SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0035
         (754 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5KTM6 Cluster: Reverse transcriptase; n=1; Bombyx mori...   177   3e-43
UniRef50_Q9TYB6 Cluster: DNA, W-Samurai RAPD marker in retrotran...   150   4e-35
UniRef50_Q4F8Q2 Cluster: Reverse transcriptase; n=1; Aedes aegyp...    95   2e-18
UniRef50_UPI00015B5EC2 Cluster: PREDICTED: similar to sidestep p...    87   4e-16
UniRef50_UPI00015B52AB Cluster: PREDICTED: hypothetical protein;...    72   2e-11
UniRef50_UPI00015B47C2 Cluster: PREDICTED: similar to ORF2-encod...    64   4e-09
UniRef50_A7SLF5 Cluster: Predicted protein; n=1; Nematostella ve...    64   4e-09
UniRef50_Q5KTL3 Cluster: Reverse transcriptase; n=1; Bombyx mori...    62   1e-08
UniRef50_UPI00015B461C Cluster: PREDICTED: similar to polypeptid...    60   4e-08
UniRef50_UPI0000587485 Cluster: PREDICTED: similar to endonuclea...    53   9e-06
UniRef50_UPI00015B48A6 Cluster: PREDICTED: similar to ORF2-encod...    52   1e-05
UniRef50_UPI0000E49ABF Cluster: PREDICTED: similar to ORF2-encod...    50   8e-05
UniRef50_UPI0000E47234 Cluster: PREDICTED: hypothetical protein;...    47   6e-04
UniRef50_A7T1Z7 Cluster: Predicted protein; n=4; Nematostella ve...    46   8e-04
UniRef50_A7SVK4 Cluster: Predicted protein; n=1; Nematostella ve...    46   0.001
UniRef50_A7RQC5 Cluster: Predicted protein; n=1; Nematostella ve...    46   0.001
UniRef50_UPI00015B46F3 Cluster: PREDICTED: similar to reverse tr...    45   0.002
UniRef50_A7S647 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.004
UniRef50_UPI0000E499E6 Cluster: PREDICTED: similar to ReO_6; n=1...    44   0.005
UniRef50_UPI0000E4A4D9 Cluster: PREDICTED: similar to endonuclea...    43   0.007
UniRef50_A7SXY3 Cluster: Predicted protein; n=1; Nematostella ve...    42   0.012
UniRef50_A7RGI2 Cluster: Predicted protein; n=2; Nematostella ve...    42   0.012
UniRef50_UPI0000E46BAD Cluster: PREDICTED: similar to ReO_6; n=3...    42   0.016
UniRef50_Q2KKY2 Cluster: Reverse transcriptase-like protein; n=2...    42   0.016
UniRef50_Q9Y1H0 Cluster: Reverse transcriptase-like protein; n=1...    42   0.016
UniRef50_A7SZD3 Cluster: Predicted protein; n=4; Nematostella ve...    41   0.038
UniRef50_Q4QQE9 Cluster: Endonuclease-reverse transcriptase; n=1...    40   0.050
UniRef50_P22430 Cluster: Envelope glycoprotein precursor (Env po...    40   0.066
UniRef50_UPI0000E47329 Cluster: PREDICTED: similar to novel chol...    40   0.087
UniRef50_UPI000069DFFC Cluster: UPI000069DFFC related cluster; n...    40   0.087
UniRef50_Q868Q6 Cluster: Reverse transcriptase; n=3; Anopheles g...    40   0.087
UniRef50_Q9C443 Cluster: Adenylate cyclase; n=6; Dikarya|Rep: Ad...    40   0.087
UniRef50_UPI00015B4963 Cluster: PREDICTED: similar to conserved ...    39   0.15 
UniRef50_Q9U997 Cluster: Reverse transcriptase; n=1; Anopheles m...    39   0.15 
UniRef50_UPI00015B461B Cluster: PREDICTED: similar to ORF2-encod...    38   0.20 
UniRef50_Q9GP60 Cluster: Pol protein; n=1; Drosophila melanogast...    38   0.20 
UniRef50_A7RX06 Cluster: Predicted protein; n=1; Nematostella ve...    38   0.20 
UniRef50_Q17003 Cluster: Putative reverse transcriptase; n=29; C...    38   0.27 
UniRef50_A7S962 Cluster: Predicted protein; n=7; Nematostella ve...    38   0.27 
UniRef50_UPI00015B4392 Cluster: PREDICTED: similar to ORF2-encod...    38   0.35 
UniRef50_Q5TTM1 Cluster: ENSANGP00000026284; n=1; Anopheles gamb...    38   0.35 
UniRef50_UPI0000E49F6D Cluster: PREDICTED: similar to ORF2-encod...    37   0.61 
UniRef50_UPI0000E49710 Cluster: PREDICTED: similar to endonuclea...    37   0.61 
UniRef50_A7T2B1 Cluster: Predicted protein; n=1; Nematostella ve...    37   0.61 
UniRef50_A0J797 Cluster: Putative uncharacterized protein precur...    36   1.1  
UniRef50_A7RXU9 Cluster: Predicted protein; n=4; Nematostella ve...    36   1.1  
UniRef50_Q2GDV9 Cluster: Acyl carrier protein; n=1; Neorickettsi...    36   1.4  
UniRef50_Q6IFU2 Cluster: Pol polyprotein; n=6; Schistosoma|Rep: ...    36   1.4  
UniRef50_Q0U0Y9 Cluster: Predicted protein; n=1; Phaeosphaeria n...    36   1.4  
UniRef50_A7SPE1 Cluster: Predicted protein; n=1; Nematostella ve...    35   1.9  
UniRef50_UPI0000E48EFD Cluster: PREDICTED: similar to reverse tr...    35   2.5  
UniRef50_Q4QQE6 Cluster: Endonuclease-reverse transcriptase; n=2...    35   2.5  
UniRef50_UPI0000E49018 Cluster: PREDICTED: similar to scavenger ...    34   3.3  
UniRef50_A5DNX6 Cluster: Predicted protein; n=1; Pichia guillier...    34   3.3  
UniRef50_Q95SX7 Cluster: Probable RNA-directed DNA polymerase fr...    34   3.3  
UniRef50_Q6V7W5 Cluster: Hox protein Dfd; n=2; Digenea|Rep: Hox ...    34   4.3  
UniRef50_A7T9U6 Cluster: Predicted protein; n=6; Nematostella ve...    34   4.3  
UniRef50_A7EJQ0 Cluster: Putative uncharacterized protein; n=2; ...    34   4.3  
UniRef50_A3QGQ9 Cluster: PAS/PAC sensor signal transduction hist...    33   5.7  
UniRef50_Q18LA9 Cluster: Pol protein; n=8; melanogaster subgroup...    33   5.7  
UniRef50_A7TBQ2 Cluster: Predicted protein; n=1; Nematostella ve...    33   5.7  
UniRef50_UPI0000E45ED4 Cluster: PREDICTED: similar to SJCHGC0161...    33   7.6  
UniRef50_Q903Y5 Cluster: Glycoprotein gp90; n=81; Equine infecti...    33   7.6  
UniRef50_Q5KTL8 Cluster: Putative uncharacterized protein; n=1; ...    33   7.6  
UniRef50_Q5B9Y7 Cluster: Putative uncharacterized protein; n=1; ...    33   7.6  
UniRef50_UPI00015B4820 Cluster: PREDICTED: similar to pol-like p...    33   10.0 
UniRef50_UPI0000E47D32 Cluster: PREDICTED: similar to endonuclea...    33   10.0 
UniRef50_UPI0000E46FD3 Cluster: PREDICTED: hypothetical protein,...    33   10.0 
UniRef50_UPI00015A5DF8 Cluster: UPI00015A5DF8 related cluster; n...    33   10.0 
UniRef50_Q52045 Cluster: Putative uncharacterized protein; n=1; ...    33   10.0 
UniRef50_A3UQC1 Cluster: Putative uncharacterized protein; n=1; ...    33   10.0 
UniRef50_A1KVC9 Cluster: Putative uncharacterized protein; n=4; ...    33   10.0 
UniRef50_Q7XM61 Cluster: OSJNBb0020O11.11 protein; n=1; Oryza sa...    33   10.0 
UniRef50_Q7M4J4 Cluster: RNA-directed DNA polymerase (EC 2.7.7.4...    33   10.0 
UniRef50_A7T3E1 Cluster: Predicted protein; n=2; Nematostella ve...    33   10.0 
UniRef50_A7RTE3 Cluster: Predicted protein; n=2; Nematostella ve...    33   10.0 
UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1; Pneum...    33   10.0 
UniRef50_Q12019 Cluster: Midasin; n=4; Saccharomycetaceae|Rep: M...    33   10.0 

>UniRef50_Q5KTM6 Cluster: Reverse transcriptase; n=1; Bombyx
           mori|Rep: Reverse transcriptase - Bombyx mori (Silk
           moth)
          Length = 185

 Score =  177 bits (430), Expect = 3e-43
 Identities = 84/184 (45%), Positives = 115/184 (62%)
 Frame = -3

Query: 695 DWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXX 516
           DWS +     ++DMV SFN  +  L+D HAP+RRVR+K  P+PWL+  IK +M       
Sbjct: 2   DWSTVFGSDTVDDMVLSFNKNISLLYDNHAPIRRVRVKQLPSPWLSDSIKRMMARRDKAK 61

Query: 515 XXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPV 336
               + PTE +L  YK LRNRCNR+CRDAKR + H SLE  +    W+FL S+GIGK   
Sbjct: 62  RRYRKLPTEDNLITYKKLRNRCNRMCRDAKRRHIHSSLEGLNTCQIWKFLNSLGIGKHLN 121

Query: 335 SSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFF 156
            +    +L ALNKHFS  P+ L+DS+K++TLL++S   +P    F  +PV+  DV+ S  
Sbjct: 122 ETSFTINLDALNKHFSQAPIILNDSTKSSTLLQLSKRPLPMCTPFTFTPVTECDVKRSIL 181

