SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0034
         (840 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2PQU4 Cluster: Putative paralytic peptide-binding prot...   512   e-144
UniRef50_Q76IB6 Cluster: Growth blocking peptide binding protein...   217   4e-55
UniRef50_P19616 Cluster: Microvitellogenin precursor; n=3; Mandu...   180   4e-44
UniRef50_Q00802 Cluster: Low molecular mass 30 kDa lipoprotein 1...   177   3e-43
UniRef50_P09335 Cluster: Low molecular 30 kDa lipoprotein PBMHP-...   161   3e-38
UniRef50_P09334 Cluster: Low molecular 30 kDa lipoprotein PBMHP-...   143   4e-33
UniRef50_Q75RW3 Cluster: BmLSP-T; n=2; Bombyx mori|Rep: BmLSP-T ...   137   4e-31
UniRef50_UPI0000E48EFF Cluster: PREDICTED: hypothetical protein,...    41   0.034
UniRef50_Q6ZMV0 Cluster: CDNA FLJ16652 fis, clone TESTI4036767; ...    41   0.045
UniRef50_Q3D424 Cluster: Cell wall surface anchor family protein...    40   0.078
UniRef50_UPI0000499DE2 Cluster: hypothetical protein 1.t00040; n...    40   0.10 
UniRef50_UPI0000DA32FD Cluster: PREDICTED: hypothetical protein;...    39   0.14 
UniRef50_Q6NWH9 Cluster: Zgc:85700; n=2; Danio rerio|Rep: Zgc:85...    39   0.18 
UniRef50_Q5APQ2 Cluster: Putative uncharacterized protein; n=3; ...    38   0.24 
UniRef50_Q980D5 Cluster: Putative uncharacterized protein; n=1; ...    38   0.24 
UniRef50_Q9VT37 Cluster: CG16707-PC, isoform C; n=6; Diptera|Rep...    38   0.31 
UniRef50_UPI0000DA3216 Cluster: PREDICTED: hypothetical protein;...    36   0.96 
UniRef50_Q6L473 Cluster: Putative uncharacterized protein OSJNBa...    36   0.96 
UniRef50_Q7RGR0 Cluster: Asparagine-rich protein, putative; n=3;...    36   0.96 
UniRef50_Q7SH96 Cluster: Predicted protein; n=1; Neurospora cras...    36   0.96 
UniRef50_Q60EQ9 Cluster: Putative uncharacterized protein OJ1280...    36   1.3  
UniRef50_Q6ZUK6 Cluster: CDNA FLJ43617 fis, clone SPLEN2016863; ...    36   1.3  
UniRef50_UPI0000DB700C Cluster: PREDICTED: hypothetical protein;...    36   1.7  
UniRef50_Q7YZI0 Cluster: MBCTL1; n=3; root|Rep: MBCTL1 - Monosig...    36   1.7  
UniRef50_Q2VMT1 Cluster: Phenylalanine ammonia lyase; n=1; Rhodo...    36   1.7  
UniRef50_Q8TFG9 Cluster: Uncharacterized serine/threonine-rich p...    36   1.7  
UniRef50_Q12215 Cluster: Cell wall integrity and stress response...    36   1.7  
UniRef50_Q8N9R0 Cluster: Putative uncharacterized protein C16orf...    35   2.2  
UniRef50_Q9XA04 Cluster: Putative serine/threonine protein kinas...    35   2.9  
UniRef50_Q86AK1 Cluster: Similar to Delayed Anaerobic Gene; Dan4...    35   2.9  
UniRef50_Q4J9N9 Cluster: Conserved T+S rich domain protein; n=1;...    35   2.9  
UniRef50_UPI0000D8A0A1 Cluster: hypothetical protein E1126G04.tm...    34   3.9  
UniRef50_Q8EWQ9 Cluster: Putative uncharacterized protein MYPE14...    34   3.9  
UniRef50_Q1Q4M6 Cluster: Similar to chromosomal condensation reg...    34   3.9  
UniRef50_A4J9J1 Cluster: ABC transporter related; n=3; Clostridi...    34   3.9  
UniRef50_Q626F7 Cluster: Putative uncharacterized protein CBG009...    34   3.9  
UniRef50_P14328 Cluster: Spore coat protein SP96; n=3; Dictyoste...    34   3.9  
UniRef50_Q9XZT3 Cluster: EG:80H7.11 protein; n=3; Drosophila mel...    34   5.1  
UniRef50_Q5CFZ6 Cluster: Putative uncharacterized protein; n=3; ...    34   5.1  
UniRef50_Q550Q0 Cluster: F-Box A protein; n=4; Dictyostelium dis...    34   5.1  
UniRef50_UPI00015C62FA Cluster: hypothetical protein CKO_03758; ...    33   6.8  
UniRef50_UPI0000F2C566 Cluster: PREDICTED: hypothetical protein;...    33   6.8  
UniRef50_UPI0000F2BCED Cluster: PREDICTED: hypothetical protein;...    33   6.8  
UniRef50_UPI0000E48EBC Cluster: PREDICTED: hypothetical protein;...    33   6.8  
UniRef50_Q6FW57 Cluster: Candida glabrata strain CBS138 chromoso...    33   6.8  
UniRef50_Q6CTJ9 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    33   6.8  
UniRef50_Q07283 Cluster: Trichohyalin; n=9; Eukaryota|Rep: Trich...    33   6.8  
UniRef50_UPI00015B625F Cluster: PREDICTED: similar to CG18076-PB...    33   8.9  
UniRef50_UPI0000E25AAE Cluster: PREDICTED: hypothetical protein;...    33   8.9  
UniRef50_UPI00005A28DE Cluster: PREDICTED: hypothetical protein ...    33   8.9  
UniRef50_Q3W7V4 Cluster: Putative uncharacterized protein; n=1; ...    33   8.9  
UniRef50_Q8WR08 Cluster: Dystroglycan type I; n=9; Diptera|Rep: ...    33   8.9  
UniRef50_Q8IMS9 Cluster: CG31439-PA; n=3; Eukaryota|Rep: CG31439...    33   8.9  
UniRef50_Q54IY4 Cluster: Putative uncharacterized protein; n=1; ...    33   8.9  
UniRef50_Q5KD42 Cluster: Putative uncharacterized protein; n=1; ...    33   8.9  
UniRef50_Q4PEH1 Cluster: Putative uncharacterized protein; n=1; ...    33   8.9  
UniRef50_P53832 Cluster: Cell wall integrity and stress response...    33   8.9  

