERYDDLDHLTSFATFTYNTSVHAETNFTPFELVYGRIARFPLRIPSDEKLKTYNVYMRDL 1745

Query: 466  NHRL 455
              RL
Sbjct: 1746 VLRL 1749


>UniRef50_UPI00015A72F6 Cluster: UPI00015A72F6 related cluster; n=1;
           Danio rerio|Rep: UPI00015A72F6 UniRef100 entry - Danio
           rerio
          Length = 1350

 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 39/95 (41%), Positives = 60/95 (63%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I +DQG+NF S + +++ +   I+H  +S YHPQ+ G LER H TLK  +R+Y V
Sbjct: 623 GLPKFIQSDQGSNFMSRIFRKVMKELNIQHCVSSAYHPQSQGVLERFHQTLKTLIRTYCV 682

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           + +  WD  +   + A  + +  + GFSP EL+FG
Sbjct: 683 QREKDWDEDVPLLLFAIRNTVQESLGFSPAELVFG 717


>UniRef50_UPI00015B468C Cluster: PREDICTED: hypothetical protein; n=1;
            Nasonia vitripennis|Rep: PREDICTED: hypothetical protein
            - Nasonia vitripennis
          Length = 1070

 Score = 90.6 bits (215), Expect = 4e-17
 Identities = 39/101 (38%), Positives = 66/101 (65%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P++++ DQG NF +++MK++ + F IK +  + +HPQ+ G+LERSHS+L EY++ ++ 
Sbjct: 961  GAPRVMLIDQGTNFLTKLMKRVAKRFRIKQVKTTAFHPQSNGSLERSHSSLMEYIKFFVQ 1020

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +N+  WD Y+  A    N++I   T  +  EL+FG    IP
Sbjct: 1021 KNKKDWDEYIDLATFNLNTSISEATWHTLFELVFGRLARIP 1061


>UniRef50_UPI0000F211A4 Cluster: PREDICTED: similar to LReO_3; n=2;
           Danio rerio|Rep: PREDICTED: similar to LReO_3 - Danio
           rerio
          Length = 1366

 Score = 88.6 bits (210), Expect = 2e-16
 Identities = 40/95 (42%), Positives = 59/95 (62%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK+I TDQG+NF+S++  Q+ +  G+ H  +S YHP++ GALE+ H TLK  LR++ V
Sbjct: 636 GLPKVIQTDQGSNFTSKLFAQVLKELGVSHQMSSAYHPESQGALEQFHQTLKTMLRTFCV 695

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
                W   L   + A    +  + GFSP EL+FG
Sbjct: 696 STGKDWVEGLPLLLFAVRETVQESLGFSPSELVFG 730


>UniRef50_UPI0000F1F28A Cluster: PREDICTED: similar to LReO_3; n=1;
           Danio rerio|Rep: PREDICTED: similar to LReO_3 - Danio
           rerio
          Length = 1317

 Score = 88.6 bits (210), Expect = 2e-16
 Identities = 42/95 (44%), Positives = 56/95 (58%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+I+ +DQG NF+S++ KQ     GI H  +S YHP++ GALER H TLK  LR Y  
Sbjct: 578 GLPRIVQSDQGTNFTSKIFKQTLNELGISHQTSSAYHPESQGALERFHQTLKTMLRRYCT 637

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           E    W   L   M A   ++  +  FSP EL+FG
Sbjct: 638 ETGKDWVEGLPFLMFAVRESVQESLSFSPAELVFG 672


>UniRef50_UPI0000F1FAA0 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 568

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 42/101 (41%), Positives = 63/101 (62%)
 Frame = -1

Query: 814 KIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQ 635
           +++ TDQG  F SE+++ L +L GI+    SPYHPQ  G +ER + TL + L   + + Q
Sbjct: 300 EVLHTDQGRQFESELIQNLCQLVGIQKTRTSPYHPQCDGMVERFNRTLIDQLTKILQQQQ 359

Query: 634 HTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
             WD YLR   LAYN++ HS+TGF+P  L  G +  +P ++
Sbjct: 360 GEWDDYLRQVALAYNTSPHSSTGFTPFFLTHGREARLPANL 400


>UniRef50_UPI0000F2096A Cluster: exosome component 2; n=15; Danio
           rerio|Rep: exosome component 2 - Danio rerio
          Length = 1420

 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 42/99 (42%), Positives = 57/99 (57%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           +GIP  I+TDQG  F S +M  L  L  +K +  S YHPQT G +ER + TLK  LR  +
Sbjct: 620 VGIPSEILTDQGTPFMSRLMADLCHLLKVKQLRTSVYHPQTDGLVERFNQTLKRMLRRVV 679

Query: 646 VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            E+   WDL +   +        ++TGF+P ELLFG +P
Sbjct: 680 AEDGRDWDLMIPYVLFGIREVPQASTGFTPFELLFGRQP 718


>UniRef50_UPI0000F1D351 Cluster: PREDICTED: similar to zinc finger
           protein; n=1; Danio rerio|Rep: PREDICTED: similar to
           zinc finger protein - Danio rerio
          Length = 858

 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 43/97 (44%), Positives = 60/97 (61%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+ K+I +DQG+NF+S +  ++ R  GIKH  ++ YH Q+ GALER HSTLK  LR+Y V
Sbjct: 594 GLSKVIQSDQGSNFTSNLFAEVLRHLGIKHNLSTAYHAQSQGALERFHSTLKSLLRAYCV 653

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E    W+  L   ML+       + G+SP EL+F  K
Sbjct: 654 EMDRDWEEGLPWLMLSAREVTQQSLGYSPNELVFAHK 690


>UniRef50_UPI0000E46005 Cluster: PREDICTED: similar to zinc finger
           protein; n=3; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to zinc finger protein -
           Strongylocentrotus purpuratus
          Length = 1060

 Score = 87.4 bits (207), Expect = 4e-16
 Identities = 37/96 (38%), Positives = 59/96 (61%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           +G P+ ++TD+G  F S+VM+++ RL  ++H+  +PYHP   G +E+ + TLK+ L+   
Sbjct: 301 VGFPREMLTDRGTQFVSDVMQEVNRL-SVRHLTTTPYHPACNGLVEKFNGTLKQMLKKMA 359

Query: 646 VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            E    WD Y+   + AY    H + GFSP ELL+G
Sbjct: 360 EERPTDWDRYIDALLFAYREAPHDSPGFSPFELLYG 395


>UniRef50_Q1RL39 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 1297

 Score = 87.4 bits (207), Expect = 4e-16
 Identities = 38/96 (39%), Positives = 56/96 (58%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           +G+P  I++DQG  F S  MK++ERL  ++H+  +PY PQ  G +ER + TLK  L+   
Sbjct: 571 VGVPSEILSDQGTQFMSGCMKEVERLVKVRHLRTTPYSPQCNGLVERFNGTLKTMLKRLC 630

Query: 646 VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            E    W  Y+   + AY      +TGF+P ELL+G
Sbjct: 631 AEQPQQWHRYINPLLFAYREVPQESTGFAPFELLYG 666


>UniRef50_A5BTS7 Cluster: Putative uncharacterized protein; n=2;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 661

 Score = 87.0 bits (206), Expect = 5e-16
 Identities = 43/101 (42%), Positives = 58/101 (57%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+ A F+S    +L +L G K  F+   HPQT G  E+ ++ LKEYLR Y+ 
Sbjct: 422 GLPKDIVSDRDARFTSRFWVELFKLLGSKLKFSIANHPQTDGQTEKINALLKEYLRHYVT 481

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
             Q  W   + TA L YN    S TG SP EL  G +P +P
Sbjct: 482 ATQKNWVDLMDTAQLCYNLQRSSATGMSPFELAIGVQPRMP 522


>UniRef50_UPI00006611DC Cluster: Homolog of Oryzias latipes "LReO_3
           protein.; n=1; Takifugu rubripes|Rep: Homolog of Oryzias
           latipes "LReO_3 protein. - Takifugu rubripes
          Length = 728

 Score = 86.2 bits (204), Expect = 9e-16
 Identities = 46/141 (32%), Positives = 75/141 (53%), Gaps = 6/141 (4%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           IGIP+++ + +G+NF+S       R   I+H  +S YHPQ+ GALER H++LK  LR Y 
Sbjct: 577 IGIPRVVQSHRGSNFTSAAFADALRQLRIQHNISSAYHPQSQGALERFHTSLKSLLRVYC 636

Query: 646 VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDL------NTYS 485
           ++    W+  L   +LA  S +  +TGFSP +L+F  +   P  +   D       +   
Sbjct: 637 IDLNRDWEEGLPWLLLAARSVVQESTGFSPNQLVFAHQVRCPLDVLRGDTKISDSPDNLV 696

Query: 484 DYIRALNHRLYYSRQKALQNI 422
           DY+     +L+ + + A  N+
Sbjct: 697 DYVHGFRRKLFLAWKMASDNL 717


>UniRef50_A5AG41 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1173

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 45/134 (33%), Positives = 68/134 (50%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ I++D+   F S   K L    G K +F++  HPQT G +E  + TL   LR+ I 
Sbjct: 915  GIPRSIVSDRDVKFLSCFWKVLWGKLGTKLLFSTTCHPQTDGQIEVVNRTLSTLLRTIIQ 974

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIRALN 464
            +N   W+  L     AYN ++HSTT FSP E+++GF P  P  +  L +N  +      N
Sbjct: 975  KNLKNWEDCLPFTEFAYNRSVHSTTSFSPFEIVYGFNPLTPLDLLPLPVNEMTSLDEKKN 1034

Query: 463  HRLYYSRQKALQNI 422
             +      K  + +
Sbjct: 1035 EQYVTKANKGRRQV 1048


>UniRef50_Q4QQD3 Cluster: Gag-pol polyprotein; n=3; Schistosoma|Rep:
            Gag-pol polyprotein - Schistosoma mansoni (Blood fluke)
          Length = 1154

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 44/101 (43%), Positives = 62/101 (61%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK+I+TDQG  F S+  K   + FGIK I  +PYHPQT G  ER++ TLKE+L S   
Sbjct: 1039 GVPKMILTDQGPCFESDEFKARLKQFGIKRIRTTPYHPQTNGLTERNNRTLKEWLAS--- 1095

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
                 W+  L   +LA+ ++I  TT  SP  L++G +P +P
Sbjct: 1096 -KGGNWEKELPLILLAHRASIQGTTKKSPFLLMYGRQPRLP 1135


>UniRef50_Q9GQ51 Cluster: Polyprotein; n=10; Dictyostelium
            discoideum|Rep: Polyprotein - Dictyostelium discoideum
            (Slime mold)
          Length = 1437

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 42/118 (35%), Positives = 70/118 (59%), Gaps = 1/118 (0%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK +++D+G NF S V+  + +LFG+  +  + YHPQ  G  E  ++TL + L+++I 
Sbjct: 1211 GVPKKLVSDRGKNFLSNVVSGVNKLFGVHKLTTTAYHPQCDGQTENFNNTLIKMLKAFIG 1270

Query: 643  ENQH-TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIR 473
               +  W   LR  + +Y    H +TGFSP  LLF  +P +P    +L++N YS+ +R
Sbjct: 1271 NELYGNWGELLRCVLYSYRITPHVSTGFSPFFLLFNRQPTLPLD-TTLNVNFYSNSLR 1327


>UniRef50_P10394 Cluster: Retrovirus-related Pol polyprotein from
            transposon 412 [Includes: Protease (EC 3.4.23.-); Reverse
            transcriptase (EC 2.7.7.49); Endonuclease]; n=9;
            Drosophila melanogaster|Rep: Retrovirus-related Pol
            polyprotein from transposon 412 [Includes: Protease (EC
            3.4.23.-); Reverse transcriptase (EC 2.7.7.49);
            Endonuclease] - Drosophila melanogaster (Fruit fly)
          Length = 1237

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 44/139 (31%), Positives = 74/139 (53%), Gaps = 4/139 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G  K  ITD G  + + ++  L +   IK+I ++ +H QT G +ERSH TL EY+RSYI 
Sbjct: 1023 GPMKTFITDMGTEYKNSIITDLCKYLKIKNITSTAHHHQTVGVVERSHRTLNEYIRSYIS 1082

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL----DLNTYSDYI 476
             ++  WD++L+  +  +N+       + P EL+FG    +PK  + L     +    DY 
Sbjct: 1083 TDKTDWDVWLQYFVYCFNTTQSMVHNYCPYELVFGRTSNLPKHFNKLHSIEPIYNIDDYA 1142

Query: 475  RALNHRLYYSRQKALQNIE 419
            +   +RL  +  +A + +E
Sbjct: 1143 KESKYRLEVAYARARKLLE 1161


>UniRef50_A5BVZ5 Cluster: Putative uncharacterized protein; n=3; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1439

 Score = 84.2 bits (199), Expect = 4e-15
 Identities = 40/104 (38%), Positives = 60/104 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I++D+ A F+ +   +L +L G +  F++  HPQT G  ER ++ L+EYLR Y+ 
Sbjct: 1016 GLPRDIVSDRDARFTGKFWVELFKLLGSELKFSTANHPQTDGQTERINALLEEYLRHYVT 1075

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
              Q  W   + TA L YN    S TG SP EL  G +P +P  +
Sbjct: 1076 ATQKNWVDLMDTAQLCYNLQRSSATGMSPFELAIGVQPRMPLEV 1119


>UniRef50_Q9ZPF9 Cluster: F5K24.1 protein; n=2; Arabidopsis
            thaliana|Rep: F5K24.1 protein - Arabidopsis thaliana
            (Mouse-ear cress)
          Length = 1138

 Score = 83.8 bits (198), Expect = 5e-15
 Identities = 44/117 (37%), Positives = 65/117 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+   F S   K L    G K +F++  HPQT G  E  + TL   LR+ I 
Sbjct: 889  GMPKTIVSDRDTKFLSYFWKTLWSKLGTKLLFSTTCHPQTDGQTEVVNRTLSTLLRALIK 948

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIR 473
            +N  TW+  L     AYN ++HS T FSP ++++GF P  P  +D + L   S ++R
Sbjct: 949  KNLKTWEDCLPHVEFAYNHSVHSATKFSPFQIVYGFNPITP--LDLMPLPLISIHLR 1003


>UniRef50_UPI0000F1DB0A Cluster: PREDICTED: hypothetical protein,
            partial; n=1; Danio rerio|Rep: PREDICTED: hypothetical
            protein, partial - Danio rerio
          Length = 1409

 Score = 83.0 bits (196), Expect = 8e-15
 Identities = 41/101 (40%), Positives = 56/101 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+ I ++QGA+F SE+M +L  L GI     +PYHP   G  ER + TL   LRS   
Sbjct: 1038 GFPQRIHSNQGASFESELMAELLTLAGIDKSRTTPYHPMGNGGTERFNRTLGNMLRSLPP 1097

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
              +  W   ++T    YN  +H TTGF+P  L+FG  P +P
Sbjct: 1098 RPKQKWPQMVQTMTFVYNCTVHETTGFAPFYLMFGGVPRLP 1138


>UniRef50_UPI0000F20443 Cluster: PREDICTED: similar to pol
            polyprotein; n=1; Danio rerio|Rep: PREDICTED: similar to
            pol polyprotein - Danio rerio
          Length = 1320

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 41/101 (40%), Positives = 58/101 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I +DQG NF S +++QL  L+G+     +PYHP   G  ER + TL + LRS   
Sbjct: 915  GVPGRIHSDQGRNFESTLIQQLCGLYGVVKSRTTPYHPAGNGQCERFNRTLHDLLRSLPP 974

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
              +  W L L   + AYN+  H +TG SP  L+FG +P +P
Sbjct: 975  SKKSDWPLCLPQVLFAYNTTPHQSTGESPYYLMFGQEPKLP 1015


>UniRef50_A5BDT7 Cluster: Putative uncharacterized protein; n=2;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1239

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 35/105 (33%), Positives = 62/105 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D GA+F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 45  GVPKAIISDGGAHFCNKPFEALLSKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 104

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            N++ W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 105 SNRNDWSIRLHDSLWAYRTAYKTILGMSPYRLVYGKTCHLPVEVE 149


>UniRef50_UPI00015B455C Cluster: PREDICTED: hypothetical protein; n=1;
            Nasonia vitripennis|Rep: PREDICTED: hypothetical protein
            - Nasonia vitripennis
          Length = 3473

 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 46/120 (38%), Positives = 67/120 (55%), Gaps = 1/120 (0%)
 Frame = -1

Query: 811  IIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQH 632
            I I +  A   ++ ++ L +LF I H+  S Y PQT G+LERSH+ L E++R Y  E   
Sbjct: 1771 IAIKNLNATTIADALESLLKLFKINHLTTSGYRPQTNGSLERSHAPLIEFIRIY-SERYD 1829

Query: 631  TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLD-LNTYSDYIRALNHRL 455
             WD     A   YN+++H+ T F+P E ++G     P  I S + L TY+ Y+R L  RL
Sbjct: 1830 DWDHLTPFATFTYNTSVHAATNFTPFEFVYGRIARFPLRIPSDEKLKTYNVYMRDLVLRL 1889


>UniRef50_Q0ZCD2 Cluster: Integrase; n=1; Populus trichocarpa|Rep:
           Integrase - Populus trichocarpa (Western balsam poplar)
           (Populus balsamiferasubsp. trichocarpa)
          Length = 694

 Score = 81.4 bits (192), Expect = 3e-14
 Identities = 36/105 (34%), Positives = 63/105 (60%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP+ +I+D G +F ++  + L + +GI H FA+PYHPQT G +E ++  +K+ L   + 
Sbjct: 304 GIPRAMISDGGTHFCNKSFEFLMKKYGITHKFATPYHPQTSGQVELANREIKQILEKTMN 363

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            N+  W L L  A+ AY +   ++ G SP  L++G   ++P  ++
Sbjct: 364 PNRKDWSLRLNDALWAYQTAYKTSLGMSPYRLVYGKPCHLPVELE 408


>UniRef50_Q0ZCC0 Cluster: Gag protein; n=2; Populus trichocarpa|Rep:
            Gag protein - Populus trichocarpa (Western balsam poplar)
            (Populus balsamiferasubsp. trichocarpa)
          Length = 1886

 Score = 81.4 bits (192), Expect = 3e-14
 Identities = 36/105 (34%), Positives = 62/105 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ +I+D G +F ++  + L + +GI H  A+PYHPQT G +E ++  +K+ L   + 
Sbjct: 1014 GIPRAMISDGGTHFCNKPFESLMKKYGITHKVATPYHPQTSGQVELANREIKQILEKTVN 1073

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W L L  A+ AY +   ++ G SP  L++G   ++P  I+
Sbjct: 1074 PNRKDWSLRLNDALWAYRTAYKTSLGMSPYRLVYGKPCHLPVEIE 1118



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 19/42 (45%), Positives = 29/42 (69%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCG 698
           GIP+ +I+D G +F ++  + L + +GI H  A+PYHPQT G
Sbjct: 765 GIPRAMISDGGTHFCNKPFESLMKKYGITHKVATPYHPQTSG 806