Query: 155 SISS 144
           SIS+
Sbjct: 182 SIST 185


>UniRef50_Q9TYB6 Cluster: DNA, W-Samurai RAPD marker in
           retrotranposable element (reverse transcriptase), strain
           p50; n=3; Bombyx mori|Rep: DNA, W-Samurai RAPD marker in
           retrotranposable element (reverse transcriptase), strain
           p50 - Bombyx mori (Silk moth)
          Length = 290

 Score =  150 bits (363), Expect = 4e-35
 Identities = 78/229 (34%), Positives = 129/229 (56%), Gaps = 1/229 (0%)
 Frame = -3

Query: 695 DWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXX 516
           DW  ++   ++++ V+ FN  V  L+D HAP+R++++K   APW+T  I+  M       
Sbjct: 2   DWDQLISSPSVDEKVHIFNEVVHGLYDTHAPIRKIKLKRPLAPWMTEGIRMAMRRRDRAF 61

Query: 515 XXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPV 336
               R   + +   +K  RNRCN++ R+AKR +  +++ + SPA  W+FL ++GIG+   
Sbjct: 62  RKFRRNRCDDNWTKFKVSRNRCNQMIRNAKRRHILENINSASPADIWKFLGTLGIGRQRH 121

Query: 335 SSVKDT-DLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSF 159
              + T +L  +N HFS     L++ +K  TL  ++ LS   +  FE S V+V +++N  
Sbjct: 122 PDFQATINLNGINFHFS-SATPLNNQTKCRTLNYLNGLSRLNVDSFEFSSVAVDEIKNII 180

Query: 158 FSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            SI S AVG DN+  ++I  IL  + P +  I NFS +S +FP  W+ A
Sbjct: 181 LSIKSNAVGCDNISRRIIVTILDYLLPAIWHITNFSLSSGSFPSLWRKA 229


>UniRef50_Q4F8Q2 Cluster: Reverse transcriptase; n=1; Aedes
           aegypti|Rep: Reverse transcriptase - Aedes aegypti
           (Yellowfever mosquito)
          Length = 725

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 66/246 (26%), Positives = 106/246 (43%), Gaps = 2/246 (0%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVR-IKHKP 573
           R+YK +D   +    N +DW       N + +++ FN  + S+ ++  P+R+VR  K+K 
Sbjct: 44  RDYKALDPEIVLNKFNESDWERFYSITNPDVLIDMFNNTLNSIHEECVPLRKVRKSKNKV 103

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
            PW    I+                      A YK LRN  NRL   AKR Y++      
Sbjct: 104 NPWFNSQIQIAFIDRDRAYKKWKHSADSDDFARYKILRNLSNRLVTQAKRSYYNAQFSGE 163

Query: 392 -SPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVP 216
            +    W  ++  G+GK   +   D +   +N  F         +S+  T+      +  
Sbjct: 164 MTTKDFWHRIRHTGLGKPNSNIESDFNADEINASF-----QRHFTSQIRTITHDPRNNND 218

Query: 215 RIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSN 36
           R   F   PV + ++ N+   + S A+G+DNV  K+I  +LP V   L+ IFN    S  
Sbjct: 219 R--RFAFQPVRIFEIINAVHEVKSNAIGLDNVPIKLIKSLLPLVLAPLSHIFNNIIESCV 276

Query: 35  FPDSWK 18
           +P  WK
Sbjct: 277 YPQVWK 282


>UniRef50_UPI00015B5EC2 Cluster: PREDICTED: similar to sidestep
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to sidestep protein - Nasonia vitripennis
          Length = 1347

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 67/239 (28%), Positives = 99/239 (41%), Gaps = 3/239 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+YK ++L  L  D+   DWS      +I+  V      +I   D+HAP R  + +  P+
Sbjct: 237 RSYKRLNLDKLLGDLVLLDWSPFYRTVDIDYKVKFLTKSLIESLDKHAPYREFKPRKNPS 296

Query: 569 PWLTPDIKTLM--XXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           PW+TPDI  L+               P  H    Y  LRN      R+AK  ++   L+N
Sbjct: 297 PWITPDILRLISSRDKAWRNFRHRGKPRTH----YNRLRNSVQSAIRNAKFNFYRNKLQN 352

Query: 395 -RSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSV 219
              P   WR ++ +GI K   +     D    N+HF      +   S     L       
Sbjct: 353 CADPREMWRIIEELGITKPSETPSMPVDPDTFNRHF------IGSVSAAPLHLPSPPERP 406

Query: 218 PRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTS 42
           P    F    V V  V ++F +  S A G+D++  K +   LP +   L DIF+ S  S
Sbjct: 407 PVDSQFFFKYVEVEHVLDAFSAAHSNAKGVDDISLKDLTNSLPAIMHALLDIFDTSLQS 465


>UniRef50_UPI00015B52AB Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 1100

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 47/156 (30%), Positives = 74/156 (47%), Gaps = 1/156 (0%)
 Frame = -3

Query: 482 LAIYKALRNRCNRLCRDAKRLYFHKSLENRSP-AHTWRFLKSVGIGKTPVSSVKDTDLCA 306
           L IY+  R+  ++   +A+  Y++  L   +  A  WR L+ +GI  T   S    +   
Sbjct: 27  LRIYRLARDNAHKQVEEARLNYYYLRLSTLTDVAEIWRELEKLGISATKAPSPSRYNTDE 86

Query: 305 LNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGID 126
           LNKHFS         +    LL + SL +P    FE S ++ +DV  +         G D
Sbjct: 87  LNKHFSSISNDPLAPAVEDYLLTLESLDLPEH--FEFSTITESDVLAAVPHFDIQNRGSD 144

Query: 125 NVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
            +   +I+  LP +AP+L+ IFN S +   FP +WK
Sbjct: 145 GIPQVVISKALPVLAPLLSHIFNLSLSEPYFPSAWK 180


>UniRef50_UPI00015B47C2 Cluster: PREDICTED: similar to ORF2-encoded
            protein; n=1; Nasonia vitripennis|Rep: PREDICTED: similar
            to ORF2-encoded protein - Nasonia vitripennis
          Length = 1013

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 61/257 (23%), Positives = 105/257 (40%), Gaps = 11/257 (4%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCI-LEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
            R++K I    L   +   DWS +      ++  +   + K++++ DQ AP++  + + K 
Sbjct: 329  RDFKSIKSDELLSLLAACDWSSVSCSDSGVDTRLEHLSQKLLTVIDQLAPLKEFKPRQKD 388

Query: 572  -APWLTPDIKTLMXXXXXXXXXXXRCPT-----EHSLAIYKALRNRCNRLCRDAKRLYFH 411
              PW+  +++ L                     +     Y+AL     R    A+  +  
Sbjct: 389  YPPWVDAELRHLYSRRDALKRRHKHARRGSRRLDDLWTEYQALAAEAERCTNQAREEFIQ 448

Query: 410  K----SLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATL 243
                 +LEN    + W  L+S+ +       +       LN HF+   VS+SD+ +   L
Sbjct: 449  NRIFDALENNK--NVWNELRSLSLISKAKEDLHGFTTDELNTHFA--GVSISDAEREVDL 504

Query: 242  LKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDI 63
              I  L+      F    V+ ADV  +    SS A G D +   +IA  LP +  +L  +
Sbjct: 505  RSI--LAEANEDGFTFREVTFADVVLAVAHFSSQAKGEDGIPQSVIAKSLPVLGHLLVTL 562

Query: 62   FNFSFTSSNFPDSWKPA 12
            FN S +   FP +WK A
Sbjct: 563  FNASLSCGVFPGAWKNA 579


>UniRef50_A7SLF5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 503

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 41/165 (24%), Positives = 79/165 (47%), Gaps = 2/165 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R  K  +  A R D+ + +W+ +  +++ N M N++    +   ++HAP    R++   +
Sbjct: 298 RKLKNFNYDAFRADIASLNWNFLNSYNDPNVMWNNWKEMFLHFVEKHAPFCAKRVRLSKS 357

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSL-ENR 393
           PW+  D+K LM           R    +   I+K  RN  N   + AK++Y+  +  EN 
Sbjct: 358 PWINSDLKKLMHQRVVFKIKAIRSKDVNDWKIFKKYRNFVNCQIKIAKQIYYDNAFRENE 417

Query: 392 -SPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDS 261
            +  +TW+ +  +   KT  S++K+  L   + H     +SLS++
Sbjct: 418 GNIRNTWKVINELTSRKTNNSTIKEVKLD--DDHSITDSLSLSEA 460


>UniRef50_Q5KTL3 Cluster: Reverse transcriptase; n=1; Bombyx
           mori|Rep: Reverse transcriptase - Bombyx mori (Silk
           moth)
          Length = 164

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 27/71 (38%), Positives = 42/71 (59%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R +  +DL  LR D    +W  +++  +++  V  FN  VI L+D HA +RRV++K  PA
Sbjct: 64  RCFSRMDLEKLRNDAAEINWDPLVDAASVDHKVEIFNNIVIKLYDIHASIRRVKLKRTPA 123

Query: 569 PWLTPDIKTLM 537
           PW+T  +K  M
Sbjct: 124 PWMTEGVKMAM 134


>UniRef50_UPI00015B461C Cluster: PREDICTED: similar to polypeptide;
           n=2; Nasonia vitripennis|Rep: PREDICTED: similar to
           polypeptide - Nasonia vitripennis
          Length = 396

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 49/192 (25%), Positives = 82/192 (42%), Gaps = 2/192 (1%)
 Frame = -3

Query: 587 IKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK 408
           +K +P+PWLTP+++ L               +  +   YKALR +       A   Y+ K
Sbjct: 23  LKRQPSPWLTPELRKLRNARNKAGHKLKYNKSRKNKDEYKALRKKVKIEFNRASMAYYSK 82

Query: 407 SLEN-RSPAHTWRFLKSVGI-GKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKI 234
            + N R+    W  +  +G+ GK          + ALN+ F    V  + S     L   
Sbjct: 83  KISNCRNCKEMWEIISKLGLRGKDKSDIQLPVSVDALNRFF----VGSNKSEILHDLRPT 138

Query: 233 SSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNF 54
           + +S      F    V+  ++  +F +  S AVG D + + ++      + P+L +IF+ 
Sbjct: 139 ARISPD--DYFYFRHVTAQEILQAFSASRSNAVGPDGLQASILKDCSFAI-PVLMNIFDA 195