>UniRef50_Q2PQU4 Cluster: Putative paralytic peptide-binding
           protein; n=1; Bombyx mori|Rep: Putative paralytic
           peptide-binding protein - Bombyx mori (Silk moth)
          Length = 436

 Score =  512 bits (1262), Expect = e-144
 Identities = 237/269 (88%), Positives = 243/269 (90%)
 Frame = -1

Query: 837 ERELGKNGLYYGAGYELPADLKTQTAFSTKMVFADATSINNHLYNLVTGGDYINAVKTVR 658
           ERELGK GLYYGAGYELPADLKTQT FSTKMVFADA SIN+HLYNLVTGGDYINAVKTVR
Sbjct: 168 ERELGKKGLYYGAGYELPADLKTQTEFSTKMVFADARSINDHLYNLVTGGDYINAVKTVR 227

Query: 657 SLVDNQGSDVCRDVVSRLVSQGIKNTMSFAYKLWHEGHKDIVEDYFPSEFXXXXXXXXXX 478
           SL DNQGS VCRDVVSRLVSQGIKN MSFAYKLWHEGHKDIVEDYFPSEF          
Sbjct: 228 SLDDNQGSGVCRDVVSRLVSQGIKNAMSFAYKLWHEGHKDIVEDYFPSEFQLILDQKRIK 287

Query: 477 XIGKHYNQALKLDANVGEYNDRLTWGDGKDYTSHHVSWQLISLWEDNNVIFKILNTEYEM 298
            IG HYNQALKLDANV  Y DRLTWGDGKDYTS+ VSW+LISLWE+NNVIFKILNTE+EM
Sbjct: 288 LIGNHYNQALKLDANVDRYKDRLTWGDGKDYTSYRVSWRLISLWENNNVIFKILNTEHEM 347

Query: 297 YLKLDVNVDSYGDRKTWGSNGSSEKRHTWSLYPVKVGDQQLFLIENREYRQGLKLDANVD 118
           YLKLDVNVD YGDRKTWGSN SSEKRHTW LYPVKVGDQQLFLIENREYRQGLKLDANVD
Sbjct: 348 YLKLDVNVDRYGDRKTWGSNDSSEKRHTWYLYPVKVGDQQLFLIENREYRQGLKLDANVD 407

Query: 117 SYGDRLVWGSNGTVADNPEYYGFIIQPWQ 31
            YGDRLVWG+NGTVADNPEYYGFIIQPWQ
Sbjct: 408 RYGDRLVWGNNGTVADNPEYYGFIIQPWQ 436


>UniRef50_Q76IB6 Cluster: Growth blocking peptide binding protein;
           n=1; Mythimna separata|Rep: Growth blocking peptide
           binding protein - Pseudaletia separata (Oriental
           armyworm) (Mythimna separata)
          Length = 430

 Score =  217 bits (529), Expect = 4e-55
 Identities = 111/270 (41%), Positives = 150/270 (55%), Gaps = 4/270 (1%)
 Frame = -1

Query: 831 ELGKNGLYYGAGYELPADLKTQTAFSTKMVFADATSINNHLYNLVTGGDYINAVKTVRSL 652
           EL K GL       LP +L+  T +++ + F D  +    +YN V  GDY  AV   +S 
Sbjct: 161 ELRKKGLTPSPNAALPRELQGLTYYNSHVAFLDNHNFEEEVYNSVINGDYDAAVNMAQSY 220

Query: 651 VDNQGSDVCRDVVSRLVSQGIKNTMSFAYKLWHEGHKDIVEDYFPSEFXXXXXXXXXXXI 472
                S+    +V+RL++   +  MSFAYKLWH G K+IV ++FP  F           +
Sbjct: 221 GVASNSEFTNRIVTRLMTAFPRKLMSFAYKLWHGGAKEIVRNHFPKAFQHIFNEDAVTIV 280