>UniRef50_Q0DJL7 Cluster: Os05g0263200 protein; n=13; Eukaryota|Rep:
            Os05g0263200 protein - Oryza sativa subsp. japonica
            (Rice)
          Length = 1820

 Score = 81.4 bits (192), Expect = 3e-14
 Identities = 43/114 (37%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+   F S   K L    G + +F++  HPQT G  E  + TL   LR+ I 
Sbjct: 1326 GMPKTIVSDRDTKFLSYFWKTLWAKLGTRLLFSTTCHPQTDGQTEVVNRTLSMLLRALIK 1385

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
            +N   W+  L     AYN  +HSTT   P E+++GFKP  P  +  L L   SD
Sbjct: 1386 KNLKEWEECLPHVEFAYNRAVHSTTNMCPFEVVYGFKPLSPIDLLPLPLQERSD 1439


>UniRef50_A5APW4 Cluster: Putative uncharacterized protein; n=3; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1536

 Score = 81.4 bits (192), Expect = 3e-14
 Identities = 34/105 (32%), Positives = 61/105 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK+II+D+G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1015 GVPKVIISDEGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELTNKEIKNILMKMVN 1074

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY     +  G SP  L++G   ++P  ++
Sbjct: 1075 TNRKDWSVKLFDSLWAYRKTYKTILGMSPYRLVYGKAYHLPVELE 1119


>UniRef50_UPI0000F1FB51 Cluster: PREDICTED: hypothetical protein; n=1;
            Danio rerio|Rep: PREDICTED: hypothetical protein - Danio
            rerio
          Length = 1380

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 37/101 (36%), Positives = 57/101 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK + +DQG NF S+++K+L  + G+K    + YHP   G  ER + TL   +R+   
Sbjct: 1037 GFPKRMHSDQGPNFESKLIKELLEMAGVKKSHTTSYHPMGNGITERFNRTLGNLIRALPP 1096

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +++  W   L+     YN  +H TTGF+P  L+FG  P +P
Sbjct: 1097 QSKAKWPQSLQMLTFCYNCTVHGTTGFAPFYLMFGRVPRLP 1137


>UniRef50_UPI00005848C8 Cluster: PREDICTED: similar to
            OSJNBa0059D20.6; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to OSJNBa0059D20.6 -
            Strongylocentrotus purpuratus
          Length = 1138

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 43/127 (33%), Positives = 72/127 (56%), Gaps = 4/127 (3%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I TDQG NF S++ K++ ++ GIK    + Y+P++ G +ER + TL + L + I 
Sbjct: 856  GVPTEIHTDQGRNFESQLFKEVCQILGIKKTRTTAYNPKSDGMIERFNRTLLDMLVTLIE 915

Query: 643  --ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYI 476
              +NQ  WD Y+  A  A+ S++H T G +P  ++FG   K    + +   D+   +DY+
Sbjct: 916  PGKNQRDWDKYVHIATTAHRSSVHETIGETPNMMMFGRELKMLSDQYMIQPDMEVGTDYV 975

Query: 475  RALNHRL 455
              L  R+
Sbjct: 976  EELRDRM 982


>UniRef50_Q9LQH2 Cluster: F15O4.13; n=7; Eukaryota|Rep: F15O4.13 -
            Arabidopsis thaliana (Mouse-ear cress)
          Length = 1887

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 41/110 (37%), Positives = 61/110 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+   F S   K L    G K +F++  HPQT G  E  + TL   LR+ I 
Sbjct: 1514 GMPKTIVSDRDTKFLSYFWKTLWSKLGTKLLFSTTCHPQTDGQTEVVNRTLSTLLRALIK 1573

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLN 494
            +N  TW+  L     AYN ++HS + FSP ++++GF P  P  +  L L+
Sbjct: 1574 KNLKTWEDCLPHVEFAYNHSMHSASKFSPFQIVYGFNPTTPLDLMPLPLS 1623


>UniRef50_Q5MG92 Cluster: Putative retrotransposon polyprotein; n=2;
            Ipomoea batatas|Rep: Putative retrotransposon polyprotein
            - Ipomoea batatas (Sweet potato) (Batate)
          Length = 1358

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 42/110 (38%), Positives = 60/110 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ I++D+ A F S   + L    G K ++++  HPQT G  E  + TL + LR  I 
Sbjct: 1046 GIPRTIVSDRDAKFLSHFWRILWGKLGTKLLYSTACHPQTDGQTEVVNRTLTQLLRVVIR 1105

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLN 494
            +N  +W+  L     AYN  IHSTT  SP E+ +GF P  P  +  L +N
Sbjct: 1106 KNLKSWEESLPYVEFAYNRAIHSTTNMSPFEVAYGFNPLTPLDLIPLHVN 1155


>UniRef50_A5B7N0 Cluster: Putative uncharacterized protein; n=21;
            Vitis vinifera|Rep: Putative uncharacterized protein -
            Vitis vinifera (Grape)
          Length = 2000

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 35/105 (33%), Positives = 61/105 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D GA+F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1313 GVPKAIISDGGAHFCNKPFEALLSKYGVKHKVATPYHPQTFGQVELANREIKNILMKVVN 1372

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 1373 SNRKDWSIRLHDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEVE 1417


>UniRef50_UPI0000F1FD8F Cluster: PREDICTED: hypothetical protein,
           partial; n=3; Danio rerio|Rep: PREDICTED: hypothetical
           protein, partial - Danio rerio
          Length = 889

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 34/101 (33%), Positives = 60/101 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+ + +DQGA+F S ++ ++ +L G++    + YH    GA+ER + TL   + +   
Sbjct: 539 GFPEWVHSDQGASFESGLISEMLQLAGVQKSHTTSYHAMGSGAVERFNHTLGNMIHALPP 598

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           + +H W   L++ +  YN+ IH TTG+ P +L+FG  P +P
Sbjct: 599 KAKHRWPQMLKSLIFCYNATIHETTGYPPFQLMFGRSPRLP 639


>UniRef50_Q0ZCB7 Cluster: Integrase; n=3; Populus trichocarpa|Rep:
            Integrase - Populus trichocarpa (Western balsam poplar)
            (Populus balsamiferasubsp. trichocarpa)
          Length = 1332

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 35/105 (33%), Positives = 62/105 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ +I+D G +F +   + L + +GI H  A+PYHPQT G +E ++  +K+ L   + 
Sbjct: 953  GIPRAMISDGGTHFCNTSFESLMKKYGITHKVATPYHPQTSGQIELANREIKQILEKTVN 1012

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W L L  A+ AY +   ++ G SP +L++G   ++P  ++
Sbjct: 1013 PNRKDWSLRLNDALWAYRTAYKTSLGMSPYKLVYGKPCHLPVELE 1057


>UniRef50_A5C6G8 Cluster: Putative uncharacterized protein; n=4; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 2068

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 46/133 (34%), Positives = 78/133 (58%), Gaps = 3/133 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+D+G +F +EV   ++R + I+H  +S Y PQT GA+E ++  +K  LR  +V
Sbjct: 1862 GVPHELISDRGVHFRAEVDTLVQR-YSIRHHRSSAYRPQTNGAVEAANKNIKRILRR-MV 1919

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID--SLDLNTYSD-YIR 473
            E    W   L  A+ AY ++  ++TG +P  L++G +  +P  I+  SL LN   +  +R
Sbjct: 1920 ETSRDWSEKLPFALWAYRTSFRTSTGATPYSLVYGMEAVLPIEIEMGSLRLNLLDERRLR 1979

Query: 472  ALNHRLYYSRQKA 434
            A++H   Y R+ A
Sbjct: 1980 AVDHVRAYQRKMA 1992


>UniRef50_A5C4R5 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1398

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 33/105 (31%), Positives = 61/105 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   ++
Sbjct: 1156 GVPKAIISDGGTHFCNKPFEALLAKYGVKHKLATPYHPQTSGQVELANREIKNILMKVVI 1215

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 1216 TSRKDWSIKLHDSLWAYRTAYKTILGMSPYRLVYGKACHLPMEVE 1260


>UniRef50_A5C0S7 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1033

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 39/104 (37%), Positives = 57/104 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+ A F      +  +L G K  F++  HPQT G  E+ ++ L+EYL+ Y+ 
Sbjct: 702  GLPKDIVSDRDARFIGRFWVESFKLLGSKLKFSTANHPQTGGQTEKINALLEEYLKHYVT 761

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
              Q  W   L  A L YN    S TG SP EL  G +P++P  +
Sbjct: 762  ATQKNWVDLLDIAQLCYNLQRSSATGMSPFELAIGVQPWMPLEV 805


>UniRef50_A5BFS9 Cluster: Putative uncharacterized protein; n=15;
            Vitis vinifera|Rep: Putative uncharacterized protein -
            Vitis vinifera (Grape)
          Length = 2326

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 36/105 (34%), Positives = 61/105 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK+II+D G +F ++  + L   +GIKH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 986  GVPKVIISDGGTHFCNKPFEALLAKYGIKHKVATPYHPQTSGQVELANREIKNILMKVVN 1045

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY +   +  G SP  L++G   ++P  I+
Sbjct: 1046 TNRKDWSVNLLDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEIE 1090



 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 30/95 (31%), Positives = 52/95 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   + +KH  A+ YHPQT G +E ++  +K  L   + 
Sbjct: 1822 GVPKAIISDGGTHFCNKPFETLLAKYRVKHKVATLYHPQTNGQVELANRKIKNILMKVVN 1881

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             N+  W + L  ++ AY +   +    SP  L++G
Sbjct: 1882 TNRKDWPVKLLDSLWAYKTAYKTILEMSPYRLVYG 1916


>UniRef50_Q9Y8H1 Cluster: Reverse transcriptase-RNase H-integrase;
            n=23; Tricholoma|Rep: Reverse transcriptase-RNase
            H-integrase - Tricholoma matsutake (Matsutake mushroom)
            (Tricholoma nauseosum)
          Length = 1057

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 37/98 (37%), Positives = 59/98 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P   ++D+G  F +E  ++L RL GIK + ++ YHPQT G  ER +  L++Y+R ++ 
Sbjct: 741  GLPGAFLSDRGPQFMAEFTRELYRLLGIKLLASTAYHPQTDGQTERVNQELEQYIRLFVN 800

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            E Q  WD  L  A   YN+++H++T  +P  L  G  P
Sbjct: 801  ERQDDWDDLLPLAEFGYNNHVHASTQQTPFLLDTGRHP 838


>UniRef50_UPI0000F1F902 Cluster: PREDICTED: similar to pol
           polyprotein; n=1; Danio rerio|Rep: PREDICTED: similar to
           pol polyprotein - Danio rerio
          Length = 976

 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 39/98 (39%), Positives = 53/98 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  +  DQG NF S V+K+L +L G+     +PYHPQ  G  ER + T    L +   
Sbjct: 687 GVPAGLHADQGRNFESAVVKELCKLIGVTKTHTTPYHPQGNGTTERFNRTFMNMLGTLDP 746

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           E +  W  Y+    LAYN   H +TGFSP  L++G  P
Sbjct: 747 EKKPQWHEYVDAMTLAYNCTQHDSTGFSPYLLMYGRHP 784


>UniRef50_UPI0000F1DF9A Cluster: PREDICTED: similar to pol
            polyprotein; n=1; Danio rerio|Rep: PREDICTED: similar to
            pol polyprotein - Danio rerio
          Length = 1590

 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 37/101 (36%), Positives = 62/101 (61%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I +DQG  F S+++ +L +L+GI     +PY PQ  G  ER + T+ + LR+   
Sbjct: 1326 GVPRQIHSDQGRCFESKLIYELCKLYGISKTRTTPYRPQGNGQCERFNRTMHDLLRTLPP 1385

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            + +  W  +L   + AYN+  H +TG+SP  L+FG +P++P
Sbjct: 1386 KEKCRWPDHLAQVVFAYNTTEHQSTGYSPHVLMFGQEPHLP 1426


>UniRef50_Q0GYC3 Cluster: Putative uncharacterized protein; n=2;
           Nucleopolyhedrovirus|Rep: Putative uncharacterized
           protein - Plutella xylostella multiple
           nucleopolyhedrovirus
          Length = 74

 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 35/49 (71%), Positives = 36/49 (73%)
 Frame = +1

Query: 223 MNGSWIFCMCEVYPGGVCNPSFCVCV*YRLKNGAGVSNHMWHRLKNDDG 369
           MNGSWIFCMC VYPGGVCNPSFC CV          SNHMW+RLKN DG
Sbjct: 1   MNGSWIFCMCGVYPGGVCNPSFCACV----------SNHMWYRLKNGDG 39


>UniRef50_Q5NRP7 Cluster: Putative gag-pol polyprotein, identical;
            n=2; Solanum demissum|Rep: Putative gag-pol polyprotein,
            identical - Solanum demissum (Wild potato)
          Length = 1588

 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 40/114 (35%), Positives = 62/114 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ I++D+ A F S   + L    G K +F++  HPQT G  E  + TL   LR+ + 
Sbjct: 1276 GIPRTIVSDRDAKFLSHFWRILWGKLGTKLLFSTSCHPQTDGQTEVVNRTLGNMLRAILK 1335

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
                +W+ YL     AYN   HS+TG +P E+++GF P  P  +  L  N +++
Sbjct: 1336 GKLTSWEDYLPIVEFAYNRTFHSSTGKTPFEVVYGFNPLTPLDLLPLPTNDFAN 1389


>UniRef50_Q5NRP3 Cluster: Gag-pol polyprotein, putative; n=1; Solanum
            demissum|Rep: Gag-pol polyprotein, putative - Solanum
            demissum (Wild potato)
          Length = 1096

 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 40/114 (35%), Positives = 62/114 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ I++D+ A F S   + L    G K +F++  HPQT G  E  + TL   LR+ + 
Sbjct: 784  GIPRTIVSDRDAKFLSHFWRILWGKLGTKLLFSTSCHPQTDGQTEVVNRTLGNMLRAILK 843

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
                +W+ YL     AYN   HS+TG +P E+++GF P  P  +  L  N +++
Sbjct: 844  GKLTSWEDYLPIVEFAYNRTFHSSTGKTPFEVVYGFNPLTPLDLLPLPTNDFAN 897


>UniRef50_Q9HFY7 Cluster: Pol protein; n=1; Glomerella cingulata|Rep:
            Pol protein - Colletotrichum gloeosporioides (Anthracnose
            fungus) (Glomerellacingulata)
          Length = 1241

 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 38/98 (38%), Positives = 57/98 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I++D+   F+S   K +    GIK   ++ +HPQT G  ER++  L+ YLR+Y+ 
Sbjct: 897  GTPKEIVSDRDKIFTSNFWKSITAQLGIKQAMSTAFHPQTDGQTERTNQILETYLRAYVN 956

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
             +Q  W + L  A  AYNS +  +T  SP  L +GF+P
Sbjct: 957  YDQDNWVVLLPIAQFAYNSAVGESTKESPFYLNYGFEP 994


>UniRef50_A5BJN2 Cluster: Putative uncharacterized protein; n=4; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1380

 Score = 79.8 bits (188), Expect = 8e-14
 Identities = 33/105 (31%), Positives = 61/105 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   ++
Sbjct: 974  GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVI 1033

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 1034 TSRKDWSIKLHDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEVE 1078


>UniRef50_A5B2X9 Cluster: Putative uncharacterized protein; n=3; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1595

 Score = 79.8 bits (188), Expect = 8e-14
 Identities = 35/105 (33%), Positives = 60/105 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1353 GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 1412

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY +   +  G SP  L++G   ++P  I+
Sbjct: 1413 VNRKDWSIKLLDSLWAYRTTYKTILGMSPYRLVYGKACHLPMEIE 1457


>UniRef50_A4RGB0 Cluster: Putative uncharacterized protein; n=23;
            Magnaporthe grisea|Rep: Putative uncharacterized protein
            - Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 1629

 Score = 79.8 bits (188), Expect = 8e-14
 Identities = 43/118 (36%), Positives = 63/118 (53%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            +G+P + I+D    F SE M  +  L G KH   S  HPQT GA+E ++  L + LR YI
Sbjct: 801  LGLPFVWISDNAGPFISEFMATINELTGTKHRHGSALHPQTQGAVEITNQELDQKLRFYI 860

Query: 646  VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIR 473
             + Q +W ++L     A+N+  HS+ G  PL+++ G +P  P S D       SD  R
Sbjct: 861  DKYQTSWSVHLPALDFAHNAAWHSSLGMCPLKVVLGTEPRNPLSTDLPTTTVDSDQKR 918


>UniRef50_A4R3D0 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 904

 Score = 79.8 bits (188), Expect = 8e-14
 Identities = 43/118 (36%), Positives = 63/118 (53%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           +G+P + I+D    F SE M  +  L G KH   S  HPQT GA+E ++  L + LR YI
Sbjct: 562 LGLPFVWISDNAGPFISEFMATINELTGTKHRHGSALHPQTQGAVEITNQELDQKLRFYI 621

Query: 646 VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIR 473
            + Q +W ++L     A+N+  HS+ G  PL+++ G +P  P S D       SD  R
Sbjct: 622 DKYQTSWSVHLPALDFAHNAAWHSSLGMCPLKVVLGTEPRNPLSTDLPTTTVDSDQKR 679


>UniRef50_A7QXC8 Cluster: Chromosome undetermined scaffold_220, whole
            genome shotgun sequence; n=77; Vitis vinifera|Rep:
            Chromosome undetermined scaffold_220, whole genome
            shotgun sequence - Vitis vinifera (Grape)
          Length = 1831

 Score = 79.4 bits (187), Expect = 1e-13
 Identities = 34/105 (32%), Positives = 61/105 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D GA+F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1589 GVPKAIISDGGAHFCNKPFEALLSKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 1648

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 1649 SSRKDWSIRLHDSLWAYRTAYKTILGMSPYRLVYGKACHLPVKVE 1693


>UniRef50_A5BY07 Cluster: Putative uncharacterized protein; n=3; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1621

 Score = 79.4 bits (187), Expect = 1e-13
 Identities = 33/105 (31%), Positives = 61/105 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D+G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1414 GVPKAIISDEGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANKEIKNILMKVVN 1473

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 1474 TSRRDWSVKLHDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEVE 1518


>UniRef50_A5BJP7 Cluster: Putative uncharacterized protein; n=6;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1265

 Score = 79.4 bits (187), Expect = 1e-13
 Identities = 34/105 (32%), Positives = 61/105 (58%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D GA+F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 440 GVPKAIISDGGAHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 499

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 500 ASRKNWSIRLHDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEVE 544


>UniRef50_Q53JQ7 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=4; Oryza sativa|Rep: Retrotransposon
            protein, putative, Ty3-gypsy sub-class - Oryza sativa
            subsp. japonica (Rice)
          Length = 1567

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 40/116 (34%), Positives = 66/116 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1451 GVPKKIVSDRGSQFTSHFWKKLQEELGTQLNFSTAYHPQTDGQTERLNQILEDMLRACVL 1510

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYI 476
            +   TWD  L  A  +YN++  ++   +P E L+G K   P   D +  N  S  I
Sbjct: 1511 DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTPLLWDQVGENKCSGLI 1566


>UniRef50_Q53J67 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=3; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            Ty3-gypsy sub-class - Oryza sativa subsp. japonica (Rice)
          Length = 1497