Query: 53  SFTSSNFPDSWK 18
              S  FPDSWK
Sbjct: 196 LLQSGIFPDSWK 207


>UniRef50_UPI0000587485 Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 766

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 45/226 (19%), Positives = 82/226 (36%), Gaps = 8/226 (3%)
 Frame = -3

Query: 665 INDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEH 486
           +  M ++    ++ L ++H P +    +    PW+T  +K L               +  
Sbjct: 106 VQAMWDNIKTTLLHLMEKHVPSKMTSTRFSQ-PWITRSLKQLTHRKKRSFDRAKASNSPE 164

Query: 485 SLAIYKALRNRCNRLCRDAKRLYFHKSLENRS---PAHTWRFLKSVGIGKTPVSSVKDTD 315
               Y A++ +  + C++A   Y    +   S   P   W F+ S     + V+S+K TD
Sbjct: 165 DYEKYLAVKKQTRKACKNAYYKYVEDIVSPDSTTNPKRFWSFINSKRCDSSGVASLKSTD 224

Query: 314 LCALNKHFSLPPVSLSDSSKTAT----LLKISSLSVPRIPIFELSPVSVADVRNSFFSIS 147
               +   S   +     S   T    +  +  +     P  E   +  A V      + 
Sbjct: 225 GLTYSDSASKSNILNRQFSSVFTRNEDMTNMKDMGRSPYPSMEAITIQPAGVLKILSELQ 284

Query: 146 -STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
              A G D + S+++  +   + P+LT  F  S      PD WK A
Sbjct: 285 VHKATGPDELPSRLLRSLAKELTPVLTVFFQASLDQGEVPDDWKNA 330


>UniRef50_UPI00015B48A6 Cluster: PREDICTED: similar to ORF2-encoded
            protein; n=5; Nasonia vitripennis|Rep: PREDICTED: similar
            to ORF2-encoded protein - Nasonia vitripennis
          Length = 1146

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 51/214 (23%), Positives = 90/214 (42%), Gaps = 7/214 (3%)
 Frame = -3

Query: 632  VISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNR 453
            V+S  D+ AP++ V  + K APW  P+++ L+           R            L   
Sbjct: 653  VLSSIDELAPLKTVCPRRKYAPWSGPELRLLIDKRNATLRRYERTGRAELFDEVLRLTYE 712

Query: 452  CNRLCRDAKRLYFHKSL-----ENRSPAHTWRFLKSVGI--GKTPVSSVKDTDLCALNKH 294
             +      +  +  + L     ENR+    W+ ++ + +  G+        T    LN+H
Sbjct: 713  VDMRSAQERESFLRQQLLDALDENRN---IWKVMRHLDLLPGRKEEEFFGFTP-GELNEH 768

Query: 293  FSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCS 114
            F+   VS  ++   A    + ++ +     F  SPVS++DV  +    SS A G+D +  
Sbjct: 769  FAGVSVSPLENIHNA----MDTILLAGEEGFTFSPVSMSDVVLAISHFSSQARGVDGIPC 824

Query: 113  KMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
             ++   LP +   + ++FN SF    FP  WK A
Sbjct: 825  GVVVKALPIIGEFILNLFNCSFAQGIFPRIWKQA 858


>UniRef50_UPI0000E49ABF Cluster: PREDICTED: similar to ORF2-encoded
            protein; n=5; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ORF2-encoded protein -
            Strongylocentrotus purpuratus
          Length = 1124

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 49/250 (19%), Positives = 101/250 (40%), Gaps = 6/250 (2%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
            R  + ID+  LR D+  T    +    + +DM   +N  +  L D+HAP R + +  +P 
Sbjct: 413  RKLRDIDVVQLRNDIQ-TSLLTLPTAKDASDMAEQYNIVLKELLDKHAPERSILVTIRPK 471

Query: 572  APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
            APW T +++                  E    ++K      N +   +K  Y    +   
Sbjct: 472  APWYTNEVREAKRSKRRAERKLKSSGLEVDRQLFKEECKSYNAVLSQSKSRYLTDEIAQC 531

Query: 392  SPAHTWRFLKSVGIGKTP-VSSVKDTDLCALNKHFSLPPVSLSD-SSKTATLLKISSLSV 219
               H ++ ++++   K+  +    ++D+   N         + D  +    +   SS   
Sbjct: 532  DTKHLFQLVQTLSRPKSQHLLPDHESDINLANDFGQFFYNKIQDIVTNLQGITSRSSDCE 591

Query: 218  PRIPIFELS---PVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSF 48
              +   +LS   PVS  +V+      SS +  +D + + ++   +  + P +T++ N S 
Sbjct: 592  DGVTTHKLSSFEPVSEFEVQKVIRESSSKSCRLDPIPTWLMKDCINELVPFVTELVNLSL 651

Query: 47   TSSNFPDSWK 18
            +S   P ++K
Sbjct: 652  SSGEVPAAYK 661


>UniRef50_UPI0000E47234 Cluster: PREDICTED: hypothetical protein;
           n=3; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 762

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 45/161 (27%), Positives = 71/161 (44%), Gaps = 9/161 (5%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHKSLEN--RSPAHTWRFLKSVGIGKTPVSSVKDTDLCALN 300
           YK LRN+  +  R A R +    +EN  ++P   WR+  S    K+ + S+   D     
Sbjct: 153 YKQLRNQLRKATRVASRSFEADLVENIGQNPKAFWRYANSKVKSKSHIVSLMKEDGQPAQ 212

Query: 299 KHFSLPPVSLSDSSKTAT---LLKISSLSVP-RIPIFELSPVS--VADVRNSFFSISST- 141
               +  +     S   T   L  I  + VP R+ +  LS V+  V+DV N    +++  
Sbjct: 213 TDSEMANILNEYFSSVFTQEDLQNIPDIQVPLRMDLPTLSKVNILVSDVENKLKKLNTNK 272

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           + G D    K++  +  T+A  LT I+N S   S  P  WK
Sbjct: 273 SPGPDGTHPKVMKELAKTIAEPLTLIYNKSMQESKLPLDWK 313


>UniRef50_A7T1Z7 Cluster: Predicted protein; n=4; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 863

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 30/116 (25%), Positives = 47/116 (40%), Gaps = 4/116 (3%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVR---RVRIK 582
           R+Y   D  A+  D+   +W     H  ++ND  +SF   V  + D+H P++   R  IK
Sbjct: 370 RDYSHYDESAVVHDMQAINWEHCFSHCKDVNDYFDSFYASVERIIDKHVPLKKLSRKEIK 429

Query: 581 HKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYF 414
               PW+T  IK  +                     +K  RN+  RL   +K  Y+
Sbjct: 430 FLSKPWITTGIKHSIAIKNKLYKQFLNTQNSFIHKQFKLYRNKLKRLLMASKEKYY 485


>UniRef50_A7SVK4 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1094

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
            R++K  +  +L  ++ N +W+ I    + ND    +    IS  D+HAP+RR R   K +
Sbjct: 1009 RSFKNFNETSLLNELKNKEWNDIAPLTDPNDTWEKWRTLFISCLDKHAPLRRKRTGEKSS 1068

Query: 569  PWLTPDI 549
            PW+  D+
Sbjct: 1069 PWIDYDL 1075


>UniRef50_A7RQC5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 389

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/62 (32%), Positives = 37/62 (59%)
 Frame = -3

Query: 722 ALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKT 543
           AL + + + DWS + E  +I+D+ N+F   +  L D+  P++ + +  +  PWLTP +K 
Sbjct: 249 ALYKRLVDFDWSPLRELSSIDDITNTFQSTLHLLMDECLPLKSITMSSRDPPWLTPLVKV 308

Query: 542 LM 537
           L+
Sbjct: 309 LL 310


>UniRef50_UPI00015B46F3 Cluster: PREDICTED: similar to reverse
           transcriptase-like protein; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to reverse
           transcriptase-like protein - Nasonia vitripennis
          Length = 745

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 35/122 (28%), Positives = 57/122 (46%)
 Frame = -3

Query: 377 WRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFE 198
           W+ L+++G+  +    + D     LN HF+   +S+SDS     L  I++     + +F 
Sbjct: 22  WKELRALGLLPSTKEELHDFTPQELNSHFA--GMSVSDSECARELEDIATSDSEDVFVFR 79

Query: 197 LSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
              VS+ADV  +    SS A G D +   +IA  L +     T +   S +   FP +WK
Sbjct: 80  A--VSIADVVLAVSHFSSRAAGEDGIPLGVIAKSLLSARDSSTYLITLSLSCGVFPGAWK 137

Query: 17  PA 12
            A
Sbjct: 138 RA 139


>UniRef50_A7S647 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 686

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = -3

Query: 722 ALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKT 543
           AL  +   TDW  + +  N+N  V     ++ +L D+H P+R V++  +   W+ P +K+
Sbjct: 458 ALYMEFAETDWGDVTKATNVNVAVGGLEQRIRTLMDKHMPLRSVQMSTQDPAWMMPLVKS 517

Query: 542 L 540
           L
Sbjct: 518 L 518


>UniRef50_UPI0000E499E6 Cluster: PREDICTED: similar to ReO_6; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           ReO_6 - Strongylocentrotus purpuratus
          Length = 472

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 46/241 (19%), Positives = 90/241 (37%), Gaps = 7/241 (2%)
 Frame = -3

Query: 719 LRRDVNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKT 543
           LR   + TDW  +     ++++  ++    V    D   P++  ++     PW+T +++ 
Sbjct: 88  LRAAFDCTDWDLLFNSASSLDEATDAITSYVKFCVDSIIPLKTFKMFPNNKPWVTKELRD 147

Query: 542 LMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLK 363
           L+           +   +      K L + C    ++        +  N  PA  W+ ++
Sbjct: 148 LLKVKNGALINGNKTRVKEVQREIKRLVDSCKMSYKNK----LENNFRNNKPAAAWKTME 203