Query: 471 GKHYNQALKLDANVGEYNDRLTWGDGKD--YTSHHVSWQLISLWEDNNVIFKILNTEYEM 298
            K Y Q LKLD N    NDRL WGD      TS  +SW+++ +W  + + FK+ N    M
Sbjct: 281 NKQYQQPLKLDVNTDSMNDRLAWGDHNQCKITSERLSWKILPMWNRDGLTFKLYNVHRNM 340

Query: 297 YLKLDVNVDSYGDRKTWGSNGSSEKRHTWSLYPV--KVGDQQLFLIENREYRQGLKLDAN 124
           YLKLD +VDS GDR+ WGSN S+E RH + L P+        +F I N +Y QGLKLDA+
Sbjct: 341 YLKLDASVDSMGDRQAWGSNNSNEDRHRYYLEPMISPHNGTLVFFIINYKYGQGLKLDAS 400

Query: 123 VDSYGDRLVWGSNGTVADNPEYYGFIIQPW 34
            D  GDRL+WG NGTV +  E + +II  W
Sbjct: 401 TDDIGDRLLWGHNGTVYNEYERFRWIISAW 430


>UniRef50_P19616 Cluster: Microvitellogenin precursor; n=3; Manduca
           sexta|Rep: Microvitellogenin precursor - Manduca sexta
           (Tobacco hawkmoth) (Tobacco hornworm)
          Length = 249

 Score =  180 bits (438), Expect = 4e-44
 Identities = 94/245 (38%), Positives = 126/245 (51%)
 Frame = -1

Query: 777 LKTQTAFSTKMVFADATSINNHLYNLVTGGDYINAVKTVRSLVDNQGSDVCRDVVSRLVS 598
           L+T     T    A A   ++ +YN V  GD   AV   + L      D+  + V+RL+ 
Sbjct: 2   LRTTVVLLTLAAIAFAAPTSDDIYNNVVIGDIDGAVAKSKELQKQGKGDIITEAVNRLIR 61

Query: 597 QGIKNTMSFAYKLWHEGHKDIVEDYFPSEFXXXXXXXXXXXIGKHYNQALKLDANVGEYN 418
              +NTM +AY+LW    +DIV++ FP +F           I K  N A+KL        
Sbjct: 62  DSQRNTMEYAYQLWSLEARDIVKERFPIQFRMMLGEHSIKLINKRDNLAMKLGVATDNSG 121

Query: 417 DRLTWGDGKDYTSHHVSWQLISLWEDNNVIFKILNTEYEMYLKLDVNVDSYGDRKTWGSN 238
           DR+ +G   D TS  V+W+ + L ED  V FKILN +   YLKL V  DS G+   + S+
Sbjct: 122 DRIAYGAADDKTSDRVAWKFVPLSEDKRVYFKILNVQRGQYLKLGVETDSDGEHMAYASS 181

Query: 237 GSSEKRHTWSLYPVKVGDQQLFLIENREYRQGLKLDANVDSYGDRLVWGSNGTVADNPEY 58
           G+   RH W L P K     +F I NREY   LKL  +VDS GDR VWG NG V  NPE 
Sbjct: 182 GADTFRHQWYLQPAKADGNLVFFIVNREYNHALKLGRSVDSMGDRQVWGHNGNVIGNPEL 241

Query: 57  YGFII 43
           +G+ +
Sbjct: 242 FGWSV 246


>UniRef50_Q00802 Cluster: Low molecular mass 30 kDa lipoprotein 19G1
           precursor; n=3; Bombyx mori|Rep: Low molecular mass 30
           kDa lipoprotein 19G1 precursor - Bombyx mori (Silk moth)
          Length = 256

 Score =  177 bits (431), Expect = 3e-43
 Identities = 94/228 (41%), Positives = 125/228 (54%)
 Frame = -1

Query: 723 INNHLYNLVTGGDYINAVKTVRSLVDNQGSDVCRDVVSRLVSQGIKNTMSFAYKLWHEGH 544
           +   LYN V   DY +AV+  + L + + S+V  +VV++L+     N M +AY+LW +G 
Sbjct: 27  LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGS 86

Query: 543 KDIVEDYFPSEFXXXXXXXXXXXIGKHYNQALKLDANVGEYNDRLTWGDGKDYTSHHVSW 364
           KDIV D FP EF           + K    AL L  +V   + R  +GDGKD TS  VSW
Sbjct: 87  KDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVQGDDGRPRYGDGKDKTSPRVSW 146

Query: 363 QLISLWEDNNVIFKILNTEYEMYLKLDVNVDSYGDRKTWGSNGSSEKRHTWSLYPVKVGD 184
           +LI+LWE+N V FKILNTE   YL L V  +  GD   +G N     R  W L P K  +
Sbjct: 147 KLIALWENNKVYFKILNTERNQYLVLGVGTNWNGDHMAFGVNSVDSFRAQWYLQPAKYDN 206

Query: 183 QQLFLIENREYRQGLKLDANVDSYGDRLVWGSNGTVADNPEYYGFIIQ 40
             LF I NREY + L L   V+  G R+ WG NG V  +PE+Y + I+
Sbjct: 207 DVLFYIYNREYSKALTLSRTVEPSGHRMAWGYNGRVIGSPEHYAWGIK 254