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 37/101 (36%), Positives = 62/101 (61%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIPK I++D+G+ F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1195 GIPKKIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLNQILEDMLRACVL 1254

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            + + TWD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1255 DFRKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTP 1295


>UniRef50_Q9FZN9 Cluster: Retroelement pol polyprotein-like; n=7;
            Arabidopsis thaliana|Rep: Retroelement pol
            polyprotein-like - Arabidopsis thaliana (Mouse-ear cress)
          Length = 1864

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 35/105 (33%), Positives = 60/105 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+I+I+D G +F ++V + L +  G+KH  A+PYHPQT G +E S+  +K  L   + 
Sbjct: 1623 GVPRIMISDGGKHFINKVFENLLKKHGVKHKVATPYHPQTSGQVEISNREIKAILEKIVG 1682

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
              +  W   L  A+ AY +   +  G +P  LL+G   ++P  ++
Sbjct: 1683 STRKDWSAKLDDALWAYRTAFKTPIGTTPFNLLYGKSCHLPVELE 1727


>UniRef50_A5C2R0 Cluster: Putative uncharacterized protein; n=13;
            Vitis vinifera|Rep: Putative uncharacterized protein -
            Vitis vinifera (Grape)
          Length = 2116

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 34/105 (32%), Positives = 60/105 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D GA+F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1874 GVPKAIISDGGAHFCNKPFEALLSRYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 1933

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             ++  W + L  ++ AY +   +  G SP  L+ G   ++P  ++
Sbjct: 1934 SSRKDWSIRLHDSLWAYRTTYKTILGMSPYRLVHGKACHLPVEVE 1978


>UniRef50_A5BYC4 Cluster: Putative uncharacterized protein; n=4; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1855

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 33/105 (31%), Positives = 60/105 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A PYHPQT G +E ++  +K  L   ++
Sbjct: 1620 GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVAIPYHPQTSGQVELANREIKNILMKVVI 1679

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 1680 TSRKDWSIKLHDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEVE 1724


>UniRef50_A5BT93 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1184

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 35/105 (33%), Positives = 60/105 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 853  GVPKAIISDGGTHFCNKPFEALLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 912

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY +   +  G SP  L++G   ++P  I+
Sbjct: 913  TNRKDWSVKLLDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEIE 957


>UniRef50_A5BFP8 Cluster: Putative uncharacterized protein; n=4; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1563

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 34/105 (32%), Positives = 60/105 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1061 GVPKAIISDGGTHFCNKPFEMLLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 1120

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 1121 TNRKDWSIKLLDSLWAYRTAYKTILGMSPYRLVYGKACHLPVELE 1165


>UniRef50_A5AY91 Cluster: Putative uncharacterized protein; n=3;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1162

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 35/105 (33%), Positives = 60/105 (57%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 211 GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANRXIKNILMKVVN 270

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            N+  W + L  ++ AY +   +  G SP  L++G   ++P  I+
Sbjct: 271 VNRKDWSIKLLDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEIE 315


>UniRef50_A5ASD2 Cluster: Putative uncharacterized protein; n=8; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1801

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 32/105 (30%), Positives = 60/105 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D+G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   ++
Sbjct: 1559 GVPKAIISDRGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVI 1618

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
              +  W + L  ++ AY +   +  G S   L++G   ++P  ++
Sbjct: 1619 TTRRDWSIKLHDSLWAYRTTYKTILGMSSYRLVYGKACHLPVEVE 1663


>UniRef50_A5ACN5 Cluster: Putative uncharacterized protein; n=6;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1390

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 35/105 (33%), Positives = 60/105 (57%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 661 GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 720

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            N+  W + L  ++ AY +   +  G SP  L++G   ++P  I+
Sbjct: 721 VNRKDWSIKLLDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEIE 765


>UniRef50_Q7XPW2 Cluster: OSJNBa0032F06.19 protein; n=4;
            Eukaryota|Rep: OSJNBa0032F06.19 protein - Oryza sativa
            subsp. japonica (Rice)
          Length = 1575

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 39/109 (35%), Positives = 62/109 (56%), Gaps = 1/109 (0%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I++D+   F+S + K+L R  G +   +S YHPQ+ G  ER +  ++ +LR ++ 
Sbjct: 1236 GLPQAIVSDRDRVFTSSLWKELFRRAGTQLRMSSSYHPQSDGQTERVNQCVEMFLRCFVH 1295

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP-YIPKSIDSLD 500
                 W  +L  A   YN++ HS  G +P E+LFG KP Y   S  S+D
Sbjct: 1296 SCPSRWKHWLALAQYWYNTSFHSALGMTPFEVLFGHKPRYFGLSTSSVD 1344


>UniRef50_Q2AA50 Cluster: Retrotransposon gag protein; n=6; Asparagus
            officinalis|Rep: Retrotransposon gag protein - Asparagus
            officinalis (Garden asparagus)
          Length = 1788

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 34/105 (32%), Positives = 59/105 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ II+D G +F +   + L R + I H  ++PYHPQT G +E ++  +K+ L   + 
Sbjct: 1480 GVPRAIISDNGTHFCNRSFEALMRKYSITHKLSTPYHPQTSGQVEVTNRQIKQILEKTVN 1539

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  A+ AY +   +  G SP  L+FG   ++P  ++
Sbjct: 1540 HNRKDWSVKLCDALWAYRTAFKANLGMSPYRLVFGKACHLPVELE 1584


>UniRef50_A5CBC2 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1459

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 38/104 (36%), Positives = 56/104 (53%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I++D+   F+     +L +L G +  F++  HPQT    ER +  L+EYLR Y+ 
Sbjct: 1090 GLPRDIVSDRDTRFTGRFWVELFKLLGSELKFSTANHPQTDRQTERINGLLEEYLRHYVT 1149

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
              Q  W   + TA L YN  I S T  SP EL  G +P +P  +
Sbjct: 1150 ATQKNWVDLMDTAQLCYNLQISSVTKMSPFELAIGVQPRMPLEV 1193


>UniRef50_A5B5G8 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1856

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 35/105 (33%), Positives = 59/105 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1475 GVPKAIINDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANRKIKNILMKVVN 1534

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY +   +  G SP  L++G   ++P  I+
Sbjct: 1535 VNRKDWSIKLLDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEIE 1579


>UniRef50_A5B346 Cluster: Putative uncharacterized protein; n=3;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 916

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 32/104 (30%), Positives = 62/104 (59%)
 Frame = -1

Query: 820 IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
           +PK+II+D+G +F ++  + L   +G+KH  A+PYHPQT G +E +++ +K  L   +  
Sbjct: 234 VPKVIISDRGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANTEIKNILMKVVNT 293

Query: 640 NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 294 SRRDWYVKLHDSLWAYRTTYKTILGMSPYRLVYGKTCHLPVEVE 337


>UniRef50_UPI0000F1ED4F Cluster: PREDICTED: similar to pol
            polyprotein; n=21; Danio rerio|Rep: PREDICTED: similar to
            pol polyprotein - Danio rerio
          Length = 1473

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 36/98 (36%), Positives = 57/98 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I++D+G  F S + K   RL G+    +S YHPQT G  ER    +  +LR++  
Sbjct: 1086 GLPEDIVSDRGPQFISRLWKAFFRLLGVTVSLSSGYHPQTNGQTERKIQEVGRFLRTFCH 1145

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            + Q++W+ +L  A  A NS    TTG +P + + GF+P
Sbjct: 1146 DRQNSWNQFLGWAEYAQNSLRQPTTGLTPFQCILGFQP 1183


>UniRef50_Q7XMR4 Cluster: OSJNBa0029L02.23 protein; n=8;
            Magnoliophyta|Rep: OSJNBa0029L02.23 protein - Oryza
            sativa (Rice)
          Length = 1514

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 36/101 (35%), Positives = 61/101 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G  F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1260 GVPKKIVSDRGNQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLNKILEDMLRACVL 1319

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   TWD  L  A  +YN++  ++   +P E L+G K + P
Sbjct: 1320 DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCWTP 1360


>UniRef50_Q53M59 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=11; Magnoliophyta|Rep: Retrotransposon
            protein, putative, Ty3-gypsy sub-class - Oryza sativa
            subsp. japonica (Rice)
          Length = 1651

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 37/107 (34%), Positives = 63/107 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1349 GVPKKIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLNQILEDMLRACVL 1408

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL 503
            +   TWD  L  A  +YN++  ++   +P E L+G K   P   D +
Sbjct: 1409 DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTPLMWDQV 1455


>UniRef50_A5C215 Cluster: Putative uncharacterized protein; n=2;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 617

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 32/105 (30%), Positives = 60/105 (57%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT   +E ++  +K  L   ++
Sbjct: 148 GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSRQVELANKEIKNILMKVVI 207

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 208 TSRKDWSIKLHDSLWAYRTTYKTILGMSPYRLVYGKXCHLPVKVE 252


>UniRef50_A5BKJ4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 922

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 33/104 (31%), Positives = 60/104 (57%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D+G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 182 GVPKAIISDEGTHFCNKPFETLLAKYGVKHKVATPYHPQTFGQVELANREIKNILMKVVN 241

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
            ++  W + L  ++ AY +   +  G SP  L++G   ++P  +
Sbjct: 242 TSRRNWFVKLHDSLWAYRTTYKTILGMSPYRLVYGKACHLPVEV 285


>UniRef50_Q5AY31 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 727

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 40/103 (38%), Positives = 58/103 (56%), Gaps = 2/103 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIPK I +D+G+ F+S    ++  L GI    ++ +HPQT G+ ER +ST++ YLR Y  
Sbjct: 37  GIPKAITSDRGSQFTSNTWARICTLTGINRRLSTAHHPQTDGSTERMNSTVETYLRIYTC 96

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGF--KPYIP 521
            +Q  W+  L  A LA N    + TG SP  L  G+   P+ P
Sbjct: 97  YDQRDWNRLLPLAELAINGRTSTATGVSPFYLSHGYNLSPFSP 139


>UniRef50_A4RKZ9 Cluster: Putative uncharacterized protein; n=3;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 775

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 36/98 (36%), Positives = 57/98 (58%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  II+D+G  F S+  K L     I  + ++ +HP+T G  ER +++L++YLR+Y+ 
Sbjct: 471 GLPLTIISDRGTQFVSKFWKHLTTRLKIDSLLSTAHHPETDGQTERFNASLEQYLRAYVA 530

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
             Q+ W+ +L  A    NS+   TTG SP    +GF P
Sbjct: 531 YLQNNWESWLPLAEFTANSHKSETTGTSPFYATYGFHP 568


>UniRef50_Q9SUK5 Cluster: Retrotransposon like protein; n=3;
           Arabidopsis thaliana|Rep: Retrotransposon like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 687

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 34/95 (35%), Positives = 58/95 (61%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  I++D+   F+S+  K  +++ G +   ++ YHPQT G  ER+  TL++ LR+ ++
Sbjct: 376 GIPVSIVSDRDTRFTSKFWKPFQKVLGTRVNLSTAYHPQTDGQSERTIQTLEDMLRACVL 435

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           +    W+ YLR    AYN++  ++ G SP E L+G
Sbjct: 436 DWGGNWEKYLRLVEFAYNNSFQASIGMSPYEALYG 470


>UniRef50_Q9AYB6 Cluster: Polyprotein; n=47; Magnoliophyta|Rep:
            Polyprotein - Oryza sativa (Rice)
          Length = 2017

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 36/101 (35%), Positives = 61/101 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1715 GVPKKIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLNQILEDMLRACVL 1774

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   TWD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1775 DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTP 1815


>UniRef50_Q6WAY3 Cluster: Gag/pol polyprotein; n=7; core
            eudicotyledons|Rep: Gag/pol polyprotein - Pisum sativum
            (Garden pea)
          Length = 2262

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 36/114 (31%), Positives = 68/114 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ IITD G+N ++++MK+L + F I+H  +SPY P+  GA+E ++  +K+ +R  +V
Sbjct: 2036 GVPERIITDNGSNLNNKMMKELCKDFKIEHHNSSPYRPKMNGAVEAANKNIKKIVRKMVV 2095

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
                 W   L  A+  Y +++ ++TG +P  L++G +  +P  ++   L    D
Sbjct: 2096 -TYKDWHEMLPFALHGYRTSVRTSTGATPYSLVYGMEAVLPVEVEIPSLRVLLD 2148


>UniRef50_Q6MWI9 Cluster: B1159F04.11 protein; n=7; Oryza sativa|Rep:
            B1159F04.11 protein - Oryza sativa (Rice)
          Length = 1679

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 36/101 (35%), Positives = 61/101 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1417 GVPKKIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLNQILEDMLRACVL 1476

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   TWD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1477 DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTP 1517


>UniRef50_A5B281 Cluster: Putative uncharacterized protein; n=2;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 721

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 38/135 (28%), Positives = 72/135 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 194 GVPKAIISDGGTHFCNKPFEILLAKYGVKHKVATPYHPQTFGQVELANREIKNILMKVVN 253

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIRALN 464
            ++    + L  ++ AY +   +  G SP  L++G   ++P  + S+    Y + ++ L 
Sbjct: 254 TSRRDCSVRLHDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEVASMKRFLYLNEMKELR 313

Query: 463 HRLYYSRQKALQNIE 419
           +  Y +   A Q ++
Sbjct: 314 NDAYINSNIAKQRLK 328


>UniRef50_Q9UVC1 Cluster: Pol polyprotein; n=2; Capnodiales|Rep: Pol
            polyprotein - Cladosporium fulvum (Fulvia fulva)
          Length = 1243

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 39/98 (39%), Positives = 54/98 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P++ ITD+   F+S   K L    GIKH  ++ YHP+T G  ER++ TL++YLR YI 
Sbjct: 932  GFPEVFITDRDKLFTSNYWKTLMGTIGIKHKLSTAYHPETDGQTERTNQTLEQYLRHYIN 991

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
              Q  W   L  A +A N++   TT  +P    FG  P
Sbjct: 992  YAQDNWVSLLPMAQIALNNHKSETTSTTPFYANFGKDP 1029


>UniRef50_Q75LZ2 Cluster: Putative polyprotein; n=2; Oryza sativa
            (japonica cultivar-group)|Rep: Putative polyprotein -
            Oryza sativa subsp. japonica (Rice)
          Length = 2108

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 41/115 (35%), Positives = 64/115 (55%), Gaps = 1/115 (0%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ II+D+   F+S   K+L R  G +   +S YHPQT G  ER +  L+ +LR ++ 
Sbjct: 1883 GLPQAIISDRDRVFTSIFWKELFRRSGTQLQMSSSYHPQTDGQTERVNQCLEMFLRCFVH 1942

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP-YIPKSIDSLDLNTYSD 482
                 W  +L  A   YN++ HST   +P E +FG KP +   S+DS+ + +  D
Sbjct: 1943 ACPSRWSKWLSLAQFWYNTSFHSTLMLTPFEAMFGHKPRHFGLSVDSVGVPSALD 1997


>UniRef50_Q01L72 Cluster: H0321H01.8 protein; n=3; Eukaryota|Rep:
            H0321H01.8 protein - Oryza sativa (Rice)
          Length = 1602

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 36/98 (36%), Positives = 58/98 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I++D+   F+S++ +QL    G K  ++S YHPQ+ G  ER +  L+ YLR ++ 
Sbjct: 1234 GLPQTIVSDRDKIFTSQLWEQLFLRAGTKLHYSSAYHPQSDGQTERVNQCLEIYLRCFVH 1293

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
                 W  +L  A   YNS  HS+ G +P E+L+G+ P
Sbjct: 1294 STPSKWYSWLHLAEYWYNSTYHSSLGTTPFEVLYGYPP 1331


>UniRef50_A5JSC4 Cluster: Polyprotein; n=8; Poaceae|Rep: Polyprotein -
            Zea mays (Maize)
          Length = 1476

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 36/95 (37%), Positives = 56/95 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I++D+GA F +   +QL+   G K I +S YHPQT G  ER +  L++ LR+  +
Sbjct: 1180 GLPRTIVSDRGAQFVARFWEQLQESLGTKLIRSSAYHPQTDGQTERVNQILEDMLRACAI 1239

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            +    WD +L  A  AYN++  S+   +P E L G
Sbjct: 1240 DCGKNWDKHLSLAEFAYNNSYQSSLKMAPFEALHG 1274


>UniRef50_A5BI07 Cluster: Putative uncharacterized protein; n=6; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1803

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 33/95 (34%), Positives = 56/95 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D GA+F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1258 GVPKAIISDGGAHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 1317

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             ++  W + L  ++ AY +   +  G SP  L++G
Sbjct: 1318 ASRKDWSIRLHDSLWAYRTTYKTILGMSPYRLVYG 1352


>UniRef50_A5AQ81 Cluster: Putative uncharacterized protein; n=3;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 470

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 31/104 (29%), Positives = 61/104 (58%)
 Frame = -1

Query: 820 IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
           +PK II+++G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   ++ 
Sbjct: 1   MPKAIISNEGTHFCNKPFEALLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVIT 60

Query: 640 NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 61  SRKDWSIKLHDSLWAYRTTYKTILGMSPYRLVYGKACHLPVEVE 104


>UniRef50_A5AHC2 Cluster: Putative uncharacterized protein; n=3;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1270

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 35/105 (33%), Positives = 59/105 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 440 GVPKAIISDGGTHFCNKPFETLLAKYGVKHKEATPYHPQTSGQVELANREIKNILMKVVN 499

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            N+  W + L  ++ AY +      G SP  L++G   ++P  I+
Sbjct: 500 VNRKDWSIKLLDSLWAYRTAYKXILGMSPYRLVYGKACHLPVEIE 544


>UniRef50_A5AH69 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1631

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 31/95 (32%), Positives = 55/95 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D+G +F +   + L   +G+KH  A+PYHPQ  G +E ++  +K  L   ++
Sbjct: 1483 GVPKAIISDRGTHFCNRPFETLLAKYGVKHKVATPYHPQNSGQVELANMEIKNILMKVVI 1542

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             ++  W + L  ++ AY +   +  G SP  L++G
Sbjct: 1543 TSRRDWSIKLHDSLWAYRTTYKTILGMSPYRLVYG 1577


>UniRef50_A7K6N0 Cluster: Putative uncharacterized protein; n=11;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1413

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 41/103 (39%), Positives = 55/103 (53%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  II+D+   F+S+    L  L GIK   ++ +HPQT G  ER + T++ YLR YI 
Sbjct: 1241 GVPDEIISDRDKLFTSKFWSTLMALLGIKRKLSTAFHPQTDGQTERLNQTMEAYLRCYIN 1300

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKS 515
              Q  W   L  A  AYN++   TT  +P    FGF P   KS
Sbjct: 1301 YKQDNWVKLLPLAQFAYNTSETETTKVTPAYANFGFNPLAYKS 1343


>UniRef50_UPI0000F1E1CA Cluster: PREDICTED: hypothetical protein; n=1;
            Danio rerio|Rep: PREDICTED: hypothetical protein - Danio
            rerio
          Length = 933