Query: 362 SVGIGKTPVSSVKDTDLCA-----LNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFE 198
            +  G  P       D+       LN  +       +  +    L     LS     I  
Sbjct: 204 VI-TGYKPKPKTLGFDITQDFVDELNDFYCRYDKKFTVENDVIALRLRQMLSESENVIC- 261

Query: 197 LSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
              +S  DVR  F ++ +  A G D +C+K++ L    +A +  ++FN S    + P  W
Sbjct: 262 ---ISEHDVRRCFGALKTNKAPGPDGICNKVLKLCRDQLAGVFNELFNHSLERGHIPTLW 318

Query: 20  K 18
           K
Sbjct: 319 K 319


>UniRef50_UPI0000E4A4D9 Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase, partial; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase, partial -
           Strongylocentrotus purpuratus
          Length = 273

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 6/148 (4%)
 Frame = -3

Query: 437 RDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALN---KHFSLPPVSLS 267
           + A R Y  +  E+ +  + WR+++S       + ++K  D    N   K F+L     S
Sbjct: 9   KSAHRQYIKELTEDANTKNFWRYIRSTRKDNVGIQTLKVNDQTLTNARDKAFALSSQFES 68

Query: 266 DSSKTATLLKISSLSVPRIPIFELSPVSV--ADVRNSFFSIS-STAVGIDNVCSKMIALI 96
             ++ +   K         P  E+ P+ V    VR    +I+ S A+G D V ++ + L 
Sbjct: 69  VFNRESQGQKPQPTMTGN-PFPEMPPIIVDTEGVRKLLQNINTSKAIGPDQVPNQALKLA 127

Query: 95  LPTVAPILTDIFNFSFTSSNFPDSWKPA 12
              +AP+L  +F  S    + P+ W+ A
Sbjct: 128 ADEIAPVLQHLFQQSLDLGDLPEDWRKA 155


>UniRef50_A7SXY3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 324

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 1/98 (1%)
 Frame = -3

Query: 302 NKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISST-AVGID 126
           N + ++  +S SD  K   L       +P    FE+  V    V+     + +  A G+D
Sbjct: 216 NSNVNMRTLSTSDFEK---LKGFVDSKIPSGTKFEIPKVMQEFVQGYLLQLQTCKATGLD 272

Query: 125 NVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            + ++++    P +AP LT I N S  +  FP  WK A
Sbjct: 273 GIRARLLRAAAPAIAPSLTKIINQSIKTGRFPARWKEA 310


>UniRef50_A7RGI2 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 335

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 4/72 (5%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVR---RVRIK 582
           R Y   D  A+  D+   +W     H  ++ND  +SF   V  + D+HAP++   R  IK
Sbjct: 239 RVYSHYDESAVVHDMQAINWEHCFSHCKDVNDYFDSFYASVERIIDKHAPLKKLSRKEIK 298

Query: 581 HKPAPWLTPDIK 546
               PW+T  IK
Sbjct: 299 FLSKPWITTGIK 310


>UniRef50_UPI0000E46BAD Cluster: PREDICTED: similar to ReO_6; n=3;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            ReO_6 - Strongylocentrotus purpuratus
          Length = 1194

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 51/245 (20%), Positives = 102/245 (41%), Gaps = 13/245 (5%)
 Frame = -3

Query: 707  VNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXX 528
            ++   W  ++   +  +  +     + +  D++ P++ V++  +  PW+TP +K+L+   
Sbjct: 360  ISQHTWDDVMASSSAQEKCDKLYASLQNAMDEYLPMKSVKMHPRDKPWVTPYLKSLIGQR 419

Query: 527  XXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWRFLKSV 357
                       TE     +K LRN+      + K+ ++      L+  +P+  ++ LK +
Sbjct: 420  QKAFSNDR---TEE----WKRLRNKVQNKKTELKKNFYKDRVLKLKRENPSSWYKHLKIM 472

Query: 356  GIGKT------PVSSVKDTDLC---ALNKHFSLPPVSLSDSSKTATLLKISS-LSVPRIP 207
               KT      P S   D DL     +N HF+    ++S       L  + + L  P+ P
Sbjct: 473  TSSKTASNIIIPESPELD-DLAIADCVNDHFA----NVSQDIPELDLQSLPAYLPTPK-P 526

Query: 206  IFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPD 27
               + P  V    N      S+  G D + ++++      +A  L ++ N S+ S + P 
Sbjct: 527  QLTVQPHEVYKELNRIKPGKSS--GPDGIPARIVKEFAVELASPLCEVLNSSYHSGSVPS 584

Query: 26   SWKPA 12
             WK A
Sbjct: 585  QWKGA 589


>UniRef50_Q2KKY2 Cluster: Reverse transcriptase-like protein; n=2;
           Siniperca chuatsi|Rep: Reverse transcriptase-like
           protein - Siniperca chuatsi (Chinese perch)
          Length = 148

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 1/113 (0%)
 Frame = -3

Query: 701 NTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVR-RVRIKHKPAPWLTPDIKTLMXXXX 525
           N   S   +  N ND+V+ FNY+  S  D  AP++ R   K +  PWL   I++      
Sbjct: 4   NPPGSVFPDSSNTNDLVDYFNYQCSSTLDLIAPLKNRQNSKTRKQPWLNDSIRSCKKNCR 63

Query: 524 XXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFL 366
                  +   +      K L    NR+ +DA+  +F   +   +  H  RFL
Sbjct: 64  RAERRWKKSRLQVHFVAMKELLRLYNRMVKDARTCHFSALIS--AHQHNPRFL 114


>UniRef50_Q9Y1H0 Cluster: Reverse transcriptase-like protein; n=1;
           Amblyomma americanum|Rep: Reverse transcriptase-like
           protein - Amblyomma americanum (lone star tick)
          Length = 315

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 43/160 (26%), Positives = 75/160 (46%), Gaps = 12/160 (7%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHKSLENRS---PAHTWRFL-KSVG--IGKTPVSSVKDTDL 312
           YK  RN  N+  R AK  YF  S  + S   P H W  L K +G      P   ++D  +
Sbjct: 2   YKKCRNNLNKELRQAKYEYFSYSFSDNSSTNPQHRWHQLGKLLGRRYNSGPNCIMRDGAV 61

Query: 311 C---ALNKHFSLPPVSLSDSSKTATLLKISSL-SVPRIPI-FELSPVSVADVRNSFFSI- 150
               AL+  F+   V++++++        +S+   P + +   +SP +  ++ + F ++ 
Sbjct: 62  LTGQALSNAFNDFSVNITNAASCPINSTNTSIYQAPGVSMSMFMSPTTENEIISVFRNLK 121

Query: 149 SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFP 30
           +S A+ I+    K +  ++  +APILT I N    S  FP
Sbjct: 122 NSRALDINGFQIKPLKYVIDLLAPILTYILNLCLNSGVFP 161


>UniRef50_A7SZD3 Cluster: Predicted protein; n=4; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 257

 Score = 40.7 bits (91), Expect = 0.038
 Identities = 19/43 (44%), Positives = 24/43 (55%)
 Frame = -3

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 131 ATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 173


>UniRef50_Q4QQE9 Cluster: Endonuclease-reverse transcriptase; n=1;
           Schistosoma mansoni|Rep: Endonuclease-reverse
           transcriptase - Schistosoma mansoni (Blood fluke)
          Length = 940

 Score = 40.3 bits (90), Expect = 0.050
 Identities = 48/247 (19%), Positives = 86/247 (34%), Gaps = 7/247 (2%)
 Frame = -3

Query: 731 DLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPD 552
           D+  + +  ++ DW  I    +I    + F    + +   H P    +      PW + +
Sbjct: 254 DIPDIMKSASSVDWK-IDPESSIETAWDLFRNLYLKVTAPHIPWTTPKRPRNSPPWFSRE 312

Query: 551 IKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN--RSPAHT 378
           ++ L+              T+ + + Y+  RN C    R A++LY  K +      P   
Sbjct: 313 VRILLRKRRKMWDRFRLLGTDEAKSQYQKARNTCASTLRKARKLYEEKIVRESIECPKRL 372

Query: 377 WRFLKSVGIGKTPVSSV--KDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPI 204
           + ++      +  V S+    T    +   F    V     S   T+    S      P 
Sbjct: 373 YSYINQRTKRRRNVPSLWGDSTATSLVEDDFGKAQVFSKYFSDVYTIETPFSPVHENPPT 432

Query: 203 FELSPVSV--ADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNF 33
             L  V++   DV      +    + G D +  K++  +   V   L+  FN S T    
Sbjct: 433 QALDSVTIKELDVFGLLIKLDIGKSTGPDELHPKLLKELANFVVNPLSVCFNLSVTQGRL 492

Query: 32  PDSWKPA 12
           P  WK A
Sbjct: 493 PKDWKNA 499


>UniRef50_P22430 Cluster: Envelope glycoprotein precursor (Env
           polyprotein) [Contains: Surface protein (SU)
           (Glycoprotein 90) (gp90); Transmembrane protein (TM)
           (Glycoprotein 45) (gp45)]; n=1009; Equine infectious
           anemia virus|Rep: Envelope glycoprotein precursor (Env
           polyprotein) [Contains: Surface protein (SU)
           (Glycoprotein 90) (gp90); Transmembrane protein (TM)
           (Glycoprotein 45) (gp45)] - Equine infectious anemia
           virus (isolate P3.2-5) (EIAV)
          Length = 860

 Score = 39.9 bits (89), Expect = 0.066
 Identities = 31/131 (23%), Positives = 66/131 (50%), Gaps = 4/131 (3%)
 Frame = -3

Query: 455 RCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPV 276
           R N+  R+     ++ S+ N++   TW+ + + GI   P+SS  +T L    + F +  +
Sbjct: 393 RPNKRIRNQSFNQYNCSINNKTELETWKLVNTSGITPLPISSEANTGLIRHKRDFGISAI 452

Query: 275 SLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSI-SSTAVGIDNVCSK---M 108
             +  + TA     +S ++  + + E++   + +V+N  F + +ST  G+D +  +   +
Sbjct: 453 VAAIVAATAI---AASATMSYVALTEVN--KIMEVQNHTFEVENSTLNGMDLIEQQIKIL 507

