SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0036
         (830 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; ...    57   6e-07
UniRef50_Q86QT4 Cluster: Putative uncharacterized protein; n=1; ...    50   9e-05
UniRef50_Q1R850 Cluster: Putative uncharacterized protein; n=3; ...    36   1.6  
UniRef50_Q7RTF4 Cluster: Putative uncharacterized protein PY0004...    34   5.0  
UniRef50_A2EFD7 Cluster: ATPase, putative; n=1; Trichomonas vagi...    33   8.8  

>UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1;
           Bombyx mori|Rep: Putative uncharacterized protein -
           Bombyx mori (Silk moth)
          Length = 77

 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 29/58 (50%), Positives = 37/58 (63%)
 Frame = +1

Query: 58  IFILADPSDFVVPRSINKRPKLWYKINLKKYKRNPSDGGDIKGKTKLFVFI*FRAFSY 231
           + ILADP+DFVVP+SINKRPK  YKINLK+ K     G   K K   + ++  R F +
Sbjct: 19  MIILADPADFVVPQSINKRPKHLYKINLKQTKGIRQTGDTSKEKQNCYFYLIPRIFIF 76


>UniRef50_Q86QT4 Cluster: Putative uncharacterized protein; n=1;
           Bombyx mori|Rep: Putative uncharacterized protein -
           Bombyx mori (Silk moth)
          Length = 47

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 23/26 (88%), Positives = 23/26 (88%)
 Frame = -1

Query: 320 LKLENGWTDLANFGLELFVEVQRRFK 243
           LKLENGWTDLANFGLEL VEVQR  K
Sbjct: 20  LKLENGWTDLANFGLELPVEVQRGLK 45


>UniRef50_Q1R850 Cluster: Putative uncharacterized protein; n=3;
           Escherichia coli|Rep: Putative uncharacterized protein -
           Escherichia coli (strain UTI89 / UPEC)
          Length = 296

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +3

Query: 594 IGNY-ALYNLSQPCYLR*RIIIGRWSEIKRNDYIIKIR*KMFFSILTIMVPIFYVYVMYV 770
           I NY ALY   +   L    II  W  +    Y +       +S+L+IM+  F+VYV YV
Sbjct: 212 IQNYVALYGFCRNICLI--FIISFWVSVPTFIYRLCTHSDYLYSLLSIMLSFFFVYVFYV 269

Query: 771 GFL 779
           GF+
Sbjct: 270 GFV 272


>UniRef50_Q7RTF4 Cluster: Putative uncharacterized protein PY00040;
            n=9; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
            protein PY00040 - Plasmodium yoelii yoelii
          Length = 5229

 Score = 33.9 bits (74), Expect = 5.0
 Identities = 23/71 (32%), Positives = 34/71 (47%)
 Frame = -1

Query: 416  LNTTTSKR*ITHSNEIYLLSIYIKMNCCSLVSLKLENGWTDLANFGLELFVEVQRRFKSL 237
            LN+ T  R     N +Y    YI +   + V  KLE G+ D +NF   ++    +  K +
Sbjct: 1371 LNSPTKSR---IRNSVYKNEEYINIEDYNSVKKKLEYGFYDNSNF-YNIYYNEMQNIKII 1426

Query: 236  KKYENARNYIK 204
            KKY   +N IK
Sbjct: 1427 KKYLKRKNEIK 1437


>UniRef50_A2EFD7 Cluster: ATPase, putative; n=1; Trichomonas
           vaginalis G3|Rep: ATPase, putative - Trichomonas
           vaginalis G3
          Length = 1077

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 19/73 (26%), Positives = 36/73 (49%)
 Frame = -1

Query: 221 ARNYIKTNNFVFPLMSPPSDGFLLYFFKFILYQSLGLLFIDRGTTKSDGSASINILISKS 42
           AR + +    + P  SP  D F++ + KFI+ +S+G +F D G+      +  ++ + + 
Sbjct: 276 ARRFDEYKEKLIPNESP-DDRFIINYDKFIISESIGTVFNDDGSPLFSQHSDRSLRLIRL 334

Query: 41  LTKQASSRDSRCF 3
           + K    R   CF
Sbjct: 335 IPKGILERRKSCF 347


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 795,585,299
Number of Sequences: 1657284
Number of extensions: 15998011
Number of successful extensions: 37013
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 35575
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37002
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 72143915536
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).