 Score = 76.6 bits (180), Expect = 7e-13
 Identities = 45/130 (34%), Positives = 68/130 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I +DQG +F S ++K++  + GI+    SPYHPQ     ER + TL   L +   
Sbjct: 652  GLPTRIHSDQGRDFESGLIKEMLNMLGIRKSRTSPYHPQGDPQPERFNRTLLSMLGTLNP 711

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIRALN 464
              +H W  ++   + AYN   +  TG+SP  LLFG +  +P  +D +   T  D   A +
Sbjct: 712  TEKHRWSQHINRLVHAYNCTKNDATGYSPYYLLFGREARLP--VD-VCFGTSPDGKGAGS 768

Query: 463  HRLYYSRQKA 434
            HR Y  R K+
Sbjct: 769  HRQYVERMKS 778


>UniRef50_A5B284 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 501

 Score = 76.6 bits (180), Expect = 7e-13
 Identities = 33/96 (34%), Positives = 54/96 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D+G +F ++    +   + +KH  A+PYHPQT G +E ++  +   L   + 
Sbjct: 214 GVPKAIISDKGTHFCNKTFNNILARYEVKHKVATPYHPQTSGQVELANREMNNILMKVVN 273

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGF 536
            N   W+L L  A+ AY ++  +  G S   L+FGF
Sbjct: 274 ANHKDWELRLPDALWAYRTSFRTILGMSSYRLVFGF 309


>UniRef50_A6SRY0 Cluster: Putative uncharacterized protein; n=11;
            Sclerotiniaceae|Rep: Putative uncharacterized protein -
            Botryotinia fuckeliana B05.10
          Length = 1618

 Score = 76.6 bits (180), Expect = 7e-13
 Identities = 41/117 (35%), Positives = 61/117 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  II+D+   F+S+    L  L GIK   ++ +HPQT G  ER++ T++ YLR Y+ 
Sbjct: 1304 GVPDEIISDRDKLFTSKFWTTLLALMGIKRKLSTSFHPQTDGQTERTNQTMEAYLRCYVN 1363

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIR 473
              Q  W   L  A  AYN++   TT  +P    FGF P   K     ++N  S  ++
Sbjct: 1364 YRQDNWVELLPMAQFAYNTSETETTKITPARANFGFNPQAYKIPIPQEVNAESAIVQ 1420


>UniRef50_UPI0000F1FC2A Cluster: PREDICTED: similar to LReO_3; n=2;
           Danio rerio|Rep: PREDICTED: similar to LReO_3 - Danio
           rerio
          Length = 1478

 Score = 76.2 bits (179), Expect = 9e-13
 Identities = 33/68 (48%), Positives = 45/68 (66%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           +GIP  I+TDQG NF+S +MK + R  GI  I  +PYHPQT G +ER + TLK  LR ++
Sbjct: 784 VGIPNEILTDQGTNFTSRLMKMMHRQLGITAIKTTPYHPQTDGLVERFNQTLKNMLRKFV 843

Query: 646 VENQHTWD 623
            E +  W+
Sbjct: 844 SEIRKNWE 851


>UniRef50_UPI0000E46419 Cluster: PREDICTED: similar to
            OSJNBa0011F23.1; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to OSJNBa0011F23.1 -
            Strongylocentrotus purpuratus
          Length = 993

 Score = 76.2 bits (179), Expect = 9e-13
 Identities = 46/143 (32%), Positives = 73/143 (51%), Gaps = 8/143 (5%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ + TDQG NF S +MK++  + GIK     P HP++ G +ER + TL   + S + 
Sbjct: 739  GIPRELHTDQGRNFESNLMKEVCEMLGIKKTRTCPLHPRSDGFIERFNRTLITMVSSILD 798

Query: 643  ENQH--TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTY------ 488
             ++H   WD  +  AMLAY S +  +TG SP  ++ G +  +P  +     +T       
Sbjct: 799  PDRHQRDWDERIPYAMLAYRSAVQESTGESPAMMMLGREVTLPVDVIFTQPSTVEREEER 858

Query: 487  SDYIRALNHRLYYSRQKALQNIE 419
             DY   L  R+  + + A   +E
Sbjct: 859  GDYSEQLRDRIRDAHEMARSKLE 881


>UniRef50_Q53JH7 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=3; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            Ty3-gypsy sub-class - Oryza sativa subsp. japonica (Rice)
          Length = 1761

 Score = 76.2 bits (179), Expect = 9e-13
 Identities = 38/101 (37%), Positives = 57/101 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I++D+G  F+S   KQL    G    F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1470 GCPKKIVSDRGTQFTSRFWKQLHEALGTDLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1529

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            + + TWD  L  A  +YN++  ++   SP E +FG K   P
Sbjct: 1530 DFEGTWDRCLPYAEFSYNNSYQASIQMSPNEAMFGRKCRTP 1570


>UniRef50_A5C0S4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 384

 Score = 76.2 bits (179), Expect = 9e-13
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 1/136 (0%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ I+ D+   F S   K L    G K +F++  HPQ     E  + TL   LR+ I 
Sbjct: 208 GMPRTIVLDRDVKFFSYFWKTLWCKLGTKLLFSTTCHPQIDRQTEVVNMTLSTLLRAIIK 267

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIRALN 464
           +N  TW+  L     AYN  I+S T FSP E+++GF P  P  + +L L  +++     N
Sbjct: 268 KNIKTWEECLSHVEFAYNCTIYSATKFSPFEIVYGFNPLTPLDLRTLPLFEHANLDGKKN 327

Query: 463 HR-LYYSRQKALQNIE 419
            + +    +K   NIE
Sbjct: 328 TKFIMQIHEKVRLNIE 343


>UniRef50_A5AH70 Cluster: Putative uncharacterized protein; n=3; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 2203

 Score = 76.2 bits (179), Expect = 9e-13
 Identities = 35/105 (33%), Positives = 58/105 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +GI H  A+PYHPQT G +E +   +K  L   + 
Sbjct: 1574 GVPKAIISDGGTHFCNKPFEALLAKYGINHKVATPYHPQTSGQVELAKREIKNILMKVVN 1633

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY +   +  G SP  L++G   ++P  I+
Sbjct: 1634 TNRKDWSVKLLDSLWAYRTAYKTILGMSPYHLVYGKACHLPVEIE 1678


>UniRef50_A4RP66 Cluster: Putative uncharacterized protein; n=17;
            Pezizomycotina|Rep: Putative uncharacterized protein -
            Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 1596

 Score = 76.2 bits (179), Expect = 9e-13
 Identities = 35/98 (35%), Positives = 56/98 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I++D+G  F S+  K L     I  + ++ +HP+T G  ER +++L++YLR+Y+ 
Sbjct: 750  GLPLTIVSDRGTQFVSKFWKHLTTRLKIDSLLSTAHHPETDGQTERFNASLEQYLRAYVA 809

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
              Q  W+ +L  A    NS+   TTG SP    +GF P
Sbjct: 810  YLQDDWESWLPLAEFTANSHKSETTGTSPFYATYGFHP 847



 Score = 76.2 bits (179), Expect = 9e-13
 Identities = 35/98 (35%), Positives = 56/98 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I++D+G  F S+  K L     I  + ++ +HP+T G  ER +++L++YLR+Y+ 
Sbjct: 1353 GLPLTIVSDRGTQFVSKFWKHLTTRLKIDSLLSTAHHPETDGQTERFNASLEQYLRAYVA 1412

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
              Q  W+ +L  A    NS+   TTG SP    +GF P
Sbjct: 1413 YLQDDWESWLPLAEFTANSHKSETTGTSPFYATYGFHP 1450


>UniRef50_A4QRY3 Cluster: Putative uncharacterized protein; n=35;
            Magnaporthe grisea|Rep: Putative uncharacterized protein
            - Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 1357

 Score = 76.2 bits (179), Expect = 9e-13
 Identities = 35/98 (35%), Positives = 56/98 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I++D+G  F S+  K L     I  + ++ +HP+T G  ER +++L++YLR+Y+ 
Sbjct: 1105 GLPLTIVSDRGTQFVSKFWKHLTTRLKIDSLLSTAHHPETDGQTERFNASLEQYLRAYVA 1164

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
              Q  W+ +L  A    NS+   TTG SP    +GF P
Sbjct: 1165 YLQDDWESWLPLAEFTANSHKSETTGTSPFYATYGFHP 1202


>UniRef50_UPI0000E49332 Cluster: PREDICTED: similar to
            OSJNBa0011F23.1; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to OSJNBa0011F23.1 -
            Strongylocentrotus purpuratus
          Length = 1261

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 41/115 (35%), Positives = 61/115 (53%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I +DQG NF S ++++L +L+GI     +PYHP+  G  ER + TL   +RS  +
Sbjct: 961  GVPLRIHSDQGRNFESGLIRELCQLYGITKSRTTPYHPEGNGQTERFNRTLCAMIRSLPL 1020

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDY 479
              +  W   +   +  YN   H  T  SP  LL+G +PY P  +D L  N   D+
Sbjct: 1021 SERLKWPDVIGHLVFLYNCTPHKVTRISPFRLLYGREPYTP--LDQLLGNIEGDW 1073


>UniRef50_Q7X7A3 Cluster: OSJNBa0014F04.1 protein; n=19; Poaceae|Rep:
            OSJNBa0014F04.1 protein - Oryza sativa (Rice)
          Length = 1450

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I++D+G+ F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1115 GAPKKIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLNQILEDMLRACVL 1174

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   TWD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1175 DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTP 1215


>UniRef50_A5C7V3 Cluster: Putative uncharacterized protein; n=2;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 742

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 37/105 (35%), Positives = 64/105 (60%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  +I+D+G +F +EV   ++R + I+H  +S Y PQT GA+E ++  +K  LR  +V
Sbjct: 248 GVPYELISDRGVHFRAEVDTLVQR-YSIRHHRSSTYRPQTNGAVEAANKNIKRILRR-MV 305

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           E    W   L  A+ AY ++ H++TG +P  L++G +  +P  I+
Sbjct: 306 ETSRDWSEKLPFALWAYRTSFHTSTGATPYSLVYGMEAMLPVEIE 350


>UniRef50_UPI0000F1D47E Cluster: PREDICTED: similar to pol
            polyprotein; n=7; Danio rerio|Rep: PREDICTED: similar to
            pol polyprotein - Danio rerio
          Length = 1446

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 36/98 (36%), Positives = 54/98 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+ +++D+G  F+S   K   RL G     +S +HPQ+ G  ER +  ++  LR  + 
Sbjct: 1138 GFPQDMVSDRGPQFTSRFWKAFGRLIGSSISLSSGFHPQSNGQTERVNQEIERSLRCLVS 1197

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            +NQ TW   L  A  A+N+  HS+ G SP E  +GF P
Sbjct: 1198 DNQTTWSSRLVWAEFAHNTLYHSSLGMSPFECQYGFPP 1235


>UniRef50_Q9LJS9 Cluster: Retroelement pol polyprotein-like; n=1;
            Arabidopsis thaliana|Rep: Retroelement pol
            polyprotein-like - Arabidopsis thaliana (Mouse-ear cress)
          Length = 1118

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 32/105 (30%), Positives = 59/105 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+++I+D G +F ++V   L    G+ H  A+PYHPQTCG +E S+  +K  L   + 
Sbjct: 876  GVPRVVISDGGRHFINKVFANLLAKHGVNHKVATPYHPQTCGQVEISNREIKGILEKTVG 935

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            +++  W   L  A+  Y +   +  G +P  L++G   ++P  ++
Sbjct: 936  KSRKDWAAKLDDALWTYRTAYKTPIGTTPFNLIYGKSCHLPVELE 980


>UniRef50_A5BWD8 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1120

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 32/105 (30%), Positives = 59/105 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT   +E ++  +K  L   + 
Sbjct: 751  GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSEQVELANREIKNILMKLVN 810

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 811  TSRRDWSVKLHDSLWAYRTTYKTILGMSPYRLVYGKACHLPMEVE 855


>UniRef50_A5AKV0 Cluster: Putative uncharacterized protein; n=13;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 2067

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 34/105 (32%), Positives = 59/105 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D G +F ++  + L   + +KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 608 GVPKAIISDGGTHFCNKPFEALLAKYRVKHKVATPYHPQTSGQVELANREIKNILMKVVN 667

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            N+  W + L  ++ AY +   +  G SP  L++G   ++P  I+
Sbjct: 668 TNRKDWSVKLLDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEIE 712


>UniRef50_A5AJJ6 Cluster: Putative uncharacterized protein; n=4; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 2155

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 37/105 (35%), Positives = 64/105 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+D+G +F +EV   ++R +GI+H  +S Y PQT GA+E ++  +K  LR  +V
Sbjct: 1930 GVPHELISDRGVHFRAEVDTLVQR-YGIRHHRSSAYRPQTNGAVEAANKNIKRILRR-MV 1987

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            E    W   L  A+ AY ++  ++TG +P  L++G +  +P  I+
Sbjct: 1988 ETSRDWSEKLPFALWAYRTSFRTSTGATPYSLVYGMEAMLPVEIE 2032


>UniRef50_A7BIS0 Cluster: Pro-pol protein; n=1; Lentinula edodes|Rep:
            Pro-pol protein - Lentinula edodes (Shiitake mushroom)
            (Lentinus edodes)
          Length = 1274

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 35/98 (35%), Positives = 54/98 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P    +D+G  F++++M+ L    GIK    S Y PQ+ G  ER++  +++Y+R Y+ 
Sbjct: 971  GLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVG 1030

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
              Q  W  +L  A    NS  HS  G SP EL +G+ P
Sbjct: 1031 RRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLP 1068


>UniRef50_UPI0000E47C82 Cluster: PREDICTED: similar to LReO_3; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           LReO_3 - Strongylocentrotus purpuratus
          Length = 896

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 44/142 (30%), Positives = 71/142 (50%), Gaps = 7/142 (4%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           +G+PK + +DQG+NF S V  Q+ +  G+KH+ +S YHP++ GALER H TLK       
Sbjct: 197 VGLPKTVQSDQGSNFMSRVFNQVLKELGVKHVVSSAYHPESQGALERFHQTLK------- 249

Query: 646 VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI-------DSLDLNTY 488
               + WD  +   + A    +  + GFS  EL++G     P  +       D    N  
Sbjct: 250 ----NMWDEGVPLLLFAVRDAVQESLGFSSFELVYGHSVRGPLKLLKERLLCDDSQTNVL 305

Query: 487 SDYIRALNHRLYYSRQKALQNI 422
            +Y+     R++ + + A QN+
Sbjct: 306 -EYVSTFRERMHKAWEVARQNL 326


>UniRef50_Q9ZS84 Cluster: Polyprotein; n=1; Solanum lycopersicum|Rep:
            Polyprotein - Solanum lycopersicum (Tomato) (Lycopersicon
            esculentum)
          Length = 1542

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 36/104 (34%), Positives = 54/104 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I++D+   F+      L  + G +  F++  HPQT G  ER +  L+EYLR Y+ 
Sbjct: 1221 GVPADIVSDRDTRFTGRFWTALFNMMGTELKFSTANHPQTDGQTERINHLLEEYLRHYVT 1280

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
             +Q  W   L TA   YN +  S T  SP E++ G +P  P  +
Sbjct: 1281 ASQRNWVELLDTAQFCYNLHKSSATEMSPFEIVLGKQPMTPLDV 1324


>UniRef50_Q8RU68 Cluster: Putative 22 kDa kafirin cluster; Ty3-Gypsy
            type; n=6; Oryza sativa|Rep: Putative 22 kDa kafirin
            cluster; Ty3-Gypsy type - Oryza sativa (Rice)
          Length = 1230

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 37/101 (36%), Positives = 59/101 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I++D+   F S+  K L R  G K  F++ YHPQT G  ER +  +++ LRS I+
Sbjct: 922  GVPVRIVSDRDTRFLSKFWKSLHRAPGTKLDFSTAYHPQTDGQTERVNQIIEDMLRSCIL 981

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            E + +W+ ++  A  AYN++  S+   +P E L+G K   P
Sbjct: 982  EFKGSWEEFMPLAEFAYNNSYQSSIRMAPYEALYGRKCRTP 1022


>UniRef50_Q7XR39 Cluster: OSJNBa0014F04.8 protein; n=53;
            Magnoliophyta|Rep: OSJNBa0014F04.8 protein - Oryza sativa
            (Rice)
          Length = 1429

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 35/99 (35%), Positives = 60/99 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1326 GVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1385

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPY 527
            +   +WD  L  A  +YN++  ++   +P E L+G K +
Sbjct: 1386 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKSF 1424


>UniRef50_Q53NA3 Cluster: Retrotransposon protein, putative,
            unclassified; n=9; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 2122

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 36/105 (34%), Positives = 60/105 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ + TDQGA+F S+ +K     +GIK + +SPY+ Q  G  E S+ TL + ++  I 
Sbjct: 1937 GIPQTLTTDQGASFMSKEVKSFTESYGIKLLSSSPYYAQANGQAESSNKTLLKLVKKKIE 1996

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            E+   W   L  A+ A+  + H  T  +P EL++G +  +P  ++
Sbjct: 1997 EHPKRWHEVLSEALWAHRISKHGATKVTPCELVYGQEAVLPVEVN 2041


>UniRef50_Q53J91 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=2; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            Ty3-gypsy sub-class - Oryza sativa subsp. japonica (Rice)
          Length = 1509

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 38/101 (37%), Positives = 56/101 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I+ D+G  F+S   KQL    G    F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1257 GCPKKIVLDRGTQFTSRFWKQLHEALGTDLNFSTAYHPQTDGQTERVNQILEDMLRACAM 1316

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            + + TWD  L  A  +YN++  ++   SP E +FG K   P
Sbjct: 1317 DFEGTWDHCLPYAEFSYNNSYQASIQMSPNEAMFGRKCRTP 1357


>UniRef50_Q2QSH3 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            subclass, expressed; n=12; Magnoliophyta|Rep:
            Retrotransposon protein, putative, Ty3-gypsy subclass,
            expressed - Oryza sativa subsp. japonica (Rice)
          Length = 1656

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 35/101 (34%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1386 GVPKKIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLNQILEDMLRACVL 1445

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +    WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1446 DFGKIWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTP 1486


>UniRef50_Q0DC29 Cluster: Os06g0493000 protein; n=8; Eukaryota|Rep:
            Os06g0493000 protein - Oryza sativa subsp. japonica
            (Rice)
          Length = 1573

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 36/98 (36%), Positives = 52/98 (53%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P +I++D+   F+S   K++    G+K  F+S YHPQT G  ER +  L+ YLR    
Sbjct: 1283 GLPTVIVSDRDRIFTSSTWKEVFEKAGVKLHFSSAYHPQTDGQSERVNQCLENYLRCMTS 1342

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
                 W   L  A   YN+  H++ G SP + L G KP
Sbjct: 1343 SKPRKWKALLPHAEWWYNTTFHTSLGMSPYQALHGIKP 1380


>UniRef50_A5B1R6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 747

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 34/101 (33%), Positives = 59/101 (58%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D+G +F ++  K L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 331 GVPKAIISDEGTHFCNKPFKTLLAKYGVKHKVATPYHPQTSGQVELANQEIKNILVKVVN 390