Query: 107 IALILPTVAPI 75
            A+IL T A +
Sbjct: 508 YAMILQTHADV 518


>UniRef50_UPI0000E47329 Cluster: PREDICTED: similar to novel
           cholinergic receptor, nicotinic, alpha polypeptide
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to novel cholinergic receptor,
           nicotinic, alpha polypeptide protein -
           Strongylocentrotus purpuratus
          Length = 802

 Score = 39.5 bits (88), Expect = 0.087
 Identities = 47/247 (19%), Positives = 99/247 (40%), Gaps = 15/247 (6%)
 Frame = -3

Query: 707 VNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXX 528
           +   +WS +++  + ++   +F   + S  D+  P + VR+  +   W+TP IK+L+   
Sbjct: 109 ITRYEWSSVMDSISSDEQTEAFYAILNSQIDRFLPTKTVRMHCRDKKWITPVIKSLIKER 168

Query: 527 XXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIG 348
                         +  + + L N   +  R AK  Y++  ++    A+   + K + I 
Sbjct: 169 QAAFSGG-------NKELTRKLANCVKKEIRKAKHDYYNDRVKKHKKANPAEWYKQIKI- 220

Query: 347 KTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLK---------ISSLSVPRIPIFEL 195
              ++++K+      N + ++P V   D++  A  +          + ++    +P +  
Sbjct: 221 ---MTNMKNA-----NSYITVPGVDRDDTAVIANRINDFFKSVAEDVPAMDAENLPAYLP 272

Query: 194 SP-----VSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNF 33
            P     +   DV      +    AVG D + S++I      ++  L  IF+ S      
Sbjct: 273 DPSPPPRIQPWDVYQQLKKVKVGKAVGPDMIPSRIIKEFACELSIPLAHIFSTSLAEGVV 332

Query: 32  PDSWKPA 12
           P  WK A
Sbjct: 333 PKMWKRA 339


>UniRef50_UPI000069DFFC Cluster: UPI000069DFFC related cluster;
           n=36; Xenopus tropicalis|Rep: UPI000069DFFC UniRef100
           entry - Xenopus tropicalis
          Length = 924

 Score = 39.5 bits (88), Expect = 0.087
 Identities = 47/223 (21%), Positives = 89/223 (39%), Gaps = 6/223 (2%)
 Frame = -3

Query: 662 NDMVNSFNYKVISLFDQHAPVRRVRIKHKPA-PWLTPDIKTLMXXXXXXXXXXXRCPTEH 486
           N   + +   + +  ++ AP +   ++ KP  PW T   K+L            +   ++
Sbjct: 266 NQATSVYYSTLATALNELAPAKTKCMRPKPLQPWNTAHTKSLQKQSRTLERRWRKSRHDN 325

Query: 485 SLAIYKALRNRCNRLCRDAKRLYFHKSLENR--SPAHTWRFLKSVGIGKTPVSSVKDTDL 312
               YK L    N     AK++Y++  + N   +P   +    ++    +P  SV     
Sbjct: 326 YHVGYKFLMVCLNTALSQAKQVYYNTLVNNNKSNPRGLFSIFNALLHHPSPNESVISEHT 385

Query: 311 CALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSP---VSVADVRNSFFSISST 141
                 F    V  S  ++ +      +L++P+ P+   S    V+ ++V     S   T
Sbjct: 386 PQDFADFFKSKVD-SIRNQFSQPSDTGNLNLPKSPLSVFSSFNLVTESEVSQLLRSSPPT 444

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
              +D + S ++  + P + P LT +FN S TS  FP  +  A
Sbjct: 445 TCSLDPMPSSLLNSV-PALTPALTHLFNSSLTSGTFPSHFXQA 486


>UniRef50_Q868Q6 Cluster: Reverse transcriptase; n=3; Anopheles
           gambiae|Rep: Reverse transcriptase - Anopheles gambiae
           (African malaria mosquito)
          Length = 1248

 Score = 39.5 bits (88), Expect = 0.087
 Identities = 38/188 (20%), Positives = 72/188 (38%), Gaps = 1/188 (0%)
 Frame = -3

Query: 578 KPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSL-AIYKALRNRCNRLCRDAKRLYFHKSL 402
           +PA W TP I+ L              PT+  + A+ +  R+      R +K+ +F + L
Sbjct: 292 RPAYWCTPAIEELENECRIAEQRQLASPTDPDISALDRQARHALKTAIRASKKQFFDRML 351

Query: 401 ENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLS 222
           +      T + ++ V     P  + +D D   L    S+     SD S      +     
Sbjct: 352 QALHDDETGQCIRKVLYRLQPSRTAQDRDPVVLK---SVVSTMFSDHSPAEWPTEDKHEI 408

Query: 221 VPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTS 42
             R+P+ E++ + +  + +        A G+D V +  +A  +         ++      
Sbjct: 409 GNRVPLREVTDLELQIIASGMQP--RKAPGLDGVPNAALASAIKNYPGSFRQVYQECLDR 466

Query: 41  SNFPDSWK 18
           S FP+ WK
Sbjct: 467 SCFPEQWK 474


>UniRef50_Q9C443 Cluster: Adenylate cyclase; n=6; Dikarya|Rep:
            Adenylate cyclase - Cryptococcus neoformans var.
            neoformans
          Length = 2271

 Score = 39.5 bits (88), Expect = 0.087
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +1

Query: 109  ILEHTLSIPTAVDEMEKKELRTSATETGLNSKIGIRGTDRLEILSNVAVFDESLSDTGGR 288
            +++ TL IP+  DE E+K +RTS ++   N   GI  +D L  + N+A+FD  +    G+
Sbjct: 1528 LMDVTLRIPSLPDESEEKRVRTSFSDIN-NMAYGI--SDMLGSIDNLAMFDLVVPHFRGK 1584

Query: 289  E-KCLLRAHKSVSLTEETG 342
            E +CL      V+ T + G
Sbjct: 1585 ENECLFGMFGRVTTTLQGG 1603


>UniRef50_UPI00015B4963 Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 558

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 20/61 (32%), Positives = 30/61 (49%)
 Frame = -3

Query: 719 LRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTL 540
           L  D+   DWS      N++  V  F   +I  FD+  P      + +P+PWLT DI+ L
Sbjct: 265 LLSDLVRLDWSPFYRTPNVDAKVKLFTEILIGAFDKLDPYIVFTPRGRPSPWLTADIREL 324

Query: 539 M 537
           +
Sbjct: 325 I 325


>UniRef50_Q9U997 Cluster: Reverse transcriptase; n=1; Anopheles
           merus|Rep: Reverse transcriptase - Anopheles merus
           (Mosquito)
          Length = 329

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = -3

Query: 146 STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           ST+ G DN+ + ++     ++APIL  IFN S     +P+SWK A
Sbjct: 107 STSSGPDNIPAYILKHCRQSLAPILAKIFNDSLMRGTYPESWKHA 151


>UniRef50_UPI00015B461B Cluster: PREDICTED: similar to ORF2-encoded
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to ORF2-encoded protein - Nasonia vitripennis
          Length = 314

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 1/108 (0%)
 Frame = -3

Query: 338 VSSVKDTDLCALNKHF-SLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNS 162
           VS V+D+  C   ++F S+ PVSL+D         ++S+         +   ++    + 
Sbjct: 33  VSPVRDSFSC---RYFNSIDPVSLNDLLSNYNWSSMNSIESDLEGALHILNSNLNLTLDE 89

Query: 161 FFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
              +   A G D V  ++I + LP +   L  IFN SF S  F  +WK
Sbjct: 90  LAPLKK-ASGEDGVPQRVITMALPAIGEFLVKIFNSSFASGVFLGAWK 136


>UniRef50_Q9GP60 Cluster: Pol protein; n=1; Drosophila
           melanogaster|Rep: Pol protein - Drosophila melanogaster
           (Fruit fly)
          Length = 1227

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 51/229 (22%), Positives = 87/229 (37%), Gaps = 21/229 (9%)
 Frame = -3

Query: 635 KVISLFDQHAPVRRVRIKHKP-APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALR 459
           KVI     ++  +  R+ HK   PW   +++ L                + +L  YK   
Sbjct: 267 KVIRSAANYSIPQTKRVIHKAKVPWWNANLQQLRDQKQRLFSSYKANTNDTNLIRYKKAN 326

Query: 458 NRCNRLCRDAKRLYFHKSLENRSPAHT----WRFLKSV-GIGKTPVSSVKD-----TDLC 309
               +    AKR    K     SP  +    W  +K + GI  TP   +K      T   
Sbjct: 327 ALFKKAVLSAKRNSLEKFTSKISPVSSTKKVWSDIKRLAGIPPTPFKYIKSNSGTLTGSF 386

Query: 308 ALNKHFSLPPVSLS-DSSKTATLLKISS-LSVPRIPIFELSPVSVA--------DVRNSF 159
            + + F+L     S D + +A  +++ +   +    I  LSP + +        ++ NS 
Sbjct: 387 DIAEEFALSWSKYSSDQNFSAEYIRVKNRYLLEPYAIDSLSPSATSLDSNFTLLEIENSV 446

Query: 158 FSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
                 + G D V   M+  + P +   L DIFN   T+  +P +W+ A
Sbjct: 447 AKAKGKSPGADRVSYPMLKNLSPHLKTKLLDIFNQILTTGKYPHTWRSA 495


>UniRef50_A7RX06 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 194

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 20/68 (29%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
           R  + +D+  L  D+ N++     +  NIN++V  ++  + +L D+HAP++   +  +P 
Sbjct: 83  RKLRSVDIDQLSEDLLNSELFQN-QQVNINNLVIKYDNTLKALLDKHAPLKAKLVTIRPK 141

Query: 572 APWLTPDI 549
           A W TP+I
Sbjct: 142 AAWYTPEI 149


>UniRef50_Q17003 Cluster: Putative reverse transcriptase; n=29;
            Culicidae|Rep: Putative reverse transcriptase - Anopheles
            gambiae (African malaria mosquito)
          Length = 1049

 Score = 37.9 bits (84), Expect = 0.27
 Identities = 56/227 (24%), Positives = 88/227 (38%), Gaps = 10/227 (4%)
 Frame = -3