>UniRef50_P09335 Cluster: Low molecular 30 kDa lipoprotein PBMHP-12
           precursor; n=5; Bombyx mori|Rep: Low molecular 30 kDa
           lipoprotein PBMHP-12 precursor - Bombyx mori (Silk moth)
          Length = 264

 Score =  161 bits (390), Expect = 3e-38
 Identities = 86/233 (36%), Positives = 127/233 (54%), Gaps = 3/233 (1%)
 Frame = -1

Query: 723 INNHLYNLVTGGDYINAV-KTVRSLVDNQGSDVCRDVVSRLVSQGIKNTMSFAYKLWHEG 547
           + + LYN +  GDY +AV K++      QGS + ++VV+ L+    +NTM + YKLW   
Sbjct: 33  LEDKLYNSILTGDYDSAVRKSLEYESQGQGS-IVQNVVNNLIIDKRRNTMEYCYKLWVGN 91

Query: 546 HKDIVEDYFPSEFXXXXXXXXXXXIGKHYNQALKLDANVGEYNDRLTWGDGKDYTSHHVS 367
            +DIV+ YFP  F           I ++YN ALKL +     N+R+ +GDG D  +  VS
Sbjct: 92  GQDIVKKYFPLSFRLIMAGNYVKLIYRNYNLALKLGSTTNPSNERIAYGDGVDKHTDLVS 151

Query: 366 WQLISLWEDNNVIFKILNTEYEMYLKLDVNVDSYG--DRKTWGSNGSSEKRHTWSLYPVK 193
           W+ I+LWE+N V FK  NT+Y  YLK+  +  +    DR  +G N +   R  W   P K
Sbjct: 152 WKFITLWENNRVYFKAHNTKYNQYLKMSTSTCNCNARDRVVYGGNSADSTREQWFFQPAK 211

Query: 192 VGDQQLFLIENREYRQGLKLDANVDSYGDRLVWGSNGTVADNPEYYGFIIQPW 34
             +  LF I NR++   L+L   V++ GDR   G +G VA  P+ Y + I P+
Sbjct: 212 YENDVLFFIYNRQFNDALELGTIVNASGDRKAVGHDGEVAGLPDIYSWFITPF 264


>UniRef50_P09334 Cluster: Low molecular 30 kDa lipoprotein PBMHP-6
           precursor; n=2; Bombyx mori|Rep: Low molecular 30 kDa
           lipoprotein PBMHP-6 precursor - Bombyx mori (Silk moth)
          Length = 256

 Score =  143 bits (347), Expect = 4e-33
 Identities = 77/226 (34%), Positives = 120/226 (53%)
 Frame = -1

Query: 711 LYNLVTGGDYINAVKTVRSLVDNQGSDVCRDVVSRLVSQGIKNTMSFAYKLWHEGHKDIV 532
           LY  V  G+Y  A+      +  +  +V ++ V RL+  G +NTM FAY+LW +  K+IV
Sbjct: 33  LYMSVVIGEYETAIAKCSEYLKEKKGEVIKEAVKRLIENGKRNTMDFAYQLWTKDGKEIV 92

Query: 531 EDYFPSEFXXXXXXXXXXXIGKHYNQALKLDANVGEYNDRLTWGDGKDYTSHHVSWQLIS 352
           + YFP +F           I K  + ALKL     + ++++ +GD KD TS  VSW+   
Sbjct: 93  KSYFPIQFRVIFTEQTVKLINKRDHHALKLIDQ--QNHNKIAFGDSKDKTSKKVSWKFTP 150

Query: 351 LWEDNNVIFKILNTEYEMYLKLDVNVDSYGDRKTWGSNGSSEKRHTWSLYPVKVGDQQLF 172
           + E+N V FKI++TE + YLKLD    S  DR  +G + +   +H W L P       +F
Sbjct: 151 VLENNRVYFKIMSTEDKQYLKLDNTKGSSDDRIIYGDSTADTFKHHWYLEPSMYESDVMF 210

Query: 171 LIENREYRQGLKLDANVDSYGDRLVWGSNGTVADNPEYYGFIIQPW 34
            + NREY   + LD ++ +  DR   G +G V+  P+ + + I P+
Sbjct: 211 FVYNREYNSVMTLDEDMAANEDREALGHSGEVSGYPQLFAWYIVPY 256


>UniRef50_Q75RW3 Cluster: BmLSP-T; n=2; Bombyx mori|Rep: BmLSP-T -
           Bombyx mori (Silk moth)
          Length = 267

 Score =  137 bits (331), Expect = 4e-31
 Identities = 75/197 (38%), Positives = 109/197 (55%), Gaps = 5/197 (2%)
 Frame = -1

Query: 618 VVSRLVSQGIKNTMSFAYKLWH--EGHKDIVEDYFPSEFXXXXXXXXXXXIGKHYNQALK 445
           +V+RL+ +  +N    AYKLW   +  ++IV++YFP  F           I K  N A+K
Sbjct: 69  IVNRLIRENKRNICDLAYKLWDYMDESQEIVKEYFPVIFRQIFSENSVKIINKRDNLAIK 128