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            ++  W + L  ++ AY +   +  G SP  L++G   ++P
Sbjct: 391 MSRRDWFVKLHDSLRAYITAHKTILGMSPYRLVYGKVCHLP 431


>UniRef50_A5B0Q3 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1853

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 37/101 (36%), Positives = 62/101 (61%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+D+GA+F +EV   L+  +GI+H  +S Y PQT GA+E ++  +K  LR  +V
Sbjct: 1628 GVPHELISDRGAHFRAEVDTLLQE-YGIRHHRSSAYRPQTNGAVEAANKNIKRILRK-MV 1685

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            E    W   L  A+ AY ++  ++TG +P  L++G +  +P
Sbjct: 1686 ETSRDWSEKLPFALWAYRTSFRTSTGATPYSLVYGMEAVLP 1726


>UniRef50_UPI00015B47C8 Cluster: PREDICTED: similar to AT07338p;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           AT07338p - Nasonia vitripennis
          Length = 389

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 34/103 (33%), Positives = 57/103 (55%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P++ ++D G  F ++ + Q  +  G++H    PYHPQ    +E+ + T+   +R+ I 
Sbjct: 168 GAPEVFLSDNGTEFKNKTIDQYLKEQGVRHELTPPYHPQA-NPVEKVNRTINNMVRALIE 226

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKS 515
           EN +TWD  L      Y +  HS+TG SP  L++G +P  P +
Sbjct: 227 ENHNTWDERLSDIAFGYITVPHSSTGVSPAILMYGTQPRKPSA 269


>UniRef50_UPI0000E4917A Cluster: PREDICTED: similar to zinc finger
            protein; n=5; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to zinc finger protein -
            Strongylocentrotus purpuratus
          Length = 1548

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 34/96 (35%), Positives = 55/96 (57%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            +G+P  +++D G  F S++M+++ +L  +K I +S YHP   G +ER ++ +K  L+   
Sbjct: 788  VGVPCEVMSDLGTQFVSDLMRKVSQLLSVKQITSSRYHPICNGLVERYNAVVKTALKRLC 847

Query: 646  VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             E    WD YL   + A      S+ GFSP ELL+G
Sbjct: 848  SEEPRQWDRYLPALLFALREAPSSSLGFSPFELLYG 883


>UniRef50_Q9SHM3 Cluster: F7F22.17; n=10; Arabidopsis thaliana|Rep:
            F7F22.17 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 1799

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 33/105 (31%), Positives = 60/105 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+++I+D G +F ++V + L +  G+KH  A+PY+PQT G +E S+  +K  L   + 
Sbjct: 1558 GVPRVVISDGGKHFINKVFENLLKKHGVKHKVATPYNPQTSGQVEISNREIKTILEKTVG 1617

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
              +  W   L  A+ AY +   +  G +P  LL+G   ++P  ++
Sbjct: 1618 ITRKDWSAKLDDALWAYRTAFKTPIGTTPFNLLYGKSCHLPVELE 1662


>UniRef50_Q8SB62 Cluster: Putative polyprotein; n=1; Oryza sativa
            (japonica cultivar-group)|Rep: Putative polyprotein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1322

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 37/101 (36%), Positives = 56/101 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I++D+G  F+S   KQL    G    F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1031 GCPKKIVSDRGTQFTSRFWKQLHEALGTDLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1090

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            + + TWD  L     +YN++  ++   SP E +FG K   P
Sbjct: 1091 DFEGTWDRCLPYTEFSYNNSYQASIQMSPNEAMFGRKCRTP 1131


>UniRef50_Q7XQM2 Cluster: OSJNBa0089E12.2 protein; n=79;
            Eukaryota|Rep: OSJNBa0089E12.2 protein - Oryza sativa
            (Rice)
          Length = 1764

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIPK I++D+G+ F+S   K+L+   G +  F++ YHPQT G  E  +  L++ LR+ ++
Sbjct: 1462 GIPKKIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTECLNQILEDMLRACVL 1521

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   TWD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1522 DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTP 1562


>UniRef50_Q7XKP3 Cluster: OSJNBa0032N05.6 protein; n=3; Oryza
            sativa|Rep: OSJNBa0032N05.6 protein - Oryza sativa (Rice)
          Length = 1528

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1226 GVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1285

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1286 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 1326


>UniRef50_Q2QZV5 Cluster: Retrotransposon protein, putative,
           Ty3-gypsy subclass; n=10; Oryza sativa|Rep:
           Retrotransposon protein, putative, Ty3-gypsy subclass -
           Oryza sativa subsp. japonica (Rice)
          Length = 1874

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 163 GVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 222

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 223 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 263



 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1572 GVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1631

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1632 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 1672


>UniRef50_Q01N53 Cluster: OSIGBa0102B11.1 protein; n=47;
            Magnoliophyta|Rep: OSIGBa0102B11.1 protein - Oryza sativa
            (Rice)
          Length = 1601

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1299 GVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1358

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1359 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 1399


>UniRef50_Q01N00 Cluster: OSIGBa0132I10.1 protein; n=58;
            Magnoliophyta|Rep: OSIGBa0132I10.1 protein - Oryza sativa
            (Rice)
          Length = 1670

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1368 GVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1427

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1428 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 1468


>UniRef50_Q01JD2 Cluster: OSIGBa0130P02.7 protein; n=23; Oryza
            sativa|Rep: OSIGBa0130P02.7 protein - Oryza sativa (Rice)
          Length = 1741

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1439 GVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1498

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1499 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 1539


>UniRef50_A5BIJ0 Cluster: Putative uncharacterized protein; n=3; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 2129

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 36/105 (34%), Positives = 64/105 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+D+G +F +EV   ++R +GI+H  ++ Y PQT GA+E ++  +K  LR  +V
Sbjct: 1904 GVPHELISDRGVHFRAEVDTLVQR-YGIRHHRSTAYRPQTNGAVEAANKNIKRILRK-MV 1961

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            E    W   L  A+ AY ++  ++TG +P  L++G +  +P  I+
Sbjct: 1962 ETSRDWSEKLPFALWAYRTSFRTSTGATPYSLVYGMEAVLPVEIE 2006


>UniRef50_A5BI69 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1628

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 33/105 (31%), Positives = 59/105 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1120 GVPKSIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 1179

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY +   +    SP  L++G   ++P  ++
Sbjct: 1180 VNRKDWSIKLLDSLWAYRTAYKTILEMSPYRLVYGKACHLPVEVE 1224


>UniRef50_A5AHJ4 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 989

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 32/105 (30%), Positives = 59/105 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYH QT G +E ++  +K  L   + 
Sbjct: 823  GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHSQTSGQVELANREIKSILMKVVN 882

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 883  TSKRDWSVKLHDSLWAYKTAYKTILGMSPYRLVYGKACHLPAEVE 927


>UniRef50_Q7XWI0 Cluster: OSJNBa0085C10.14 protein; n=25; Oryza
           sativa|Rep: OSJNBa0085C10.14 protein - Oryza sativa
           (Rice)
          Length = 756

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 35/101 (34%), Positives = 60/101 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S+  K+L+   G K  F++ YHPQT    ER +  L++ LR+  +
Sbjct: 575 GVPKKIVSDRGSQFTSKFWKKLQEEMGSKLNFSTAYHPQTDEQTERVNQILEDMLRACAL 634

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 635 DFNRSWDKILPYAEFSYNNSYQASLQMAPYEALYGRKGRTP 675


>UniRef50_Q7XW39 Cluster: OSJNBb0062H02.17 protein; n=5; Oryza sativa
            (japonica cultivar-group)|Rep: OSJNBb0062H02.17 protein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1629

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 36/98 (36%), Positives = 56/98 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ +I+D+   F+S +   L RL G +   +S YHPQT G  ER +  L+ +LR ++ 
Sbjct: 1291 GLPQSLISDRDRIFTSTLWTTLFRLAGTQLRMSSSYHPQTDGQTERVNQCLETFLRCFVH 1350

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
                 W  +L  A   YN++ HS  G +P E+L+G KP
Sbjct: 1351 ACPSQWSRWLALAEYWYNTSFHSALGTTPFEVLYGHKP 1388


>UniRef50_Q01JC4 Cluster: OSIGBa0122F23.6 protein; n=116; cellular
            organisms|Rep: OSIGBa0122F23.6 protein - Oryza sativa
            (Rice)
          Length = 1346

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 35/101 (34%), Positives = 62/101 (61%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S+  ++L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1044 GVPKKIVSDRGSQFTSKFWQKLQSELGTRLNFSTAYHPQTDGQTERVNQILEDMLRACVL 1103

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   +WD  L  A  +YN++  ++   SP E L+G K   P
Sbjct: 1104 DFGGSWDKNLPYAEFSYNNSYQASLQMSPNEALYGRKCRTP 1144


>UniRef50_A5X2S4 Cluster: Polyprotein; n=3; Spermatophyta|Rep:
            Polyprotein - Primula vulgaris
          Length = 1359

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 34/98 (34%), Positives = 56/98 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D+   F+S+  K+L  L G K + ++ +HPQT G  E  + +L+ YLR Y  
Sbjct: 1098 GLPKKIISDRDTIFTSDFWKELFHLLGTKLLLSTAFHPQTDGQTEIVNKSLETYLRCYTS 1157

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            +    W  ++  A   YNS  H++    P + L+G++P
Sbjct: 1158 QYPKNWAKWIYLAEFWYNSTTHTSIKMPPFKALYGYEP 1195


>UniRef50_A5C6M0 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1651

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 30/105 (28%), Positives = 58/105 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F +   + +   + +KH  A+PYHPQT G +E ++  +K  L   ++
Sbjct: 1221 GVPKAIISDGGTHFCNNPFETILVKYRVKHKVATPYHPQTSGQVELANREIKNILMKVVI 1280

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            +++  W + L   +  Y +   +  G SP  L++G   ++P  ++
Sbjct: 1281 KSRKNWSIKLHDLLWPYRTTYKTILGMSPYRLVYGKACHLPMEVE 1325


>UniRef50_A5BKG7 Cluster: Putative uncharacterized protein; n=9; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 2089

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 37/101 (36%), Positives = 62/101 (61%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+D+G +F +EV   L++ + I+H  +S Y PQT GA+E ++  +K  LR  IV
Sbjct: 1864 GVPHELISDRGVHFRAEVDALLQK-YAIRHHRSSAYRPQTNGAVEAANKNIKRILRK-IV 1921

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            E    W   L  A+ AY ++ H++TG +P  L++G +  +P
Sbjct: 1922 ETSRDWLEKLPFALWAYRTSFHTSTGATPYSLVYGMEVVLP 1962


>UniRef50_A5APQ1 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1185

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 32/95 (33%), Positives = 55/95 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 754  GVPKAIISDGGIHFCNKSFETLLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 813

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             ++  W + L  ++  Y +N  +  G SP  L++G
Sbjct: 814  TSRRDWSVKLHDSLWVYRTNYKTILGMSPYCLVYG 848


>UniRef50_A5ACR1 Cluster: Putative uncharacterized protein; n=5; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1896

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 36/105 (34%), Positives = 63/105 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+D+G +F +EV   ++R + I+H  ++ Y PQT GA+E ++  +K  LR  +V
Sbjct: 1703 GVPHELISDRGVHFRAEVDTLIQR-YNIRHHRSTAYRPQTNGAVEAANKNIKRILRK-MV 1760

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            E    W   L  A+ AY ++  ++TG +P  L++G K  +P  I+
Sbjct: 1761 ETSRDWSEKLPFALWAYRTSFRTSTGATPYSLVYGMKAVLPVEIE 1805


>UniRef50_Q99315 Cluster: Transposon Ty3-G Gag-Pol polyprotein
            (Gag3-Pol3) (Transposon Ty3-1 TYA-TYB polyprotein)
            [Contains: Capsid protein (CA) (p24); Spacer peptide p3;
            Nucleocapsid protein p11 (NC); Ty3 protease (EC 3.4.23.-)
            (PR) (p16); Spacer peptide J; Reverse
            transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7)
            (EC 3.1.26.4) (RT) (RT-RH) (p55); Integrase p61 (IN);
            Integrase p58 (IN)]; n=12; Fungi/Metazoa group|Rep:
            Transposon Ty3-G Gag-Pol polyprotein (Gag3-Pol3)
            (Transposon Ty3-1 TYA-TYB polyprotein) [Contains: Capsid
            protein (CA) (p24); Spacer peptide p3; Nucleocapsid
            protein p11 (NC); Ty3 protease (EC 3.4.23.-) (PR) (p16);
            Spacer peptide J; Reverse transcriptase/ribonuclease H
            (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (RT) (RT-RH)
            (p55); Integrase p61 (IN); Integrase p58 (IN)] -
            Saccharomyces cerevisiae (Baker's yeast)
          Length = 1547

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 39/115 (33%), Positives = 59/115 (51%), Gaps = 2/115 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+ I +D+    +++  ++L +  GIK   +S  HPQT G  ER+  TL   LR+Y  
Sbjct: 1228 GFPRTITSDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLRAYAS 1287

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP--KSIDSLDLNTYS 485
             N   W +YL      YNS    T G SP E+  G+ P  P  KS D ++  +++
Sbjct: 1288 TNIQNWHVYLPQIEFVYNSTPTRTLGKSPFEIDLGYLPNTPAIKSDDEVNARSFT 1342


>UniRef50_Q94LP8 Cluster: Putative polyprotein; n=1; Oryza sativa
            (japonica cultivar-group)|Rep: Putative polyprotein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1409

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 32/98 (32%), Positives = 57/98 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  IITD+   F+S++ +++ +   ++  F++ YHPQT G  ER +  L+ YLRS   
Sbjct: 1217 GMPMAIITDRDRIFTSQLFQEVFKAMKVQLRFSTAYHPQTDGQTERVNQCLESYLRSMAF 1276

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            +  H W  +L  A   YN+  H++   +P + ++G+ P
Sbjct: 1277 QEPHQWYSWLALAEWWYNTTYHTSLQMTPFQAMYGYPP 1314


>UniRef50_Q6VPE6 Cluster: Putative integrase; n=1; Petunia x
           hybrida|Rep: Putative integrase - Petunia hybrida
           (Petunia)
          Length = 437

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 43/136 (31%), Positives = 65/136 (47%), Gaps = 1/136 (0%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ I++D+   F S   + L    G K +F++ +HPQT G  E  + TL   LR+   
Sbjct: 97  GVPQTIVSDRDTKFLSHFWRSLWGALGTKLLFSTSHHPQTDGQTEVVNRTLGALLRAMTR 156

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYI-RAL 467
               TW   L     AYN  +HS  G +P E ++GF P IP  +  L      ++  +A 
Sbjct: 157 GKAGTWIDRLPMMEFAYNRTLHSMIGMTPFECVYGFNPLIPLDLTPLPREMVVNFEGKAR 216

Query: 466 NHRLYYSRQKALQNIE 419
              L     KA +N+E
Sbjct: 217 AKALVELHAKAKKNLE 232


>UniRef50_Q6MWH2 Cluster: B1160F02.4 protein; n=2; Oryza sativa
            (japonica cultivar-group)|Rep: B1160F02.4 protein - Oryza
            sativa subsp. japonica (Rice)
          Length = 1618

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 35/101 (34%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+     +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1316 GVPKKIVSDRGSQFTSHFWKKLQEELRTQLNFSTAYHPQTDGQTERLNQILEDMLRACVL 1375

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   TWD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1376 DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTP 1416


>UniRef50_Q60ET2 Cluster: Putative polyprotein; n=1; Oryza sativa
            (japonica cultivar-group)|Rep: Putative polyprotein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1154

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 39/109 (35%), Positives = 56/109 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I++D+   F S   K L    G K +F++  H Q  G +E  + TL   LR  I 
Sbjct: 925  GVPRTIVSDRDVKFMSYFWKTLWAKLGTKLLFSTTCHSQIDGQMEVVNRTLSMLLRMMIK 984

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDL 497
            +N   W+  L     AYN  +HSTT  SP E+++GF P  P  +  L L
Sbjct: 985  KNLKEWEDCLPHVEFAYNRVVHSTTQLSPFEVVYGFNPITPLDLLPLPL 1033


>UniRef50_Q2R3G0 Cluster: Retrotransposon protein, putative,
            unclassified; n=1; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 1485

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 1/109 (0%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  II+D+   F+S + K+L    G +   +S YHPQT G  ER +  L+ +LR ++ 
Sbjct: 1140 GLPCAIISDRDRVFTSTLWKELFLRAGTQLRMSSSYHPQTDGQTERVNQCLETFLRCFVH 1199

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP-YIPKSIDSLD 500
                 W  +L  A   YNS+ HS    +P E LFG KP Y   +I ++D
Sbjct: 1200 SCPKQWKHWLGMAQFWYNSSYHSAIAMTPFEALFGHKPSYFGLTITAVD 1248


>UniRef50_A5C747 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 615

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 31/105 (29%), Positives = 59/105 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK+II+D+GA+  ++  + L   +G+KH  A+PYHPQT G +E  +  +K  L   + 
Sbjct: 81  GAPKVIISDEGAHCCNKPFETLLAKYGVKHKVATPYHPQTSGQVELVNKEIKNILMKVVN 140

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            ++  W + +  ++ AY +   +  G  P  L++G   ++P  ++
Sbjct: 141 ASRKDWSVKIHDSLWAYRTTYKTILGMLPYRLVYGKGCHLPMEVE 185


>UniRef50_A5AHS1 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1410

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 32/105 (30%), Positives = 59/105 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G ++ ++  +K  L   + 
Sbjct: 851  GVPKTIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVKLANREIKNILMKMVN 910

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY +   +  G SP  +++G    +P  ++
Sbjct: 911  TNREDWSVKLLDSLWAYITAYKTILGMSPYRIVYGKACLLPVEVE 955


>UniRef50_Q2H755 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 930

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 37/98 (37%), Positives = 56/98 (57%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  II+D+G  F SE  ++L     I    +S +HP+T G  ER ++ L++YLR+++ 
Sbjct: 629 GSPDTIISDRGTQFVSEFWRELSARLSITLKPSSAFHPETDGQTERVNAILEQYLRAFMN 688

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            +Q  W  +L  A  A N+ +  TTGFSP    +GF P
Sbjct: 689 FHQDDWVDWLLLAEFASNNTVSETTGFSPFFANYGFNP 726


>UniRef50_Q8JIZ1 Cluster: Polyprotein; n=1; Danio rerio|Rep:
            Polyprotein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 2237

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 36/95 (37%), Positives = 57/95 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+II +D G +F +E +  +E+L GIK  + + YHPQ+ G +ER + TLK  L     
Sbjct: 1842 GFPRIIRSDNGTHFKNEHLADVEKLLGIKLRYGAVYHPQSQGKVERLNLTLKNKLAKICH 1901

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            +++  W   L  A+++   +I+ TTGF+P EL  G
Sbjct: 1902 KSKLNWVDALPIALMSVRCSINRTTGFTPFELATG 1936


>UniRef50_Q8S6W4 Cluster: Putative pol polyprotein; n=1; Oryza
            sativa|Rep: Putative pol polyprotein - Oryza sativa
            (Rice)
          Length = 1508