Query: 668  NINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTE 489
            ++++ V SF+  ++  F    PV+R   K  P PW    +K L                +
Sbjct: 375  SLDEAVCSFSSFMLQAFVVCVPVQRP--KPNP-PWADRTLKRLKRVKRAAYRHYQTRRCQ 431

Query: 488  HSLAIYKALRNRCNRLCRDAKRLYFHKSLEN--RSPAHTWRFLKS-VGIGKTPVS-SVKD 321
             S +IY    +      R   R Y  K   N  R P   WRF  S      TP S + K 
Sbjct: 432  RSRSIYFDTHSLYCSYNRFRYRRYLSKIQRNLCRWPDSFWRFYNSKTKSTHTPKSITYKG 491

Query: 320  TDLCALNKHFSLPPVSLSDSSKTAT----LLKISSLSVPRIPIFELSPVSVADVRNSFFS 153
                  N+  +L     +D    A      +  + ++ P   I   +P   +++  S  +
Sbjct: 492  ATSANTNEMCNLFADRFADCFSPAMNDTDTIDAALVNTPAGAINMSTPFIDSEIVLSALA 551

Query: 152  I--SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
                S A G D + S ++     TVAPIL  +FN S  +  FP +W+
Sbjct: 552  QLKPSFAPGPDGIPSTVLKRCQTTVAPILAKLFNASLANGYFPKAWR 598


>UniRef50_A7S962 Cluster: Predicted protein; n=7; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 584

 Score = 37.9 bits (84), Expect = 0.27
 Identities = 30/130 (23%), Positives = 54/130 (41%), Gaps = 1/130 (0%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           R+ +     AL R + + DWS +     + + M N+F   V +  D   P +   I    
Sbjct: 162 RDLRTSSKAALGRYLISIDWSLLFAPLSDCDQMWNTFIEVVSTGLDIIMPEKEYHICAAD 221

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
           APW+TP +K+++             P       ++ + NR  ++CR        K L+ +
Sbjct: 222 APWMTPGLKSIILKRQEAFKNHG--PESVQFKFFRNMVNRERKVCRSRFYDSKVKQLKGK 279

Query: 392 SPAHTWRFLK 363
           +P   W  +K
Sbjct: 280 NPKKWWDEVK 289


>UniRef50_UPI00015B4392 Cluster: PREDICTED: similar to ORF2-encoded
           protein; n=2; Nasonia vitripennis|Rep: PREDICTED:
           similar to ORF2-encoded protein - Nasonia vitripennis
          Length = 498

 Score = 37.5 bits (83), Expect = 0.35
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = -3

Query: 185 SVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFP-DSWKPAA 9
           ++++V  S  ++SS   G D V  ++I   LP +   + DIFN SF    FP   ++P A
Sbjct: 181 NISEVVISISNLSSQVRGFDGVPQEVIVKSLPAIGGFIVDIFNSSFARGVFPMGDFRPIA 240


>UniRef50_Q5TTM1 Cluster: ENSANGP00000026284; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000026284 - Anopheles gambiae
           str. PEST
          Length = 763

 Score = 37.5 bits (83), Expect = 0.35
 Identities = 52/256 (20%), Positives = 97/256 (37%), Gaps = 13/256 (5%)
 Frame = -3

Query: 746 NYKGIDLGALRRDVNNTD--WSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           NY  +DL  L R + + D  ++C  ++  I+D   +F   + S   +  PV+   I  + 
Sbjct: 144 NYARVDLPKLERLILSFDNSFNCS-DYSTIDDATEAFCEFMRSAICECTPVK---IPRRG 199

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN- 396
            PW    +  L                  S   Y  + +   R  R   R Y  ++  + 
Sbjct: 200 PPWADRTLNALKKEKRKAYSDQRAQRNSTSRLYYNRVHSLYRRYNRSCHRSYLKQTARSL 259

Query: 395 -RSPAHTWRFL--KSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDS--SKTATLLKIS 231
            + P   W ++  K    G   +        C+L +   L  +   D+  S+T     ++
Sbjct: 260 CKYPRRFWSYMDKKRKSAGLPSIKRYDGDSACSLPEMCKLFALRFKDNFASQTTGPEDVA 319

Query: 230 SLSVPRIPIFELSP----VSVADVRNSFFSI-SSTAVGIDNVCSKMIALILPTVAPILTD 66
             ++   P+  L P    ++V  + ++   + SS   G D + + ++      +AP L  
Sbjct: 320 D-ALSNTPVGALLPMLPFITVDTIISAIKRVKSSYTPGPDGIPAVILKWCASALAPSLMK 378

Query: 65  IFNFSFTSSNFPDSWK 18
           IF  S     FP +WK
Sbjct: 379 IFKESLRCGTFPATWK 394


>UniRef50_UPI0000E49F6D Cluster: PREDICTED: similar to ORF2-encoded
           protein; n=3; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to ORF2-encoded protein -
           Strongylocentrotus purpuratus
          Length = 733

 Score = 36.7 bits (81), Expect = 0.61
 Identities = 19/67 (28%), Positives = 36/67 (53%)
 Frame = -3

Query: 218 PRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSS 39
           PR  + +   VS++ VR    S+ S    +D + + ++  +L  + P +T +FN S +S 
Sbjct: 66  PRHELSDFCLVSLSQVRKLITSLPSKHCKLDPIPTWLLKEVLDELLPHITKLFNLSLSSG 125

Query: 38  NFPDSWK 18
             P+S+K
Sbjct: 126 IVPESFK 132


>UniRef50_UPI0000E49710 Cluster: PREDICTED: similar to
           endonuclease-reverse transcriptase; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease-reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 773

 Score = 36.7 bits (81), Expect = 0.61
 Identities = 44/205 (21%), Positives = 88/205 (42%), Gaps = 8/205 (3%)
 Frame = -3

Query: 602 VRRVRIKHKPAP-WLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAK 426
           + +V+ ++   P W+  D++  +           +  +E     Y   RN        AK
Sbjct: 106 IPKVKARNNQQPLWMNNDVRQAIKCKHKAWNRFQKSRSESDRVSYNIARNEATDKVNIAK 165

Query: 425 RLYFHK-SLENRS-PAHTWRFLKSVGIGKTPVSSVKDTD-LCALNKHFSLPPVSLSDSSK 255
           + +  K +LE +S P   WR+++S    K  +  ++  D   A +       ++L  +S 
Sbjct: 166 KSFERKLTLEIKSNPKSFWRYVQSKNKFKQGIGDLEKPDGTIASDDADKAETLNLFFASV 225

Query: 254 -TATLLKISSLSVPRIPIFELSPV--SVADVRNSFFSIS-STAVGIDNVCSKMIALILPT 87
            T   L +      RI   +L  V  +  +V+ +   +  S + G DN+ ++++  ++  
Sbjct: 226 FTKEDLSLVPALDLRIRDKQLDTVCFNYENVKKAIMRLDQSKSPGPDNIHNRILKELVDD 285

Query: 86  VAPILTDIFNFSFTSSNFPDSWKPA 12
           ++  L  +FN S +S    DSWK A
Sbjct: 286 ISRPLAHLFNKSMSSGVVCDSWKEA 310


>UniRef50_A7T2B1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 445

 Score = 36.7 bits (81), Expect = 0.61
 Identities = 19/72 (26%), Positives = 37/72 (51%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +RN K  +     RD+    W  I+   + N M + +    +++ D+HAPV+  + K   
Sbjct: 357 IRNMKKFNQELFARDLLAQPWEQIVLCPDANKMWDFWRDLFLNVLDKHAPVQLKKKKAFS 416

Query: 572 APWLTPDIKTLM 537
            PW+T +++ L+
Sbjct: 417 DPWVTQELRELI 428


>UniRef50_A0J797 Cluster: Putative uncharacterized protein
           precursor; n=2; cellular organisms|Rep: Putative
           uncharacterized protein precursor - Shewanella woodyi
           ATCC 51908
          Length = 1355

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 34/114 (29%), Positives = 51/114 (44%), Gaps = 2/114 (1%)
 Frame = -3

Query: 347 KTPVSSVKD-TDLCA-LNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVAD 174
           KT +SS  + T++ A L+    L P +L   S   T L IS+ +     IF+    S   
Sbjct: 641 KTEISSYSEFTEVTAHLSDQLELSPTALDKLSSETTTLLISNSNA----IFDRYN-SKQS 695

Query: 173 VRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           V+ S    S           K    I PT+    TD F++S  ++NF D+W P+
Sbjct: 696 VQQSSGKASQPLSYQAQSQQKSTGSIKPTIVNYGTDHFDYSLEATNFLDNWLPS 749


>UniRef50_A7RXU9 Cluster: Predicted protein; n=4; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 89

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 17/45 (37%), Positives = 23/45 (51%)
 Frame = -3

Query: 146 STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           S A G+D + +K++ L  P +   L  I N S   S FP  WK A
Sbjct: 11  SKATGLDGISAKLLKLAGPAIDMPLCKIINLSIKQSIFPTIWKQA 55


>UniRef50_Q2GDV9 Cluster: Acyl carrier protein; n=1; Neorickettsia
           sennetsu str. Miyayama|Rep: Acyl carrier protein -
           Neorickettsia sennetsu (strain Miyayama)
          Length = 144

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +1

Query: 76  IGATVGRIRAIILEHTLSIPT-AVDEMEKKELRTSATETGLNSKIGIRGTDRLEILSNV 249
           +GAT  ++R I+LEHT+ +       +  ++      ET L+S++GI   D  EI+  V
Sbjct: 1   MGATQEKLRKIVLEHTVKVSVMGALNLSDEKYDEIKLETDLSSELGIDSLDAAEIIMRV 59


>UniRef50_Q6IFU2 Cluster: Pol polyprotein; n=6; Schistosoma|Rep: Pol
           polyprotein - Schistosoma mansoni (Blood fluke)
          Length = 1227

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRI-KH 579
           R+YK  D   LR  +  +DW      +++ D +N F   V S  D  AP++  RI KH
Sbjct: 513 RDYKHADWDLLRSLIKLSDWDEFFSCNSLTDAINIFYLIVNSCLDSCAPIKIYRISKH 570