Query: 444 LDANVGEYNDRLTWGDGKDYTSHHVSWQLISLWEDNNVIFKILNTEYEMYLKLD---VNV 274
           L   +   NDR+ +GD  D TS +V+W+LI LW+DN V FKI +       ++    + V
Sbjct: 129 LGDALDSDNDRVAYGDANDKTSDNVAWKLIPLWDDNRVYFKIFSVHRNQIFEIRHTYLTV 188

Query: 273 DSYGDRKTWGSNGSSEKRHTWSLYPVKVGDQQLFLIENREYRQGLKLDANVDSYGDRLVW 94
           D+  D   +G + +   RH W L PV++ +Q LF I NR+Y Q LKL  NVDS GDR  +
Sbjct: 189 DN--DHGVYGDDRADTHRHQWYLNPVELENQVLFYIYNRQYDQALKLGRNVDSDGDRRAY 246

Query: 93  GSNGTVADNPEYYGFII 43
            S+ +V   PE Y + I
Sbjct: 247 SSSSSVEGQPELYAWSI 263


>UniRef50_UPI0000E48EFF Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: hypothetical protein, partial -
           Strongylocentrotus purpuratus
          Length = 195

 Score = 41.1 bits (92), Expect = 0.034
 Identities = 28/78 (35%), Positives = 40/78 (51%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           TS  T    TSS  TS+  ++  +T +  ++S+   +K S+   + AS TT  P +T  T
Sbjct: 88  TSPTTTPQTTSSTTTSQTTTSPTTTPK--TTSSTTPVKTSSTASSTASPTTT-PQKTSST 144

Query: 386 TPATMSAGNSSLFGKTTT 333
           TP T S   SS    TTT
Sbjct: 145 TPVTKSPATSSTISPTTT 162


>UniRef50_Q6ZMV0 Cluster: CDNA FLJ16652 fis, clone TESTI4036767;
           n=2; Homo sapiens|Rep: CDNA FLJ16652 fis, clone
           TESTI4036767 - Homo sapiens (Human)
          Length = 325

 Score = 40.7 bits (91), Expect = 0.045
 Identities = 49/166 (29%), Positives = 62/166 (37%), Gaps = 4/166 (2%)
 Frame = -3

Query: 553 RGPQGHRRRLLPERIPTHTRPTDN*AHRQTLQSSSQTGC*RWRVQRPPDLGRRKRLHQPP 374
           R PQ       P+R PTH  P  +  HR   +  +     R    R P   +R   H+PP
Sbjct: 27  RAPQRDPTHRAPQRDPTHRAPQRDPTHRAPQRDPTHRAPQRDPTHRAP---QRDPTHRPP 83

Query: 373 CQLATHLSLGRQQRDIQDTEHRI--RDVLETGRERGQLRR--QEDLGIEWFQ*EETHLVF 206
            +  TH +  R      D  HR   RD      +RG   R  Q        Q + TH   
Sbjct: 84  QRDPTHRAPQR------DPTHRAPQRDPTHRAPQRGPRHRAPQRSPRHRAPQRDPTHRA- 136

Query: 205 IPGKGGRPTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQ 68
            P +G R  A P R+P   A     R R   RGP     QR  R +
Sbjct: 137 -PQRGPRHRA-PQRDPTHRAPQRGPRHRAPQRGPTHRAPQRGPRHR 180



 Score = 33.1 bits (72), Expect = 8.9
 Identities = 49/180 (27%), Positives = 64/180 (35%), Gaps = 6/180 (3%)
 Frame = -3

Query: 583 HHVVRVQAVARGPQGHRRRLLPERIPTHTRPTDN*AHRQTLQSSSQTGC*RWRVQRPPDL 404
           H   +     R PQ       P+R PTH  P  +  HR   +  +     R    R P  
Sbjct: 35  HRAPQRDPTHRAPQRDPTHRAPQRDPTHRAPQRDPTHRAPQRDPTHRPPQRDPTHRAP-- 92

Query: 403 GRRKRLHQPPCQLATHLSLGRQQR---DIQDTEHRI--RDVLETGRERGQLRRQEDLGIE 239
            +R   H+ P +  TH +  R  R     +   HR   RD      +RG   R       
Sbjct: 93  -QRDPTHRAPQRDPTHRAPQRGPRHRAPQRSPRHRAPQRDPTHRAPQRGPRHRAP----- 146

Query: 238 WFQ*EETHLVFIPGKGGRPTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQR-DSRRQPR 62
             Q + TH    P +G R  A P R P   A     R R   RGP     QR  + R P+
Sbjct: 147 --QRDPTHRA--PQRGPRHRA-PQRGPTHRAPQRGPRHRAPQRGPRHRAPQRGPTHRAPQ 201


>UniRef50_Q3D424 Cluster: Cell wall surface anchor family protein;
            n=62; root|Rep: Cell wall surface anchor family protein -
            Streptococcus agalactiae H36B
          Length = 1326

 Score = 39.9 bits (89), Expect = 0.078
 Identities = 26/78 (33%), Positives = 41/78 (52%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            TS  T A+ +SS   S + S S ST+  +S+S + +   S    T AST+ +    T  +
Sbjct: 871  TSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSAS 930