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 36/105 (34%), Positives = 59/105 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ + TDQGA+F S+ +K     +GIK + +SPY+ Q  G  E S+ TL + ++  I 
Sbjct: 1273 GIPQTLTTDQGASFMSKEVKNFAESYGIKLLSSSPYYAQANGQAESSNKTLLKLVKKKIE 1332

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            E    W   L  A+ A+  + H  T  +P EL++G +  +P  ++
Sbjct: 1333 EYPKRWHEVLFEALWAHRISKHGATKVTPFELVYGQEAVLPVEVN 1377


>UniRef50_Q7XQR0 Cluster: OSJNBa0091D06.9 protein; n=9; Oryza
            sativa|Rep: OSJNBa0091D06.9 protein - Oryza sativa (Rice)
          Length = 1762

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 37/101 (36%), Positives = 56/101 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I++D+G  F+S   KQL    G    F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1471 GCPKKIVSDRGTQFTSRFWKQLHEALGTDLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1530

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            + + TWD  L  A  +YN++  ++   SP   +FG K   P
Sbjct: 1531 DFEGTWDRCLPYAEFSYNNSYQASIQMSPNGAMFGRKCRTP 1571


>UniRef50_Q7XPJ7 Cluster: OSJNBa0087O24.13 protein; n=5; Oryza
            sativa|Rep: OSJNBa0087O24.13 protein - Oryza sativa
            subsp. japonica (Rice)
          Length = 1311

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 35/98 (35%), Positives = 52/98 (53%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P +I++D+   F+S+  K +    G+K  F+S YHPQT G  ER +  L+ YLR    
Sbjct: 1021 GLPAVIVSDRDRIFTSQTWKDVFEKAGVKLHFSSAYHPQTDGQTERVNQCLENYLRCMTF 1080

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
                 W   L  A   YN++ H+T G +P + L G  P
Sbjct: 1081 TKPKKWKSLLAYAKWWYNTSFHTTLGMTPYQALHGVPP 1118


>UniRef50_Q6L3M7 Cluster: Gag-pol protein, putative; n=4;
            Magnoliophyta|Rep: Gag-pol protein, putative - Solanum
            demissum (Wild potato)
          Length = 1554

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 34/95 (35%), Positives = 59/95 (62%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  II+D+GA F+++  K  ++  G K   ++ ++PQT G  ER+  TL++ LR+ ++
Sbjct: 1305 GIPISIISDRGAQFTAQFWKSFKKGLGSKVNLSTAFYPQTDGQAERTIHTLEDMLRACVI 1364

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            + +  WD +L     AYN++ HS+   +P E L+G
Sbjct: 1365 DFKGNWDDHLPLIEFAYNNSYHSSIHMAPYEALYG 1399


>UniRef50_Q53LW4 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=1; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            Ty3-gypsy sub-class - Oryza sativa subsp. japonica (Rice)
          Length = 1506

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 32/95 (33%), Positives = 59/95 (62%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S++ ++L+   G +  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1204 GVPKKIVSDRGSQFTSKIWQKLQEELGTRLNFSTTYHPQTYGQTERVNQILEDMLRACAL 1263

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            +    WD  L  A  +YN++  ++   +P E L+G
Sbjct: 1264 DFGGAWDKSLPYAEFSYNNSYQASLQMAPFEALYG 1298


>UniRef50_Q01JF4 Cluster: H0502G05.12 protein; n=33; Oryza sativa|Rep:
            H0502G05.12 protein - Oryza sativa (Rice)
          Length = 1877

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 37/101 (36%), Positives = 56/101 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I++D+G  F+S   KQL    G    F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1586 GCPKKIVSDRGTQFTSRFWKQLHEALGTDLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1645

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            + + TWD  L  A  +YN++  ++   SP   +FG K   P
Sbjct: 1646 DFEGTWDRCLPYAEFSYNNSYQASIQMSPNGAMFGRKCRTP 1686


>UniRef50_A5BVP5 Cluster: Putative uncharacterized protein; n=5; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1979

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 32/105 (30%), Positives = 58/105 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+ K II+D G +F ++  + L   +G+KH  A+PYHP T G +E ++  +K  L   + 
Sbjct: 1425 GVXKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPXTSGQVELANREIKNILMKVVN 1484

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 1485 VNRKDWSIKLLDSLWAYRTXYXTILGMSPYRLVYGKACHLPXEVE 1529


>UniRef50_A5B213 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1197

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 33/105 (31%), Positives = 57/105 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D   +F ++  + L   +G+KH  A PYHPQT G +E ++  +K  L   + 
Sbjct: 917  GVPKAIISDGATHFCNKPFETLLAKYGVKHKVAIPYHPQTSGQVELANREIKNILMKVMN 976

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W   L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 977  TNRKDWSAKLLDSLWAYRTTYKTILGMSPYRLVYGKTCHLPVELE 1021


>UniRef50_A5AY22 Cluster: Putative uncharacterized protein; n=6; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 2004

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 36/105 (34%), Positives = 63/105 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+D+G +F +EV   ++R + I+H  +S Y PQT GA+E ++  +K  LR  +V
Sbjct: 1779 GVPHELISDRGVHFRAEVDTLVQR-YSIRHHRSSAYRPQTNGAVEAANKNIKRILRK-MV 1836

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            E    W   L  A+ AY ++  ++TG +P  L++G +  +P  I+
Sbjct: 1837 ETSRDWSEKLPFALWAYRTSFRTSTGATPYSLVYGMEAVLPVEIE 1881


>UniRef50_Q9AYC2 Cluster: Polyprotein; n=37; Oryza sativa|Rep:
            Polyprotein - Oryza sativa (Rice)
          Length = 2162

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 34/99 (34%), Positives = 60/99 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S+  ++L+   G +  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1721 GVPKKIVSDRGSQFTSKFWQKLQEELGTRLNFSTAYHPQTDGQTERVNLILEDMLRACAL 1780

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPY 527
            +    WD  L  A  +YN++  ++   +P E L+G K Y
Sbjct: 1781 DFGGAWDKSLPYAEFSYNNSYQASLQMAPFEALYGRKLY 1819


>UniRef50_Q94BM2 Cluster: Gag-pol polyprotein; n=29;
            Magnoliophyta|Rep: Gag-pol polyprotein - Hordeum vulgare
            (Barley)
          Length = 1720

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 36/101 (35%), Positives = 54/101 (53%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I++D+ A F S   + L    G K +F++  HPQT G  E  + +L   LR+ + 
Sbjct: 1382 GVPNTIVSDRDAKFLSHFWRCLWAKLGTKLLFSTTCHPQTDGQTEVVNRSLSTMLRAVLK 1441

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
             N   W+  L     AYN ++HSTT   P E+++GF P  P
Sbjct: 1442 NNIKLWEECLPHIEFAYNRSLHSTTKMCPFEIVYGFLPRAP 1482


>UniRef50_Q7XXG1 Cluster: OSJNBb0089K24.9 protein; n=1; Oryza sativa
            (japonica cultivar-group)|Rep: OSJNBb0089K24.9 protein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1320

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 35/101 (34%), Positives = 61/101 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S+  K+L+   G K  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1018 GVPKKIVSDRGSQFTSKFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACVL 1077

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   +WD  L  A  +Y ++  ++   +P E L+G K   P
Sbjct: 1078 DFGGSWDKNLPYAEFSYINSYQASLQMAPYEALYGRKCRTP 1118


>UniRef50_Q7F9N8 Cluster: OSJNBa0041M06.5 protein; n=2; Oryza sativa
            (japonica cultivar-group)|Rep: OSJNBa0041M06.5 protein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1954

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 35/105 (33%), Positives = 59/105 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ + TDQGA+F S+ +K     +GIK + + PY+ Q  G  E S+ TL + ++  I 
Sbjct: 1776 GIPQTLTTDQGASFMSKEVKNFAESYGIKLLSSYPYYAQANGQAESSNKTLLKLVKKKIE 1835

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            E+   W   L  A+ A+  + H  T  +P EL++G +  +P  ++
Sbjct: 1836 EHPKRWHEVLSEALWAHRISKHGATKVTPFELVYGQEAVLPVEVN 1880


>UniRef50_Q2QRZ1 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            subclass; n=7; Oryza sativa|Rep: Retrotransposon protein,
            putative, Ty3-gypsy subclass - Oryza sativa subsp.
            japonica (Rice)
          Length = 1571

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 34/101 (33%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S+  ++L+   G +  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1353 GVPKKIVSDRGSQFTSKFWQKLQEKLGTRLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1412

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +    WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1413 DFGGAWDKNLPYAEFSYNNSYQASLQMAPFEALYGRKCRTP 1453


>UniRef50_A5CBL5 Cluster: Putative uncharacterized protein; n=3; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1996

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 35/105 (33%), Positives = 64/105 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+D+G +F +EV   ++R +GI+H  ++ Y PQT GA+E ++  +K  L+  +V
Sbjct: 1834 GVPHELISDRGVHFRAEVDTLVQR-YGIRHHRSTAYRPQTNGAVEAANKNIKRILQK-MV 1891

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            E    W   L  A+ AY ++  ++TG +P  L++G +  +P  I+
Sbjct: 1892 ETSRDWSEKLPFALWAYRTSFRTSTGATPYSLVYGMEAMLPVKIE 1936


>UniRef50_A5AVY5 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1412

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 41/138 (29%), Positives = 73/138 (52%), Gaps = 9/138 (6%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I  D+   F+S   ++  +L G+    ++ YHPQT G  E  +  ++ YLR  + 
Sbjct: 1149 GLPHSITCDRDPIFTSVFWQEFFKLQGVSLQLSTAYHPQTDGQTEVVNRCIETYLRCMVG 1208

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK-----PYIPK--SIDSLD--LNT 491
            +N   W  ++  A   YN++ HS+   SP E L+G+      PY PK  +++++D  LN 
Sbjct: 1209 DNPGQWANWISLAEFWYNTSYHSSLKMSPFEALYGYAPPLQIPYFPKDSNVEAIDRVLNE 1268

Query: 490  YSDYIRALNHRLYYSRQK 437
               +++ L H L  ++Q+
Sbjct: 1269 RESWLQLLKHHLSKAQQR 1286


>UniRef50_Q9XZR7 Cluster: Protease, reverse transcriptase,
            ribonuclease H, integrase precursor; n=4;
            Endopterygota|Rep: Protease, reverse transcriptase,
            ribonuclease H, integrase precursor - Drosophila buzzatii
            (Fruit fly)
          Length = 1147

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 37/112 (33%), Positives = 61/112 (54%), Gaps = 1/112 (0%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK++ITD G  F+S   K      G++H   +PY PQ     ER++ T+K  +  +  
Sbjct: 913  GAPKVLITDNGTQFTSRAFKNFLDELGVRHQLTAPYTPQE-NPTERANRTVKTMIAQFAG 971

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI-DSLDLNT 491
             +Q  WD  L    LA NS++ ++TG++   +  G +P +PK++ D+  L T
Sbjct: 972  SDQRCWDEALPELTLAVNSSVSASTGYTAAFITQGREPRLPKTMFDAQTLGT 1023


>UniRef50_Q15F66 Cluster: Pol polyprotein; n=1; Nosema bombycis|Rep:
            Pol polyprotein - Nosema bombycis
          Length = 1270

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 36/107 (33%), Positives = 59/107 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G  K+I +DQG  F+++++  +  L+G +   +SPYHPQ+ G  ER++ T+ E +   + 
Sbjct: 1014 GPVKVIRSDQGLEFTNKLVNSVAELWGSRFRHSSPYHPQSNGLAERTNRTVVEKMSKAMT 1073

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL 503
            E    WD  L   ++ Y  +I      SP  LL+G  P IP ++ SL
Sbjct: 1074 EYSQNWDKVLPYVLMQYRVSIIERFNASPFMLLYGRTPQIPSTLLSL 1120


>UniRef50_UPI0000E49205 Cluster: PREDICTED: similar to novel
           transposon; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to novel transposon -
           Strongylocentrotus purpuratus
          Length = 188

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 38/95 (40%), Positives = 55/95 (57%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP+I+++D G  F+S   +Q  +  GIKH F++PYHP + G  ER   TLK+ LR+   
Sbjct: 21  GIPQILVSDNGTQFTSSKFQQFVKSNGIKHKFSAPYHPSSNGQAERFVQTLKQALRA-AR 79

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           ++  +    L   + AY S  HS TG +P  LL G
Sbjct: 80  KDGGSIQAKLERFLFAYRSASHSVTGETPATLLMG 114


>UniRef50_Q7XGB8 Cluster: Retrotransposon protein, putative,
           Ty3-gypsy subclass; n=2; Oryza sativa|Rep:
           Retrotransposon protein, putative, Ty3-gypsy subclass -
           Oryza sativa subsp. japonica (Rice)
          Length = 1264

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 35/101 (34%), Positives = 57/101 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S+  ++L+   G +  F   YHPQT G  ER +  L++ LR+  +
Sbjct: 461 GVPKKIVSDRGSQFTSKFWQKLQEELGTRLNFIIAYHPQTDGQTERVNQILEDMLRACAL 520

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +    WD  L  A  +YN+N   +   +P E L+G K   P
Sbjct: 521 DFGGAWDKSLPYAKFSYNNNYQDSLQMAPFETLYGRKCRTP 561


>UniRef50_Q53KY4 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=7; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            Ty3-gypsy sub-class - Oryza sativa subsp. japonica (Rice)
          Length = 1333

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 44/141 (31%), Positives = 75/141 (53%), Gaps = 11/141 (7%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S+  ++L+   G +  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1031 GVPKKIVSDRGSQFTSKFWQKLQEELGTRLNFSTAYHPQTDGPTERVNQILEDMLRACAL 1090

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLD---------LNT 491
            +    WD  L  A  +YN++  ++   +P E L+G +   P   D            LN 
Sbjct: 1091 DFGGAWDKSLPYAEFSYNNSYQASLQMAPFEALYGRRCRTPLFWDQTGERQLFGTEALNE 1150

Query: 490  YSDYIRALNHRL--YYSRQKA 434
              + +RA+  RL    SRQK+
Sbjct: 1151 AEEKVRAVRERLRIAQSRQKS 1171


>UniRef50_A5CA05 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1066

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 32/95 (33%), Positives = 54/95 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYH QT G +E ++  +K  L   + 
Sbjct: 824  GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHHQTSGQVELANREIKNILMKVVN 883

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             N+  W + L  ++ AY +   +  G SP  L++G
Sbjct: 884  TNRKYWSIKLLDSLWAYRTTYKTILGMSPYRLVYG 918


>UniRef50_A5BXG2 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1268

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 31/93 (33%), Positives = 54/93 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   ++
Sbjct: 1165 GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVI 1224

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
             ++  W + L  ++ AY +   +  G SP  L+
Sbjct: 1225 TSRKYWSIKLHDSLWAYRTTYKTILGMSPDRLV 1257


>UniRef50_A5BSG6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1013

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 31/105 (29%), Positives = 58/105 (55%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK+II+D G +F ++  + L   +G+KH  A+PYH QT   +E ++  +K  L   + 
Sbjct: 651 GVPKVIISDGGTHFCNKPFETLVAKYGVKHKVATPYHSQTSRQVELANREIKNILMKVVN 710

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            +   W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 711 TSIRDWSVKLHDSLWAYKTTYKTILGMSPYRLVYGNACHLPMEVE 755


>UniRef50_A5BQR4 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1427

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 32/95 (33%), Positives = 55/95 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G ++ ++  +K  L   + 
Sbjct: 1185 GVPKAIISDGGTHFCNKPSETLLAKYGVKHKVATPYHPQTSGQVKLANREIKNILMKEVN 1244

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             N+  W + L  ++ AY +   +  G SP  L++G
Sbjct: 1245 TNRKDWSVKLLDSLWAYRTVYKTILGMSPYHLVYG 1279


>UniRef50_A5AIU0 Cluster: Putative uncharacterized protein; n=4; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1753

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 30/95 (31%), Positives = 54/95 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D+G +F ++  + L   +G+KH  A+PYHP T G +E ++  +K  L   + 
Sbjct: 1259 GVPKAIISDEGTHFCNKPFETLLAKYGVKHKVATPYHPXTSGQVELANREIKNILMKVVN 1318

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             ++  W +    ++ AY +   +  G SP  L++G
Sbjct: 1319 TSKRDWSVKFHDSLXAYRTAYKTILGMSPYRLVYG 1353


>UniRef50_A2Q2J0 Cluster: RNA-directed DNA polymerase (Reverse
            transcriptase); Ribonuclease H; n=39; core
            eudicotyledons|Rep: RNA-directed DNA polymerase (Reverse
            transcriptase); Ribonuclease H - Medicago truncatula
            (Barrel medic)
          Length = 1146

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 34/105 (32%), Positives = 59/105 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  IITD G N ++ V++ L   F I+H  +SPY PQ  GA+E ++  +K  ++  +V
Sbjct: 920  GVPSKIITDNGTNLNNNVVQALCEEFKIEHHNSSPYRPQMNGAVEAANKNIKRIVQK-MV 978

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
                 W   L  A+  Y + + S+TG +P  L++G +  +P  ++
Sbjct: 979  TTYKDWHEMLPYALHGYRTTVRSSTGATPFSLVYGMEAVLPSEVE 1023


>UniRef50_A1BPH1 Cluster: Pol polyprotein; n=4; cellular
            organisms|Rep: Pol polyprotein - Drosophila buzzatii
            (Fruit fly)
          Length = 1143

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 35/95 (36%), Positives = 52/95 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G  F S+         GIKH++ + Y PQ+  A ER + +L   +RSY+ 
Sbjct: 925  GVPKTIISDNGTQFKSKEFNAWLTALGIKHVYTALYSPQS-NAAERVNRSLLAAIRSYLQ 983

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             +Q  WD++L +   A  S +H +   SP   LFG
Sbjct: 984  NDQTDWDVHLTSISCALRSGLHQSLNCSPYRALFG 1018


>UniRef50_Q6RYC6 Cluster: Gag-pol polyprotein; n=5; Dikarya|Rep:
            Gag-pol polyprotein - Aspergillus flavus
          Length = 1998

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 36/96 (37%), Positives = 53/96 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I +D+   F+S+  + L  L GI     + YHPQ  G  ER++ T+++YLR Y+ 
Sbjct: 1696 GMPEKITSDRDKLFTSKFWQSLTDLMGIDQKLTTAYHPQGNGQTERTNQTIEQYLRHYVN 1755

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGF 536
              Q  W   L TA  AYN+  HST G +P     G+
Sbjct: 1756 YQQDDWANLLPTAQFAYNNAEHSTIGTTPFYANHGY 1791


>UniRef50_Q8S656 Cluster: Putative Sorghum bicolor 22 kDa kafirin
            cluster; n=2; Oryza sativa|Rep: Putative Sorghum bicolor
            22 kDa kafirin cluster - Oryza sativa (Rice)
          Length = 1143

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 44/141 (31%), Positives = 74/141 (52%), Gaps = 11/141 (7%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S+  ++L+   G +  F++ YHPQT G  ER +  L++ LR+   
Sbjct: 841  GVPKKIVSDRGSQFTSKFWQKLQEELGTRLNFSTAYHPQTDGQTERVNQILEDMLRACAF 900