>UniRef50_Q0U0Y9 Cluster: Predicted protein; n=1; Phaeosphaeria
           nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 721

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 4/90 (4%)
 Frame = -3

Query: 341 PVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNS 162
           P +S  D    +++  FSLP  S SDSS +      S+ S P       +P S   +  S
Sbjct: 435 PSTSTTDAVSYSVSSTFSLPEPSSSDSSSSVYTPSPSTSSSPTTSSETPAPSSADTISYS 494

Query: 161 FFSISSTAV----GIDNVCSKMIALILPTV 84
           FFS ++T +     ID+  S   ++ L TV
Sbjct: 495 FFSTTTTKIDSSSSIDSSRSSETSVFLSTV 524


>UniRef50_A7SPE1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 762

 Score = 35.1 bits (77), Expect = 1.9
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHK 576
           R+YK  +     RD+    +  +    N ++ VN+FN       + HAP++R++IK +
Sbjct: 552 RSYKNYNPEHFLRDLEYVPFLIVNVFENFDNQVNAFNDLFSDTLELHAPLKRIKIKSR 609


>UniRef50_UPI0000E48EFD Cluster: PREDICTED: similar to reverse
           transcriptase-like protein, partial; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           reverse transcriptase-like protein, partial -
           Strongylocentrotus purpuratus
          Length = 664

 Score = 34.7 bits (76), Expect = 2.5
 Identities = 26/98 (26%), Positives = 42/98 (42%)
 Frame = -3

Query: 311 CALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVG 132
           CAL  H     +  +DSS +     +   S P   + +  PV+ +DV     S    A  
Sbjct: 162 CALMLHVCQLEMD-TDSSSSLPYNDLRKTSKPSCSLEKFLPVTQSDVARIIKSSKIKACP 220

Query: 131 IDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           +D + + +    +  + P +TDI N S  +  FP S K
Sbjct: 221 LDPLPAMVFKNCVEVLLPAITDIINQSLQTGIFPASLK 258


>UniRef50_Q4QQE6 Cluster: Endonuclease-reverse transcriptase; n=2;
           Schistosoma|Rep: Endonuclease-reverse transcriptase -
           Schistosoma mansoni (Blood fluke)
          Length = 831

 Score = 34.7 bits (76), Expect = 2.5
 Identities = 15/56 (26%), Positives = 28/56 (50%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIK 582
           RNY+ +D       + +TDW      +N + + N F + + S+ ++ AP+   R K
Sbjct: 230 RNYRKVDWNNFHNYLRSTDWGTYFTANNTDTLTNIFYHNIESIMNKIAPLEYWRPK 285


>UniRef50_UPI0000E49018 Cluster: PREDICTED: similar to scavenger
           receptor cysteine-rich protein type 12 precursor; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           scavenger receptor cysteine-rich protein type 12
           precursor - Strongylocentrotus purpuratus
          Length = 428

 Score = 34.3 bits (75), Expect = 3.3
 Identities = 17/69 (24%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHK-P 573
           RN+KG+D    ++ V+    S  +E+ ++++ V  +   +  + D  AP+R   +K +  
Sbjct: 317 RNFKGMDRDLFQQRVSEALSSIDVENIDLSNSVEEYERSLCDILDALAPLRTRCLKQREK 376

Query: 572 APWLTPDIK 546
           +PW   +I+
Sbjct: 377 SPWYNEEIR 385


>UniRef50_A5DNX6 Cluster: Predicted protein; n=1; Pichia
           guilliermondii|Rep: Predicted protein - Pichia
           guilliermondii (Yeast) (Candida guilliermondii)
          Length = 891

 Score = 34.3 bits (75), Expect = 3.3
 Identities = 34/124 (27%), Positives = 51/124 (41%), Gaps = 1/124 (0%)
 Frame = -3

Query: 407 SLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISS 228
           ++EN     T  F  +  I   PVSSV D + C      S+ P      ++T +    SS
Sbjct: 29  AIENDDDCETLSFTGTSSITAPPVSSVSDGEDC----ETSVEPSDEDCETETVS----SS 80

Query: 227 LSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTV-APILTDIFNFS 51
              P      L PVS     +    +SS+ VG   V S  +      V + I ++I + +
Sbjct: 81  SEEPECDELSLVPVSSTSDEDDCLEVSSSTVGSSVVSSSSVVFTSSEVSSEISSEITSSA 140

Query: 50  FTSS 39
            TSS
Sbjct: 141 LTSS 144


>UniRef50_Q95SX7 Cluster: Probable RNA-directed DNA polymerase from
           transposon BS; n=7; melanogaster subgroup|Rep: Probable
           RNA-directed DNA polymerase from transposon BS -
           Drosophila melanogaster (Fruit fly)
          Length = 906

 Score = 34.3 bits (75), Expect = 3.3
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = -3

Query: 236 ISSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIF 60
           + SL  P      + P+ V ++  +  S+    + GIDNVC+  +  +       L  I+
Sbjct: 421 LDSLETPLQMSLPIKPIRVEEIVEAIKSLPLKKSPGIDNVCNATLKALPVRAILYLALIY 480

Query: 59  NFSFTSSNFPDSWKPAA 9
           N       FP  WK AA
Sbjct: 481 NAILRVQFFPKQWKMAA 497


>UniRef50_Q6V7W5 Cluster: Hox protein Dfd; n=2; Digenea|Rep: Hox
           protein Dfd - Schistosoma mansoni (Blood fluke)
          Length = 543

 Score = 33.9 bits (74), Expect = 4.3
 Identities = 13/32 (40%), Positives = 24/32 (75%)
 Frame = -3

Query: 305 LNKHFSLPPVSLSDSSKTATLLKISSLSVPRI 210
           LN H + PP+S++ +S+TAT+L I S ++ ++
Sbjct: 131 LNLHETSPPISITQTSQTATMLDIQSSTIDQV 162


>UniRef50_A7T9U6 Cluster: Predicted protein; n=6; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 175

 Score = 33.9 bits (74), Expect = 4.3
 Identities = 40/171 (23%), Positives = 81/171 (47%), Gaps = 17/171 (9%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHK--SLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALN 300
           YK  RN+ ++L R +K+ Y+    +  +++  + W  +K + I   P  S + + L   N
Sbjct: 1   YKCYRNKISQLIRTSKQNYYQNYFATNSKNIKNIWSGIKEL-ITTKPTCSNQPSKLIINN 59

Query: 299 KHFSLP-PVSLSDSSKTATL-----LKI--------SSLSVPRIPIFELSPVSVADVRNS 162
           K    P  ++++ ++  AT+      KI        S L  P +  F LSPV+ +++ + 
Sbjct: 60  KTVKDPKAIAIAFNNFFATIGSQLASKIPHVDRSPESFLGPPLVNSFVLSPVTASEIEDI 119

Query: 161 FFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
              ++ S A G  ++   ++  +   ++  L  ++N SF++   PD  K A
Sbjct: 120 ISGLNPSKASGPYSIPVCLLKFLKFYLSVPLEILYNHSFSNGCVPDQLKIA 170


>UniRef50_A7EJQ0 Cluster: Putative uncharacterized protein; n=2;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 785

 Score = 33.9 bits (74), Expect = 4.3
 Identities = 17/71 (23%), Positives = 34/71 (47%)
 Frame = -3

Query: 224 SVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFT 45
           S  R P+     ++  +V      +SST+ G+D    +++     +V   + +I++    
Sbjct: 287 STQRGPLPWKRRITKEEVEKHVIDVSSTSPGVDRATVRLLKACWDSVKAPIHEIYDSCLA 346

Query: 44  SSNFPDSWKPA 12
            S +PD+WK A
Sbjct: 347 LSYYPDAWKLA 357


>UniRef50_A3QGQ9 Cluster: PAS/PAC sensor signal transduction
           histidine kinase precursor; n=2; Shewanella|Rep: PAS/PAC
           sensor signal transduction histidine kinase precursor -
           Shewanella loihica (strain BAA-1088 / PV-4)
          Length = 1226

 Score = 33.5 bits (73), Expect = 5.7
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = -3

Query: 644 FNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTL 540
           F  +   +  Q++P+RR++I  +PAPW +P   TL
Sbjct: 748 FEIRAKDINQQYSPIRRLKIMLEPAPWQSPFAYTL 782


>UniRef50_Q18LA9 Cluster: Pol protein; n=8; melanogaster
           subgroup|Rep: Pol protein - Drosophila melanogaster
           (Fruit fly)
          Length = 1103

 Score = 33.5 bits (73), Expect = 5.7
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = -3

Query: 191 PVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPI-LTDIFNFSFTSSNFPDSWK 18
           PV++A++     S+    A G DN+ +K I + LPT A I L  I+N    + +FP+ WK
Sbjct: 483 PVTLAELNGLINSLELKKAPGTDNLNNKTI-INLPTKARIYLILIYNNILRTGHFPNKWK 541

Query: 17  PAA 9
            A+
Sbjct: 542 HAS 544


>UniRef50_A7TBQ2 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 75

 Score = 33.5 bits (73), Expect = 5.7
 Identities = 16/43 (37%), Positives = 22/43 (51%)
 Frame = -3

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           A G+D +    +  + P +   LT IFN S +S  F D WK A
Sbjct: 9   AAGLDELNGFFLKSVAPEIFRSLTKIFNLSVSSCVFSDPWKRA 51


>UniRef50_UPI0000E45ED4 Cluster: PREDICTED: similar to SJCHGC01615
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to SJCHGC01615 protein -
           Strongylocentrotus purpuratus
          Length = 415

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -3

Query: 218 PRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSS 39
           P + +F+  PVS ++++      ++ +  +D + + ++   +    PI++ I N S TS 
Sbjct: 40  PSLTVFD--PVSDSEIKKIVRRAATKSCNLDPLPTWLLKDCVKIFVPIMSQIVNSSITSG 97

Query: 38  NFPDSWKPA 12
            FPD  K A
Sbjct: 98  VFPDKLKEA 106


>UniRef50_Q903Y5 Cluster: Glycoprotein gp90; n=81; Equine infectious
           anemia virus|Rep: Glycoprotein gp90 - Equine infectious
           anemia virus
          Length = 423