Query: 386  TPATMSAGNSSLFGKTTT 333
            T A+MSA  S+    +T+
Sbjct: 931  TSASMSASTSASTSASTS 948



 Score = 39.1 bits (87), Expect = 0.14
 Identities = 25/78 (32%), Positives = 41/78 (52%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           TS  T A+ ++S   S + S S ST+  +S+S + +I  S      AST+ +    T  +
Sbjct: 763 TSASTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSAS 822

Query: 386 TPATMSAGNSSLFGKTTT 333
           T A+MSA  S+    +T+
Sbjct: 823 TSASMSASTSASTSASTS 840



 Score = 38.7 bits (86), Expect = 0.18
 Identities = 25/78 (32%), Positives = 41/78 (52%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            TS  T A+ ++S   S + S S ST+   S+S + ++  S    T AST+ +    T  +
Sbjct: 999  TSASTSASMSASTSASTSASMSASTSASTSASMSASMSASTSASTSASTSASTSASTSAS 1058

Query: 386  TPATMSAGNSSLFGKTTT 333
            T A+MSA  S+    +T+
Sbjct: 1059 TSASMSASTSASMSASTS 1076



 Score = 37.9 bits (84), Expect = 0.31
 Identities = 25/78 (32%), Positives = 41/78 (52%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            TS  T A+ ++S   S + S S ST+   S+S +++   S    T AST+ +    T  +
Sbjct: 1159 TSASTSASTSASTSASTSASMSASTSASTSASMSVSTSASMSASTSASTSASMSASTSAS 1218

Query: 386  TPATMSAGNSSLFGKTTT 333
            T A+MSA  S+    +T+
Sbjct: 1219 TSASMSASTSASTSASTS 1236



 Score = 37.5 bits (83), Expect = 0.41
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            TS  T A+ ++S   S + S S ST+   S+S + +   S    T AST+ +    T  +
Sbjct: 1115 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1174

Query: 386  TPATMSAGNSS 354
            T A+MSA  S+
Sbjct: 1175 TSASMSASTSA 1185



 Score = 36.7 bits (81), Expect = 0.72
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            TS  T A+ ++S   S + S S ST+   S+S + +   S    T AST+ +    T  +
Sbjct: 859  TSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASMSASTSAS 918

Query: 386  TPATMSAGNSS 354
            T A+MSA  S+
Sbjct: 919  TSASMSASTSA 929



 Score = 35.1 bits (77), Expect = 2.2
 Identities = 23/70 (32%), Positives = 36/70 (51%)
 Frame = -2

Query: 563  SCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKTT 384
            S  T A+ ++S   S + S S ST+   S+S + +   S    T AST+ +    T  +T
Sbjct: 848  SASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSAST 907

Query: 383  PATMSAGNSS 354
             A+MSA  S+
Sbjct: 908  SASMSASTSA 917



 Score = 35.1 bits (77), Expect = 2.2
 Identities = 23/71 (32%), Positives = 38/71 (53%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            TS  T A+ ++S  +S + S S ST+  +S+S + +   S      AST+ +    T  +
Sbjct: 943  TSASTSASMSASTSSSTSASMSASTSASMSASMSASTSSSTSASMSASTSASMSASTSAS 1002

Query: 386  TPATMSAGNSS 354
            T A+MSA  S+
Sbjct: 1003 TSASMSASTSA 1013



 Score = 35.1 bits (77), Expect = 2.2
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            TS  T A+ ++S   S + S S ST+   S+S + +   S    T AST+ +    T  +
Sbjct: 955  TSSSTSASMSASTSASMSASMSASTSSSTSASMSASTSASMSASTSASTSASMSASTSAS 1014

Query: 386  TPATMSAGNSS 354
            T A+MSA  S+
Sbjct: 1015 TSASMSASTSA 1025



 Score = 35.1 bits (77), Expect = 2.2
 Identities = 24/78 (30%), Positives = 41/78 (52%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            TS    A+ ++S  +S + S S ST+  +S+S + +   S    T AST+ +    T  +
Sbjct: 967  TSASMSASMSASTSSSTSASMSASTSASMSASTSASTSASMSASTSASTSASMSASTSAS 1026

Query: 386  TPATMSAGNSSLFGKTTT 333
            T A+MSA  S+    +T+
Sbjct: 1027 TSASMSASMSASTSASTS 1044



 Score = 35.1 bits (77), Expect = 2.2
 Identities = 24/78 (30%), Positives = 40/78 (51%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            TS  T A+ ++S   S + S S ST+  +S+S + +   S    T AST+ +       +
Sbjct: 1043 TSASTSASTSASTSASTSASMSASTSASMSASTSASTSASMSASTSASTSASTSASMSVS 1102

Query: 386  TPATMSAGNSSLFGKTTT 333
            T A+MSA  S+    +T+
Sbjct: 1103 TSASMSASTSASTSASTS 1120



 Score = 34.3 bits (75), Expect = 3.9
 Identities = 22/70 (31%), Positives = 36/70 (51%)
 Frame = -2

Query: 563  SCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKTT 384
            S  T A+ ++S   S + S S S +   S+S + ++  S    T AST+ +    T  +T
Sbjct: 900  SASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSSST 959