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLD---------LNT 491
            +    WD  L  A  +YN++  ++   +P E L+G +   P   D            LN 
Sbjct: 901  DFGGAWDKSLSYAEFSYNNSYQASLQMAPFEALYGRRCRTPLFWDQTGERQLFGTEVLNE 960

Query: 490  YSDYIRALNHRL--YYSRQKA 434
              + +RA+  RL    SRQK+
Sbjct: 961  AEEKVRAVRERLRIAQSRQKS 981


>UniRef50_Q2R3R3 Cluster: Retrotransposon protein, putative,
            unclassified; n=2; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 1091

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 36/98 (36%), Positives = 56/98 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ II+D+   F+S +   L  L G +   +S YHPQT G  ER +  L+ +LR ++ 
Sbjct: 745  GLPQSIISDRDRIFTSTLWTTLFCLAGTQLQMSSSYHPQTDGQTERVNQCLETFLRCFVH 804

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
                 W  +L  A   YN++ HS+ G +P E+L+G KP
Sbjct: 805  ACPSHWTKWLALAEYWYNTSFHSSLGMTPFEVLYGHKP 842


>UniRef50_Q25AL5 Cluster: H0102C09.1 protein; n=5; Oryza sativa|Rep:
            H0102C09.1 protein - Oryza sativa (Rice)
          Length = 1825

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 37/101 (36%), Positives = 58/101 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIPK II+D+G  F+S   ++L    G    F++ +HPQT G  ER +  L++ LR+Y +
Sbjct: 1532 GIPKRIISDRGTQFTSHFWQKLHYELGSYLDFSTAFHPQTGGQTERLNQRLEDMLRAYAL 1591

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   +WD  L  A  +YN++  ++   SP E L+G K   P
Sbjct: 1592 DFAASWDKCLPYAEFSYNNSYQASLKMSPHEALYGRKCQTP 1632


>UniRef50_Q10PF2 Cluster: Retrotransposon protein, putative,
           unclassified; n=3; Poaceae|Rep: Retrotransposon protein,
           putative, unclassified - Oryza sativa subsp. japonica
           (Rice)
          Length = 937

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 40/126 (31%), Positives = 62/126 (49%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP+ I++D+   F+S+    L   +  +   ++ YHPQT G +ER +  L+ YLR    
Sbjct: 624 GIPRSIVSDRDRLFTSKFWTTLFATWDTQLQMSTAYHPQTDGQIERVNQCLEMYLRCMTQ 683

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIRALN 464
            N   W  ++  A   YN+N H+  G SP + LFG  P+    +  L L T  D +    
Sbjct: 684 ANPKKWSHWIHLAEFWYNTNYHTYLGCSPHKALFGVDPHY-SQVPDLTLATLPDVVDVQT 742

Query: 463 HRLYYS 446
            R + S
Sbjct: 743 ERQHLS 748


>UniRef50_Q01LW3 Cluster: OSIGBa0139I12.1 protein; n=2; Oryza
            sativa|Rep: OSIGBa0139I12.1 protein - Oryza sativa (Rice)
          Length = 1585

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 34/101 (33%), Positives = 62/101 (61%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S+  ++L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1283 GVPKKIVSDRGSQFTSKFWQKLQVEMGNRLNFSTAYHPQTDGQTERVNQILEDMLRACVL 1342

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1343 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 1383


>UniRef50_A5BIQ2 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1420

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 32/105 (30%), Positives = 58/105 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D   +F ++  + L   +G+KH  A+PYH QT G +E ++  +K      + 
Sbjct: 1106 GVPKAIISDGSTHFYNKPFQTLLAKYGVKHKVATPYHXQTSGQVELANREIKNISMKVVN 1165

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W + L  ++ AY +   +  G SP  L++G   ++P ++D
Sbjct: 1166 TNRKDWSIKLLDSLWAYRTTYKTILGMSPYHLVYGKACHLPLNMD 1210


>UniRef50_Q8L7J3 Cluster: Gag-pol polyprotein; n=30;
            Magnoliophyta|Rep: Gag-pol polyprotein - Zea mays (Maize)
          Length = 1618

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/101 (34%), Positives = 54/101 (53%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I++D+ A F S   + L    G K +F++  HPQT G  E  + TL   LR+ + 
Sbjct: 1326 GVPNTIVSDRDAKFLSHFWRTLWAKLGTKLLFSTTCHPQTDGQTEVVNRTLSTMLRAVLK 1385

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +N   W+  L     AYN ++HSTT   P ++++G  P  P
Sbjct: 1386 KNIKMWEDCLPHIEFAYNRSLHSTTKMCPFQIVYGLLPRAP 1426


>UniRef50_Q5JPZ2 Cluster: OSJNBa0004L19.22 protein; n=8; Oryza
            sativa|Rep: OSJNBa0004L19.22 protein - Oryza sativa
            (Rice)
          Length = 1586

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 32/98 (32%), Positives = 56/98 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  IITD+   F+S++ +++ +   ++  F++ YHPQT G  ER +  L+ YLRS   
Sbjct: 1296 GMPMAIITDRDRIFTSQLFQEIFKSMKVRLKFSTSYHPQTDGQTERVNQCLESYLRSMTF 1355

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            +    W  +L  A   YN+  H++   +P + L+G+ P
Sbjct: 1356 QEPTRWHSWLALAEWWYNTTYHTSIQMTPFQALYGYPP 1393


>UniRef50_A5BST7 Cluster: Putative uncharacterized protein; n=7; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1744

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 32/105 (30%), Positives = 58/105 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1241 GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQVELANREIKNILMKVVN 1300

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             N+  W +    ++ AY +   +    SP  L++G   ++P  ++
Sbjct: 1301 VNRKDWSIKFLDSLWAYRTAYKTMLRMSPYCLVYGKACHLPVEVE 1345


>UniRef50_A5BJ88 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1367

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 31/104 (29%), Positives = 60/104 (57%)
 Frame = -1

Query: 820  IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
            +PK II+  G  F +++ + L   +G+KH  A+PYHPQT G +E ++  +K  L + +  
Sbjct: 1001 VPKAIISYGGTYFCNKLFETLLAKYGVKHKVATPYHPQTFGQVELANREIKNILINVVNT 1060

Query: 640  NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            ++  W + L  ++ AY +  ++  G SP  L++G   ++P  ++
Sbjct: 1061 SRRDWSITLHDSLWAYRTAYNTILGMSPYRLVYGKTCHLPVEVE 1104


>UniRef50_A5B5Q5 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1896

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/105 (33%), Positives = 63/105 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+D+G +F +EV   ++R + I+H  +S Y PQT GA++ ++  +K  LR  +V
Sbjct: 1711 GVPHELISDRGVHFRAEVDTLVQR-YSIRHHRSSAYRPQTNGAIKATNKNIKRILRR-MV 1768

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            E    W   L  A+ AY ++  ++TG +P  L++G +  +P  I+
Sbjct: 1769 ETSRDWSEKLPFALWAYRTSFRTSTGATPYSLVYGMEAMLPVEIE 1813


>UniRef50_A5B3D7 Cluster: Putative uncharacterized protein; n=12;
            Vitis vinifera|Rep: Putative uncharacterized protein -
            Vitis vinifera (Grape)
          Length = 2022

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/101 (34%), Positives = 61/101 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+D+G +F +EV   L++ + I+H  +S Y PQT GA+E ++  +K  LR  +V
Sbjct: 1797 GVPHELISDRGVHFRAEVDTLLQK-YAIRHHRSSAYRPQTNGAVEAANKNIKRILRK-MV 1854

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            E    W   L  A+ AY ++  ++TG +P  L++G +  +P
Sbjct: 1855 ETSRDWSEKLPFALWAYRTSFRTSTGATPYSLVYGMEAVLP 1895


>UniRef50_A5AVK2 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1929

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/105 (33%), Positives = 63/105 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +++D+G +F +EV   ++R + I+H  +S Y PQT GA+E ++  +K  LR  +V
Sbjct: 1713 GVPHELMSDRGVHFRAEVDTLVQR-YSIRHHRSSAYRPQTNGAVEAANKNIKRILRR-MV 1770

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
            E    W   L  A+ AY ++  ++TG +P  L++G +  +P  I+
Sbjct: 1771 ETSRDWSEKLPFALWAYRTSFRTSTGATPYSLVYGMEAVLPVEIE 1815


>UniRef50_Q6CHG3 Cluster: Ylt1 protein; n=6; Yarrowia lipolytica|Rep:
            Ylt1 protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 2621

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 39/101 (38%), Positives = 53/101 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ + TD G+ F  +  K L   F IK +F +P H Q+ G +ER H  L   LR Y  
Sbjct: 2315 GVPRRVYTDGGSEFKGD-FKHLCEDFHIKQVFTTPAHGQSTGIVERGHQNLLHCLRKY-- 2371

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
                 W LYL TA+ A      S+TG SP EL++G    +P
Sbjct: 2372 --GRQWILYLHTALWADRCTRRSSTGKSPFELMYGVSGVLP 2410


>UniRef50_Q68YT0 Cluster: Putative reverse
           transcriptase-RNaseH-integrase; n=1; Moniliophthora
           perniciosa|Rep: Putative reverse
           transcriptase-RNaseH-integrase - Crinipellis perniciosa
           (Witches'-broom disease fungus) (Marasmiusperniciosus)
          Length = 495

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 36/100 (36%), Positives = 54/100 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  I +D+G+ F S   + L +   +K  F S YHP+  G  ER++ TL++YLR Y  
Sbjct: 187 GVPNHITSDRGSEFVSSFSRSLGQALNMKLHFTSGYHPEADGQTERANQTLEQYLRMYCS 246

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYI 524
             Q  W+  L  A  AYN+  +++TG  P     G+ P I
Sbjct: 247 YQQDNWNELLPLAEFAYNNAPNASTGVLPFFANKGYHPNI 286


>UniRef50_Q1KTA8 Cluster: Pol polyprotein; n=1; Nosema bombycis|Rep:
            Pol polyprotein - Nosema bombycis
          Length = 1225

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 36/98 (36%), Positives = 53/98 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P  +++D+G  F ++ + +L  LF I   F S YHPQ  GA+ER++ +L   L   + 
Sbjct: 991  GPPNELLSDRGLEFLNKTVAELCNLFKIYKSFTSAYHPQCNGAVERTNQSLVAKLAKLVN 1050

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
                 WD YL   + AY  +    + FSP ELL+G KP
Sbjct: 1051 GKWKDWDEYLELTLYAYRISPRKISKFSPFELLYGRKP 1088


>UniRef50_Q2VF30 Cluster: Polyprotein; n=1; Atlantic salmon swim
            bladder sarcoma virus|Rep: Polyprotein - Atlantic salmon
            swim bladder sarcoma virus
          Length = 2146

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 43/125 (34%), Positives = 71/125 (56%), Gaps = 6/125 (4%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I +D G++FS++ ++Q+E  FGI H F S Y PQ+ G +ER + TLK  +     
Sbjct: 1913 GVPRQIRSDNGSHFSNQHLRQVEERFGIVHKFGSVYKPQSQGLVERCNQTLKAKIAKVCA 1972

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG-FKPYIPKS---IDSLDLNT--YSD 482
              + TW   L  A++A  S+  + T  SP E++ G   P  P+    + +LD++    +D
Sbjct: 1973 GTKLTWVEALPLALMAMRSSPGAGTHLSPHEIMTGRVMPGPPREGGHMPALDVHQIGMTD 2032

Query: 481  YIRAL 467
            Y+R L
Sbjct: 2033 YVRKL 2037


>UniRef50_Q9LP90 Cluster: T32E20.30; n=1; Arabidopsis thaliana|Rep:
            T32E20.30 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 1397

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 36/98 (36%), Positives = 54/98 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P  I++D+   F S   K   +L G K  +++ +HPQT G  E  + TL+ YLR +  
Sbjct: 1092 GFPASIVSDRDNTFLSSFWKDCFKLSGTKLKYSTAFHPQTDGQTEVLNRTLETYLRCFAS 1151

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
             +  TW  YL  A L YNS+ H+T   +P ++L+G  P
Sbjct: 1152 AHPKTWFQYLPRAELWYNSSFHTTIKTTPFKVLYGRDP 1189


>UniRef50_Q7XR40 Cluster: OSJNBa0014F04.7 protein; n=8; Oryza
            sativa|Rep: OSJNBa0014F04.7 protein - Oryza sativa (Rice)
          Length = 1625

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 35/101 (34%), Positives = 59/101 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+ K I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 1367 GVAKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 1426

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1427 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 1467


>UniRef50_Q01MU8 Cluster: OSIGBa0102O13.8 protein; n=1; Oryza
           sativa|Rep: OSIGBa0102O13.8 protein - Oryza sativa
           (Rice)
          Length = 797

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 33/105 (31%), Positives = 57/105 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP+++I+D G++F  +  + L R  G KH  A+PYHPQT G  E S+  +K  L+  + 
Sbjct: 674 GIPRMVISDGGSHFIDKTFRDLLREMGAKHNVATPYHPQTSGQAETSNKQIKNILQKIVN 733

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           +    W   L   + AY +   +  G SP ++++G    +P  ++
Sbjct: 734 KMGTGWKDRLPDTLWAYRTAYKTPIGMSPYQIVYGKSCRLPVELE 778


>UniRef50_A5APS1 Cluster: Putative uncharacterized protein; n=2;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 880

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 36/105 (34%), Positives = 61/105 (58%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  +I+D+G +F  EV   ++  +GI+H  +S Y PQT GA+E  +  +K  LR  +V
Sbjct: 353 GVPYELISDRGMHFRGEVDTLIQE-YGIQHHKSSVYRPQTNGAVEAVNKNIKRILRK-MV 410

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           E    W   L  A+ AY ++  ++TG +P  L++G +  +P  I+
Sbjct: 411 ETSRDWSKKLPFALWAYRTSFRTSTGATPYSLVYGMEAVLPVEIE 455


>UniRef50_Q1EBQ6 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 615

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 38/111 (34%), Positives = 62/111 (55%)
 Frame = -1

Query: 820 IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
           +P  I+TDQ + F+SE    L  +  I    ++ +H QT G  ER +S L++YL+SYI  
Sbjct: 188 LPASIVTDQESLFTSEFWGDLTHILKIARAMSTAFHLQTDGQTERLNSVLEQYLQSYISY 247

Query: 640 NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTY 488
           +Q  W ++L  A   YN++  ++T  SP +L++G    +   +D LD   Y
Sbjct: 248 DQDDWVMWLPMAEFTYNNSQQASTQKSPFQLIYG----LNLQVDLLDPEEY 294


>UniRef50_O93209 Cluster: Pro-Pol polyprotein (Pr125Pol) [Contains:
            Protease/Reverse transcriptase/ribonuclease H (EC
            3.4.23.-) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4)
            (p87Pro-RT-RNaseH); Protease/Reverse transcriptase (EC
            3.4.23.-) (EC 2.7.7.49) (EC 2.7.7.7) (p65Pro-RT);
            Ribonuclease H (EC 3.1.26.4) (RNase H); Integrase (IN)
            (p42In)]; n=206; Spumavirus|Rep: Pro-Pol polyprotein
            (Pr125Pol) [Contains: Protease/Reverse
            transcriptase/ribonuclease H (EC 3.4.23.-) (EC 2.7.7.49)
            (EC 2.7.7.7) (EC 3.1.26.4) (p87Pro-RT-RNaseH);
            Protease/Reverse transcriptase (EC 3.4.23.-) (EC
            2.7.7.49) (EC 2.7.7.7) (p65Pro-RT); Ribonuclease H (EC
            3.1.26.4) (RNase H); Integrase (IN) (p42In)] - Feline
            foamy virus (FFV) (Feline syncytial virus)
          Length = 1156

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 37/110 (33%), Positives = 64/110 (58%), Gaps = 1/110 (0%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            + IPK++ +DQG+ F+SE   Q  +   I+  F++PYHPQ+ G +ER +S +K+ L   +
Sbjct: 928  LAIPKVLHSDQGSAFTSEEFAQWAKERNIQLEFSTPYHPQSSGKVERKNSEIKKLLTKLL 987

Query: 646  VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP-KSIDSLD 500
            V     W   + +  LA N+    +T ++P +L+FG    +P  + D+LD
Sbjct: 988  VGRPLKWYNLISSVQLALNNTHVVSTKYTPHQLMFGIDCNLPFANKDTLD 1037


>UniRef50_Q53L81 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=1; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            Ty3-gypsy sub-class - Oryza sativa subsp. japonica (Rice)
          Length = 1158

 Score = 70.9 bits (166), Expect = 4e-11
 Identities = 33/95 (34%), Positives = 55/95 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D+G  F+S   +++    G    F++ YHPQT G  ER++  L++ LR+  +
Sbjct: 865  GVPKRIISDRGTQFTSHFWEKVHEALGSYLAFSTAYHPQTDGQTERTNQVLEDMLRACAL 924

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            +    W+  L  A  +YN++  ++   SP E LFG
Sbjct: 925  DFSKDWERCLPYAEFSYNNSFQASLKMSPNEALFG 959


>UniRef50_Q0KIP3 Cluster: Polyprotein, 3'-partial, putative; n=4; core
            eudicotyledons|Rep: Polyprotein, 3'-partial, putative -
            Solanum demissum (Wild potato)
          Length = 1475

 Score = 70.9 bits (166), Expect = 4e-11
 Identities = 32/95 (33%), Positives = 56/95 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  II+D+G+ F+S   +  +   G +   ++ +HPQT G  ER+   L++ LR+ ++
Sbjct: 1319 GVPVSIISDRGSQFTSNFWRTFQDELGTRVDLSTAFHPQTDGQSERTIQVLEDMLRACVM 1378

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            +    WD +L  A  AYN++ HS+   +P E L+G
Sbjct: 1379 DFGGQWDQFLPLAEFAYNNSYHSSIQMAPFEALYG 1413


>UniRef50_A5CA67 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 493

 Score = 70.9 bits (166), Expect = 4e-11
 Identities = 32/101 (31%), Positives = 56/101 (55%)
 Frame = -1

Query: 820 IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
           +P+ II+D G +F ++  K L   +G+KH  A+PYHPQT   +E ++  +K  L   +  
Sbjct: 365 VPRAIISDGGTHFCNKSFKTLLAKYGVKHKVATPYHPQTSSQVELANREIKNILMKVVNA 424

Query: 640 NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPK 518
           N+  W + L  ++ AY +   +  G SP  L++G   + P+
Sbjct: 425 NKKDWYVKLLDSLWAYRTTYKTILGMSPYLLVYGKACHFPR 465


>UniRef50_UPI0000F1E5A7 Cluster: PREDICTED: similar to pol
            polyprotein; n=1; Danio rerio|Rep: PREDICTED: similar to
            pol polyprotein - Danio rerio
          Length = 1047

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 6/125 (4%)
 Frame = -1

Query: 823  GIPKIIITDQGA-NFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            G P  +  DQG  NF S ++K+L +  GI     +PYHPQ  G  ER + TL   L +  
Sbjct: 682  GFPARLHADQGRRNFESAIVKELCKCTGITKTHTTPYHPQGNGTTERFNRTLMNMLGTPE 741