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 15/48 (31%), Positives = 27/48 (56%)
 Frame = -3

Query: 455 RCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDL 312
           R N+  R+     ++ S+ N++   TW+ +K+ GI   P+SS  +T L
Sbjct: 371 RPNKRIRNQSFNQYNCSINNKTELETWKLVKTSGITPLPISSEANTGL 418


>UniRef50_Q5KTL8 Cluster: Putative uncharacterized protein; n=1;
           Bombyx mori|Rep: Putative uncharacterized protein -
           Bombyx mori (Silk moth)
          Length = 173

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 14/50 (28%), Positives = 25/50 (50%)
 Frame = -3

Query: 746 NYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVR 597
           N++  D+  L       DWS I+   ++N  +N+F  K+ S+ D   P +
Sbjct: 124 NFRKADINVLYASFAEIDWSDIVSETHVNIALNTFYNKLYSIIDYCVPTK 173


>UniRef50_Q5B9Y7 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 457

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 25/86 (29%), Positives = 38/86 (44%)
 Frame = -3

Query: 278 VSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIAL 99
           VS  +S     +LK  S++ PRI  FE+  + V D++N+F               K +AL
Sbjct: 384 VSAGNSIFNNYMLKTLSVTAPRISSFEILYMGVTDLKNAFH-------------GKDLAL 430

Query: 98  ILPTVAPILTDIFNFSFTSSNFPDSW 21
           I       + D+F F+      P SW
Sbjct: 431 IRQAYMVGIKDVFAFALAGPASPSSW 456


>UniRef50_UPI00015B4820 Cluster: PREDICTED: similar to pol-like
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to pol-like protein - Nasonia vitripennis
          Length = 1050

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = -3

Query: 143 TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           +A GID +  + +  +      IL DI+N  FTS+++P+ WK
Sbjct: 502 SAPGIDGIDYECLFNLPLKYKLILLDIYNEMFTSNSYPEQWK 543


>UniRef50_UPI0000E47D32 Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase, partial; n=3;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase, partial -
           Strongylocentrotus purpuratus
          Length = 913

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = -3

Query: 173 VRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           V+    +I+ T A+G D + ++ + +    +APIL  IF  S  S + P  W+ A
Sbjct: 468 VKKLLLNINLTKAIGPDQIQNQALKIAAEELAPILQFIFQLSLDSGDLPLDWRKA 522


>UniRef50_UPI0000E46FD3 Cluster: PREDICTED: hypothetical protein,
           partial; n=4; Strongylocentrotus purpuratus|Rep:
           PREDICTED: hypothetical protein, partial -
           Strongylocentrotus purpuratus
          Length = 517

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
           RNY+ ID      D+++          ++NDM+ S    V  + +QH P    R K +P 
Sbjct: 123 RNYRQIDSEKFLADLSSR--FADFPESDVNDMLTSLYGAVQGVLNQHCPETTRRRKQRPC 180

Query: 572 APW 564
           APW
Sbjct: 181 APW 183


>UniRef50_UPI00015A5DF8 Cluster: UPI00015A5DF8 related cluster; n=1;
           Danio rerio|Rep: UPI00015A5DF8 UniRef100 entry - Danio
           rerio
          Length = 1024

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 14/63 (22%), Positives = 29/63 (46%), Gaps = 1/63 (1%)
 Frame = -3

Query: 197 LSPVSVADVRNSFFSISSTAV-GIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
           L+ +++ ++ ++   + +    G D   S+M     P + P+L   FN+       P SW
Sbjct: 401 LTEITIEELDSAISKLKANKTPGTDGYPSEMFKTFKPQITPMLLKCFNYVLRGGEIPQSW 460

Query: 20  KPA 12
           + A
Sbjct: 461 QEA 463


>UniRef50_Q52045 Cluster: Putative uncharacterized protein; n=1;
           Plasmid pHV2|Rep: Putative uncharacterized protein -
           Plasmid pHV2
          Length = 808

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 4/83 (4%)
 Frame = +1

Query: 64  ISVSIGATVGRIRAIILEHTLSIPTAVDEMEK----KELRTSATETGLNSKIGIRGTDRL 231
           ++V I  TVG   +  + ++ ++ +A  + ++    + L     E GL  K G RG  R+
Sbjct: 220 LAVEILRTVGETESGHMAYS-ALQSAFSQYDRTTVSRRLNEKLIEYGLCEKYGARGNLRI 278

Query: 232 EILSNVAVFDESLSDTGGREKCL 300
           EIL   A++ E L+    R+K L
Sbjct: 279 EILDKGALYLEELAKEKERQKAL 301


>UniRef50_A3UQC1 Cluster: Putative uncharacterized protein; n=1;
           Vibrio splendidus 12B01|Rep: Putative uncharacterized
           protein - Vibrio splendidus 12B01
          Length = 596

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 26/104 (25%), Positives = 43/104 (41%), Gaps = 1/104 (0%)
 Frame = -3

Query: 353 IGKTPVSSVKDTD-LCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVA 177
           IG  P+ +V+  D L    +  S+P  S  +     + L      +  IP F    V   
Sbjct: 227 IGAIPLPNVQGWDYLAKTGETTSIPTESFVEGRLNLSALLNDEFGISDIPCFSSFLVESR 286

Query: 176 DVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFT 45
             R+   S++   VG  ++CS  IA    T +  +  +FN  +T
Sbjct: 287 ASRSIDASLADFVVGSFSLCSISIAATCNTTSFTVDGMFNIDYT 330


>UniRef50_A1KVC9 Cluster: Putative uncharacterized protein; n=4;
           Neisseria|Rep: Putative uncharacterized protein -
           Neisseria meningitidis serogroup C / serotype 2a (strain
           ATCC 700532 /FAM18)
          Length = 585

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 2/72 (2%)
 Frame = -3

Query: 449 NRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCAL--NKHFSLPPV 276
           NRL  D K++   +     SPA   ++L  + +G      ++ TD  AL  ++H SLPP 
Sbjct: 195 NRLVSDIKKICETELAVFSSPAPFQKYLFLLHVGDHIYGGLEHTDSTALLADRH-SLPPY 253

Query: 275 SLSDSSKTATLL 240
            ++D+  T T L
Sbjct: 254 GMTDADDTYTTL 265


>UniRef50_Q7XM61 Cluster: OSJNBb0020O11.11 protein; n=1; Oryza
           sativa (japonica cultivar-group)|Rep: OSJNBb0020O11.11
           protein - Oryza sativa subsp. japonica (Rice)
          Length = 377

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +2

Query: 416 SKVF*HLCTNGCTGCAVLCIWP 481
           S+VF H C+ GC GC++   WP
Sbjct: 42  SRVFIHFCSRGCWGCSLRWRWP 63


>UniRef50_Q7M4J4 Cluster: RNA-directed DNA polymerase (EC 2.7.7.49)
           homolog; n=3; Bombyx mori|Rep: RNA-directed DNA
           polymerase (EC 2.7.7.49) homolog - Bombyx mori (Silk
           moth)
          Length = 1051

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 16/61 (26%), Positives = 27/61 (44%)
 Frame = -3

Query: 200 ELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
           +  P+S   +R    S+ +TA GID + +++I   LP        ++        FP  W
Sbjct: 447 DADPLSKDSLRAIIGSLKNTAPGIDGLTARIIKKALPAAEAEFVAVYARCVVEGTFPPVW 506

Query: 20  K 18
           K
Sbjct: 507 K 507


>UniRef50_A7T3E1 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 127

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 1/62 (1%)
 Frame = -3

Query: 200 ELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDS 24
           E   +SV  VR +  S+    A G DN+ S ++ +    +AP L  +FN S      P  
Sbjct: 2   EAIQLSVEGVRAALASVDPRKARGTDNIPSAVLKICADELAPSLCVLFNKSLELGKLPVE 61

Query: 23  WK 18
           WK
Sbjct: 62  WK 63


>UniRef50_A7RTE3 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 957

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 15/53 (28%), Positives = 26/53 (49%)
 Frame = -3

Query: 176 DVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           DVR      S  +  +D + + ++   L  + P++T + N S  S +F D WK
Sbjct: 671 DVRALIDQGSKKSCPLDPMPTSLVFQCLDELIPVITSMINLSLQSGSFADEWK 723


>UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1;
           Pneumocystis carinii|Rep: Eukaryotic release factor 3 -
           Pneumocystis carinii
          Length = 629

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 2/99 (2%)
 Frame = +1

Query: 1   GSAAAGFQESGKLLEVKEKLKISVSIGATVGRIRAIILEHTLSIPTAVDEMEKKELRTSA 180
           GSA +G + S K++ V +  K+S   G+ VGR    + +    +P+   +ME   L  S 
Sbjct: 105 GSATSGQRTSAKVIRVDDAPKVSGLDGSVVGRNGNRVNKVDKRVPSM--DMENLSLAASK 162

Query: 181 TETGLNSKIGIRGTDRLEILSNV--AVFDESLSDTGGRE 291
            E    S  G      L+I S     + +E L D  G+E
Sbjct: 163 QEKNHVSVTGDEERKDLDIASQFQEEIDEEVLQDIYGKE 201


>UniRef50_Q12019 Cluster: Midasin; n=4; Saccharomycetaceae|Rep:
            Midasin - Saccharomyces cerevisiae (Baker's yeast)
          Length = 4910

 Score = 32.7 bits (71), Expect = 10.0
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 1/65 (1%)
 Frame = -3

Query: 332  SVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFEL-SPVSVADVRNSFF 156
            +V ++ L A+N ++ L  V  S+S KT T+  ++S+  PR+ +F + S +   D+   + 
Sbjct: 2035 AVYESVLKAINNNWPLVLVGPSNSGKTETIRFLASILGPRVDVFSMNSDIDSMDILGGYE 2094

Query: 155  SISST 141
             +  T
Sbjct: 2095 QVDLT 2099


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 739,835,611
Number of Sequences: 1657284
Number of extensions: 14685760
Number of successful extensions: 39374
Number of sequences better than 10.0: 78
Number of HSP's better than 10.0 without gapping: 37874
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39339
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 62146450145
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).