Query: 383  PATMSAGNSS 354
             A+MSA  S+
Sbjct: 960  SASMSASTSA 969



 Score = 34.3 bits (75), Expect = 3.9
 Identities = 23/71 (32%), Positives = 36/71 (50%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            TS  T A+ + S   S + S S ST+  +S+S + +   S    T AST+ +       +
Sbjct: 1183 TSASTSASMSVSTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSAS 1242

Query: 386  TPATMSAGNSS 354
            T A+MSA  S+
Sbjct: 1243 TSASMSASTSA 1253



 Score = 33.9 bits (74), Expect = 5.1
 Identities = 23/77 (29%), Positives = 38/77 (49%)
 Frame = -2

Query: 563  SCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKTT 384
            S  T A+ ++S   S + S S ST+   S+S + +   S      AST+ +    T  +T
Sbjct: 1020 SASTSASTSASMSASMSASTSASTSASTSASTSASTSASTSASMSASTSASMSASTSAST 1079

Query: 383  PATMSAGNSSLFGKTTT 333
             A+MSA  S+    +T+
Sbjct: 1080 SASMSASTSASTSASTS 1096



 Score = 33.9 bits (74), Expect = 5.1
 Identities = 23/78 (29%), Positives = 39/78 (50%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            TS    A+ ++S   S + S S ST+  +S+S + +   S      AST+ +    T  +
Sbjct: 1195 TSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSASMSASTSAS 1254

Query: 386  TPATMSAGNSSLFGKTTT 333
            T A+MSA  S+    +T+
Sbjct: 1255 TSASMSASMSASTSASTS 1272



 Score = 33.5 bits (73), Expect = 6.8
 Identities = 23/78 (29%), Positives = 39/78 (50%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           TS    A+ ++S   S + S S ST+  +S+S + +   S    T AST+ +       +
Sbjct: 655 TSASMSASTSASTSASMSASTSASTSASMSASMSASTSASMSASTSASTSASMSASMSAS 714

Query: 386 TPATMSAGNSSLFGKTTT 333
           T A+MSA  S+    +T+
Sbjct: 715 TSASMSASTSASTSASTS 732


>UniRef50_UPI0000499DE2 Cluster: hypothetical protein 1.t00040; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 1.t00040 - Entamoeba histolytica HM-1:IMSS
          Length = 903

 Score = 39.5 bits (88), Expect = 0.10
 Identities = 17/45 (37%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = -1

Query: 381 SHHVSWQLISLWEDNNVIFKILNTEYEMYLKLDVNVDSY-GDRKT 250
           +H ++ Q +SL++ NN +FK    EY   L +DV+++ Y  DR+T
Sbjct: 235 NHPITQQFLSLFDQNNTLFKCTYKEYLRLLSIDVSIERYISDRQT 279


>UniRef50_UPI0000DA32FD Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 271

 Score = 39.1 bits (87), Expect = 0.14
 Identities = 27/80 (33%), Positives = 39/80 (48%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S +S  T  T T++  T+  NS++ +T    SS+  IT   ++   T  +TTT     T 
Sbjct: 129 SSSSSTTTTTTTTTTTTTITNSSTITTTTTSSSTTTITTTTTSSSTTTITTTTT--STTT 186

Query: 392 KTTPATMSAGNSSLFGKTTT 333
            TT  T +  NSS    TTT
Sbjct: 187 TTTTTTTTITNSSTITTTTT 206


>UniRef50_Q6NWH9 Cluster: Zgc:85700; n=2; Danio rerio|Rep: Zgc:85700
           - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 308

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 30/95 (31%), Positives = 36/95 (37%)
 Frame = -3

Query: 538 HRRRLLPERIPTHTRPTDN*AHRQTLQSSSQTGC*RWRVQRPPDLGRRKRLHQPPCQLAT 359
           H RR    R     R TD   HR    SSS  G    R  R  D GR  R H+   +   
Sbjct: 39  HSRRRTRSRSRDRNRTTDR-RHRNRSHSSSSRGSGHRRRSRSADRGRSHRSHRSRSRSRN 97

Query: 358 HLSLGRQQRDIQDTEHRIRDVLETGRERGQLRRQE 254
             S  R +R    +  R        RERGQ R ++
Sbjct: 98  RRSRSRHRRSRSCSSGRSSRKRSRERERGQRRTRD 132


>UniRef50_Q5APQ2 Cluster: Putative uncharacterized protein; n=3;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 768

 Score = 38.3 bits (85), Expect = 0.24
 Identities = 26/80 (32%), Positives = 46/80 (57%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S +S  +  T +S    S ++S+S S +   SSS+N +   S+  +T +STT++ P  +E
Sbjct: 286 SISSTSSSFTTSSDTSASSSSSSSVSPSSTTSSSSNFSSSSSSSTITSSSTTSSIPSSSE 345

Query: 392 KTTPATMSAGNSSLFGKTTT 333
            ++ +T SA +SS    T+T
Sbjct: 346 VSSTST-SASSSSSDSSTST 364


>UniRef50_Q980D5 Cluster: Putative uncharacterized protein; n=1;
           Sulfolobus solfataricus|Rep: Putative uncharacterized
           protein - Sulfolobus solfataricus
          Length = 496