Query: 646  VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI--DSLDLN---TYSD 482
               +  W  ++     AYN + H +TG+SP  L+FG  P +P  +   S   N    YS+
Sbjct: 742  PHLKSRWHEHIDAMTHAYNCSQHDSTGYSPYYLMFGRHPRLPVDLIFGSPTTNQPCEYSE 801

Query: 481  YIRAL 467
            Y++ L
Sbjct: 802  YVQTL 806


>UniRef50_Q7XL81 Cluster: OSJNBb0014D23.8 protein; n=4; Oryza
           sativa|Rep: OSJNBb0014D23.8 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 1545

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 35/98 (35%), Positives = 55/98 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ II+D+   F+S+  +QL    G +    + YHPQT G  ER +  L+ YLR ++ 
Sbjct: 694 GLPRFIISDRDRIFTSQFWEQLFPRSGTQLQLTTAYHPQTDGQTERVNQCLEIYLRCFVH 753

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
                W  +L  A   +N++ HST   SP E+L+G+ P
Sbjct: 754 AMPSKWSSWLYLAEFWFNTSYHSTLFKSPFEVLYGYPP 791


>UniRef50_Q53NJ3 Cluster: Retrotransposon protein, putative,
            unclassified; n=2; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 1513

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 31/98 (31%), Positives = 56/98 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  II D+   F+S++ +++ +   ++  F++ YHPQT G  ER +  L+ YLR+   
Sbjct: 1255 GMPMAIIIDRDRIFTSQLFQEIFKSMKVQLRFSTSYHPQTDGQTERVNQCLESYLRNMTF 1314

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            +  H W  +L  A   YN+  H++   +P + L+G+ P
Sbjct: 1315 QEPHQWYSWLSLAGWWYNTTYHTSLQMTPFQALYGYPP 1352


>UniRef50_Q2R3E6 Cluster: Retrotransposon protein, putative,
           Ty3-gypsy subclass; n=6; Magnoliophyta|Rep:
           Retrotransposon protein, putative, Ty3-gypsy subclass -
           Oryza sativa subsp. japonica (Rice)
          Length = 610

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 33/105 (31%), Positives = 57/105 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++I+D G++F  +  + L R  G KH  A+PYHPQT G  E S+  +K  L+  + 
Sbjct: 368 GTPRMVISDGGSHFIDKTFRDLLREMGAKHNMATPYHPQTSGQAETSNKQIKNILQKTVN 427

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           +    W   L  A+ AY +   +  G SP ++++G    +P  ++
Sbjct: 428 KMGTGWKDRLPYALWAYRTAYKTPIGMSPYQIVYGKSCRLPVELE 472


>UniRef50_A5C046 Cluster: Putative uncharacterized protein; n=3; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1565

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 31/95 (32%), Positives = 54/95 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1224 GVPKAIISDGGTHFCNKPFETLLTKYGVKHKVATPYHPQTSGQVELANREIKNILTKVVN 1283

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             ++  W + L  ++ AY +   +  G S   L++G
Sbjct: 1284 TSRRDWSVKLHDSLWAYRTAYKTILGMSLYSLVYG 1318


>UniRef50_A5BSX6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 790

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 34/98 (34%), Positives = 55/98 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  I++D+   F S     L +L G K   +S YHPQ+ G  E  + TL++YLR ++ 
Sbjct: 515 GIPTSIVSDRDKVFISSFWLALFQLQGTKLCMSSSYHPQSNGQTEVVNRTLEQYLRCFVG 574

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +    W  ++  A  +YN++ HS+T  +P E ++G  P
Sbjct: 575 DQPQKWLKWIPWAEFSYNTSTHSSTKMTPFEAVYGIPP 612


>UniRef50_A5B9Y2 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 587

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 35/95 (36%), Positives = 54/95 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I +DQ + F S   + L + FG K  +++ YHPQ  G  E  + +L + LR  + 
Sbjct: 485 GVPKSITSDQDSKFLSPFWRTLWKKFGTKLQYSTSYHPQMDGQTEVVNRSLGDLLRCLVG 544

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           EN   W+  +  A  AYN + + TTG SP E+++G
Sbjct: 545 ENPKQWEAVVAQAEFAYNYSKNLTTGKSPFEVVYG 579


>UniRef50_Q6H8S0 Cluster: Polyprotein; n=2; Yarrowia lipolytica|Rep:
            Polyprotein - Yarrowia lipolytica (Candida lipolytica)
          Length = 1240

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 37/131 (28%), Positives = 76/131 (58%), Gaps = 7/131 (5%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I++D+   F++++ + L+   G +  F++  HPQT G  ER ++ L   ++ + V
Sbjct: 938  GVPRSIVSDRDKLFTAKLWQTLQTRLGTELKFSTVNHPQTDGQSERVNTELIRQMKQHFV 997

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDL-------NTYS 485
             +++ WDL+L     A NS  HS+TG++P E ++G+ P  P    + +L       + + 
Sbjct: 998  TDKN-WDLWLPVIEFAMNSAKHSSTGYAPFEAVYGYIPDGPTYASTRELTKVHHQMDAWM 1056

Query: 484  DYIRALNHRLY 452
            D +RA+++ ++
Sbjct: 1057 DKLRAISNSMH 1067


>UniRef50_A4QZT8 Cluster: Putative uncharacterized protein; n=1;
            Magnaporthe grisea|Rep: Putative uncharacterized protein
            - Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 1348

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 32/104 (30%), Positives = 58/104 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P + ++D    F SE +  L  L G KH   S  HPQ+ G++E +++ L + +R Y+ 
Sbjct: 1004 GVPDLWLSDNAGPFISEFLNTLNELTGTKHKHGSARHPQSQGSVEITNAELDQKMRFYVD 1063

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
            + Q  W  ++      +NS++H++ G +P+E   G +P  P S+
Sbjct: 1064 KYQTNWRRHIPAFDFGHNSSVHASIGMAPIEAETGARPRDPLSL 1107


>UniRef50_A4QQG5 Cluster: Putative uncharacterized protein; n=16;
            Magnaporthe grisea|Rep: Putative uncharacterized protein
            - Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 1729

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 32/104 (30%), Positives = 58/104 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P + ++D    F SE +  L  L G KH   S  HPQ+ G++E +++ L + +R Y+ 
Sbjct: 1385 GVPDLWLSDNAGPFISEFLNTLNELTGTKHKHGSARHPQSQGSVEITNAELDQKMRFYVD 1444

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
            + Q  W  ++      +NS++H++ G +P+E   G +P  P S+
Sbjct: 1445 KYQTNWRRHIPAFDFGHNSSVHASIGMAPIEAETGARPRDPLSL 1488


>UniRef50_UPI0000F1F6B2 Cluster: PREDICTED: similar to pol
            polyprotein; n=12; Danio rerio|Rep: PREDICTED: similar to
            pol polyprotein - Danio rerio
          Length = 1635

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 34/106 (32%), Positives = 58/106 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +++D+G  F S+  ++  RL G     +S +HPQ+ G  ER++  L+  LR  + 
Sbjct: 1131 GLPTDVVSDRGPQFISKFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLRCLVS 1190

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDS 506
            +N  +W   L     A+NS   S TG SP +   G++P +  S++S
Sbjct: 1191 QNPSSWSQQLSWVEYAHNSLPVSATGLSPFQCSLGYQPPVFPSLES 1236


>UniRef50_Q77K58 Cluster: Lef5; n=4; Nucleopolyhedrovirus|Rep: Lef5
           - Helicoverpa armigera NPV
          Length = 315

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 27/47 (57%), Positives = 40/47 (85%)
 Frame = +3

Query: 30  LQNSNKNKLFELSGLSLKSCRHDFVTVESQTRAGDEIASFLRYCRMC 170
           + +S K KL+ ++G+SL++C+H FVTVE QTRAGDEI SF++YC++C
Sbjct: 260 INSSLKYKLYSINGMSLRACQHSFVTVEKQTRAGDEIVSFIKYCQIC 306


>UniRef50_Q65353 Cluster: ORF B; n=7; root|Rep: ORF B - Autographa
            californica nuclear polyhedrosis virus (AcMNPV)
          Length = 1084

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 47/126 (37%), Positives = 68/126 (53%), Gaps = 4/126 (3%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I+TD G  FS+++  +  R+  I H    P+ P   G +ER HST+ E++R  I+
Sbjct: 852  GLPITIVTDNGTEFSNQLFSEFVRIHKIIHHKTLPHSPSDNGNIERFHSTILEHIR--IL 909

Query: 643  ENQHTWDLYLRT---AMLAYNSNIHSTTGFSPLELLFG-FKPYIPKSIDSLDLNTYSDYI 476
            + QH  +  +     A++ YNS+IHS T   P +LL G F P  P  ID L  +    Y 
Sbjct: 910  KLQHKDEPIVNLMPYAIIGYNSSIHSFTKCRPFDLLNGHFDPRDPLDID-LTEHILQQY- 967

Query: 475  RALNHR 458
             A NHR
Sbjct: 968  -AQNHR 972


>UniRef50_A5C623 Cluster: Putative uncharacterized protein; n=5; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1694

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 32/95 (33%), Positives = 54/95 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 1063 GEPKAIISDGGTHFCNKPFEILLVKYGVKHKVATPYHPQTFGQVELANRDIKNILMKVVN 1122

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             ++  W + L  ++ AY +   +  G SP  L++G
Sbjct: 1123 TSRKDWSVRLHDSLWAYRTXYKTILGMSPYRLVYG 1157


>UniRef50_A5BWT5 Cluster: Putative uncharacterized protein; n=2;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 895

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 40/111 (36%), Positives = 58/111 (52%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ I+  +  NF S   K L    G +  F+S +HPQT G  E  + +L   LR  + 
Sbjct: 570 GLPQSIVFYRDVNFMSYFWKTLWAKLGAQLKFSSSFHPQTDGQTEVVNRSLGNLLRCIVR 629

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNT 491
           +    WD  L  A  A+NS+ + T G SP E+ +G KP  P  ID + L+T
Sbjct: 630 DQLRNWDNVLPQAEFAFNSSTNRTIGHSPFEVAYGLKPKQP--IDLIPLST 678


>UniRef50_A5BSN7 Cluster: Putative uncharacterized protein; n=20;
            Vitis vinifera|Rep: Putative uncharacterized protein -
            Vitis vinifera (Grape)
          Length = 2019

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 31/105 (29%), Positives = 58/105 (55%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+  GA+F ++  + L   + +KH  A+PYHPQT   +E ++  +K  L   + 
Sbjct: 1487 GVPKAIISGGGAHFCNKPFEALLSKYRVKHKVATPYHPQTSRQVELANREIKNILMKVVN 1546

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             ++  W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 1547 SSRKDWSIKLHDSLWAYRTAYKTILGMSPYRLVYGKACHLPVEVE 1591


>UniRef50_Q8T4B4 Cluster: AT07338p; n=1; Drosophila
           melanogaster|Rep: AT07338p - Drosophila melanogaster
           (Fruit fly)
          Length = 451

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 31/104 (29%), Positives = 56/104 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK++ITD     +    ++     G++H   +PY PQ     ER++ T+K  +  +  
Sbjct: 220 GVPKVMITDNNVQLTIRAFRKFLEELGVRHQLTAPYTPQE-NPTERANRTVKTMIAQFTG 278

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
            +Q TWD +     LA N+++  TTG+SP  +  G +P +P ++
Sbjct: 279 ADQRTWDEHWPELQLAVNTSVAETTGYSPAFITQGREPRLPNAL 322


>UniRef50_Q2QSI5 Cluster: Retrotransposon protein, putative,
            unclassified; n=2; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 1873

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 34/95 (35%), Positives = 54/95 (56%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ + TDQ A+F S+ +K     +GIK + +SPY+ Q  G  E S+ TL + ++  I 
Sbjct: 1699 GIPQTLTTDQDASFMSKEVKSFTESYGIKLLSSSPYYAQANGQAESSNKTLLKLVKKKIE 1758

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            E+   W   L  A+ A+  + H  T  +P EL++G
Sbjct: 1759 EHPKRWHEVLSEALWAHRISKHGATKVTPFELVYG 1793


>UniRef50_Q0ITS1 Cluster: Os11g0224300 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os11g0224300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 383

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 36/98 (36%), Positives = 54/98 (55%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P++II+D+   F+S + ++L +L  +K   +S YHPQT G  ER +  L+ YLR  + 
Sbjct: 105 GMPQVIISDRDKIFTSALWQELFKLADVKLNMSSSYHPQTDGQTERLNQCLEAYLRCAVH 164

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
                W  +L      YN+  HS    SP E+LF  KP
Sbjct: 165 SCPKHWSKWLSQVQHWYNTAYHSALDKSPYEVLFARKP 202


>UniRef50_A5BQ80 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 305

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 32/95 (33%), Positives = 53/95 (55%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK II+D G +F ++  + L   +G+KH  A+PYHPQT G +E ++  +K  L   + 
Sbjct: 70  GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATPYHPQTSGQIELANREIKNILMKVVN 129

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            N+  W + L   + AY +   +  G S   L++G
Sbjct: 130 VNRKYWSIKLLDLLWAYRTAYKTILGISLNHLVYG 164


>UniRef50_A5BCV2 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1249

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 30/105 (28%), Positives = 56/105 (53%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  II+D G +F ++  + L   +G+KH  A+ YHPQ  G +E ++  +K  L   + 
Sbjct: 1007 GVPLAIISDGGTHFCNKPFETLLAKYGVKHKVATHYHPQNSGKIELANKEIKNILMKXVN 1066

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             +   W + L  ++ AY +   +  G SP  L++G   ++P  ++
Sbjct: 1067 TSIRDWSIKLHDSLWAYRTTYKTILGMSPYRLIYGKACHLPVEVE 1111


>UniRef50_A5B385 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1795

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 35/101 (34%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+D+GA+F +EV   L+  +GI+H  +S Y PQT  A+E ++  +K  LR  +V
Sbjct: 1684 GVPHELISDRGAHFRAEVDNLLQE-YGIRHHRSSAYRPQTNRAVEAANKNIKRILRK-MV 1741

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            E    W   L  A+ AY ++  ++ G +P  L++G +  +P
Sbjct: 1742 ETSRDWSEKLPFALWAYRTSFRTSIGATPYSLVYGMEAVLP 1782


>UniRef50_A5B326 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1378

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 40/138 (28%), Positives = 72/138 (52%), Gaps = 9/138 (6%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I  D+   F++   ++  +L G+    ++ YHPQT G  E  +  ++ YLR    
Sbjct: 1118 GLPHSITCDRDPIFTNVFWQEFFKLQGVSLQLSTAYHPQTDGQTEVVNRCIETYLRCMAG 1177

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK-----PYIPK--SIDSLD--LNT 491
            +N   W  ++  A   YN++ HS+   SP E L+G+      PY PK  +++++D  LN 
Sbjct: 1178 DNPGQWANWISLAEFWYNTSYHSSLKMSPFEALYGYAPPLQIPYFPKDSNVEAVDRVLNE 1237

Query: 490  YSDYIRALNHRLYYSRQK 437
               +++ L H L  ++Q+
Sbjct: 1238 RESWLQLLKHHLSKAQQR 1255


>UniRef50_A5AQQ3 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1599

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 31/105 (29%), Positives = 57/105 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK II+D G +F ++  + L   +G+KH  A+ YHPQT G +E ++  +K  L   + 
Sbjct: 1238 GVPKAIISDGGTHFCNKPFETLLAKYGVKHKVATHYHPQTSGQVELANREIKSILMKVVN 1297

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
             +   W + L  ++ AY +   +    SP  L++G   ++P  ++
Sbjct: 1298 TSIRDWSVKLHDSLWAYRTAYKTMLAMSPYRLVYGKTCHLPVEVE 1342


>UniRef50_A5APH5 Cluster: Putative uncharacterized protein; n=3; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1323

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 38/111 (34%), Positives = 59/111 (53%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I++++   F S   K L    G +  F+S +HPQT G  E  + +L   LR  + 
Sbjct: 997  GLPQSIVSNRDVKFMSYFWKTLWVKLGTQLKFSSSFHPQTDGQTEVVNRSLGNLLRCIVR 1056

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNT 491
            +    WD  L  A  A+NS+ + TTG+ P E+ +G KP  P  +D + L T
Sbjct: 1057 DQLRNWDNVLPQAEFAFNSSTNRTTGYLPFEVAYGLKPKQP--VDLIPLPT 1105


>UniRef50_A5AJZ3 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 656

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 35/105 (33%), Positives = 60/105 (57%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  +I D+G +F +EV   ++R + I+H  +S Y PQT G +E ++  +K  LR  +V
Sbjct: 545 GVPHELILDRGVHFRAEVDTLVQR-YSIRHHRSSAYRPQTNGVVEAANKNIKRILRR-MV 602

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           E    W   L  A+ AY +   ++TG +P  L++G +  +P  I+
Sbjct: 603 ETSRDWSKKLPFALWAYRTYFRTSTGTTPYSLVYGMEAVLPVKIE 647


>UniRef50_A5AGD8 Cluster: Putative uncharacterized protein; n=3; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 2154

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 35/101 (34%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +I+++GA+F +EV   L+  +GI+H  +S Y PQT G +E  +  +K  LR  +V
Sbjct: 1929 GVPHELISNRGAHFRAEVDTLLQE-YGIRHHRSSAYRPQTNGXVEAXNKNIKRILRK-MV 1986

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            E    W   L  A+ AY ++  ++TG +P  L++G +  +P
Sbjct: 1987 ETSRDWSEKLPFALWAYRTSFRTSTGATPYSLVYGMEVVLP 2027


>UniRef50_Q9NL36 Cluster: Pol polyprotein; n=7; Bombyx mori|Rep: Pol
           polyprotein - Bombyx mori (Silk moth)
          Length = 596

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 37/101 (36%), Positives = 56/101 (55%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  I +DQG  F S +  +L +L GI  I  +PYHPQ+ GA+ER H +LK  L + + 
Sbjct: 365 GCPVRITSDQGRQFESNLFLKLTKLLGINKICTTPYHPQSNGAVERWHRSLKVALMTRL- 423

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            N  +W   L TAM    +++ + +G S  +L +G    +P
Sbjct: 424 -NDTSWVDELSTAMFGLRASVRTDSGVSAAQLTYGKNIRLP 463


>UniRef50_Q2HHU5 Cluster: Putative uncharacterized protein; n=2;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 1941

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 37/98 (37%), Positives = 53/98 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ I++D+G  F S   + L     +    +S +HPQT G  ER ++ L++YLR YI 
Sbjct: 1583 GLPETIVSDRGTQFVSAFWRALSARLAVTLRPSSAFHPQTNGQTERINAELEQYLRLYID 1642

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
              Q  W  +L  A  A N+ I  TTG SP    +GF P
Sbjct: 1643 WAQDDWVDWLPLAEFAGNNMISETTGVSPFFANYGFNP 1680


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 719,128,125
Number of Sequences: 1657284
Number of extensions: 14185441
Number of successful extensions: 39394
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 37600
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39257
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 71324098314
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).