 Score = 38.3 bits (85), Expect = 0.24
 Identities = 23/72 (31%), Positives = 40/72 (55%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+  T  T T++  TS  +++S +T+   SSS+  T   S   +T +STT++    T  T
Sbjct: 397 TTSSTTTTSTTTSTTSTTSTSSSTTSTTTSSSSTTTTSSS---ITSSSTTSSTTSSTSTT 453

Query: 386 TPATMSAGNSSL 351
           TP + S+  +S+
Sbjct: 454 TPTSTSSSTTSV 465


>UniRef50_Q9VT37 Cluster: CG16707-PC, isoform C; n=6; Diptera|Rep:
           CG16707-PC, isoform C - Drosophila melanogaster (Fruit
           fly)
          Length = 183

 Score = 37.9 bits (84), Expect = 0.31
 Identities = 25/71 (35%), Positives = 33/71 (46%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P  S TS  T  T T+  IT+     + ST    +S+ + T   S    T  +TTT  PG
Sbjct: 55  PSTSTTSTTTEKTTTTPPITTSTEKTTTSTTP--ASTTSSTTPASTTSSTTPATTTTTPG 112

Query: 401 ETEKTTPATMS 369
            T  TTP+  S
Sbjct: 113 TTSTTTPSPNS 123


>UniRef50_UPI0000DA3216 Cluster: PREDICTED: hypothetical protein;
           n=2; Coelomata|Rep: PREDICTED: hypothetical protein -
           Rattus norvegicus
          Length = 418

 Score = 36.3 bits (80), Expect = 0.96
 Identities = 26/80 (32%), Positives = 37/80 (46%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S +S  T  T T++  T+  NS+S  T    +SS+  TI  +    +  + TT     T 
Sbjct: 228 SSSSSTTTTTTTTTTTTTTINSSSTITTT-TTSSSTTTITTTTTSSSTTTITTTTTSTTT 286

Query: 392 KTTPATMSAGNSSLFGKTTT 333
            TT  T +  NSS    TTT
Sbjct: 287 TTTTTTTTITNSSTITTTTT 306


>UniRef50_Q6L473 Cluster: Putative uncharacterized protein
           OSJNBa0009L15.14; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OSJNBa0009L15.14 - Oryza sativa subsp. japonica (Rice)
          Length = 92

 Score = 36.3 bits (80), Expect = 0.96
 Identities = 17/31 (54%), Positives = 19/31 (61%)
 Frame = -3

Query: 199 GKGGRPTAVPHREPGVPAGTEAGRERGLIRG 107
           G+GGRP A P R P + AG EA R  G  RG
Sbjct: 32  GRGGRPGAAPSRLPDLAAGREAARPDGGTRG 62


>UniRef50_Q7RGR0 Cluster: Asparagine-rich protein, putative; n=3;
           Plasmodium (Vinckeia)|Rep: Asparagine-rich protein,
           putative - Plasmodium yoelii yoelii
          Length = 507

 Score = 36.3 bits (80), Expect = 0.96
 Identities = 34/140 (24%), Positives = 60/140 (42%), Gaps = 8/140 (5%)
 Frame = -1

Query: 465 HYNQALKLDANVGEYNDRLTWGDGKDYTSHHVSWQLISLWEDNNV---IFKILN-----T 310
           +Y Q ++ D      N+     D +D TSH+++  +ISL E++ +     KI N      
Sbjct: 291 YYEQVIQNDEKKKNINNNEINSDKEDKTSHNINENIISLTENSKLSEYSNKIKNDDTPCL 350

Query: 309 EYEMYLKLDVNVDSYGDRKTWGSNGSSEKRHTWSLYPVKVGDQQLFLIENREYRQGLKLD 130
           EY   +K+ +  +   D  T    G+ + ++ W L   K    +   I N E     K +
Sbjct: 351 EYHDDIKMVIGENKDNDNSTCADIGTIKDKNEWIL--EKTDQSENNNINNNEISN--KDN 406

Query: 129 ANVDSYGDRLVWGSNGTVAD 70
            N++S  + + W   G   D
Sbjct: 407 TNLESSNNSIKWEFEGDDKD 426


>UniRef50_Q7SH96 Cluster: Predicted protein; n=1; Neurospora
            crassa|Rep: Predicted protein - Neurospora crassa
          Length = 1809

 Score = 36.3 bits (80), Expect = 0.96
 Identities = 19/35 (54%), Positives = 21/35 (60%)
 Frame = +3

Query: 90   SPTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPP 194
            +P  GGP M PR+ P SVPA TP S  GT    PP
Sbjct: 1172 APHPGGP-MPPRAPPGSVPATTPPSTGGTPFFTPP 1205


>UniRef50_Q60EQ9 Cluster: Putative uncharacterized protein
           OJ1280_A04.4; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OJ1280_A04.4 - Oryza sativa subsp. japonica (Rice)
          Length = 340

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 27/59 (45%), Positives = 31/59 (52%)
 Frame = -3

Query: 199 GKGGRPTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQPRVLRLHNPAVAVTP 23
           G  G   AVPHRE  VP G EA  ERG  RG P    +RD+  +P + R    AVA  P
Sbjct: 193 GHHGGELAVPHRERRVPGG-EAEPERGQHRGLP----ERDTSSEPDLAR----AVAAQP 242


>UniRef50_Q6ZUK6 Cluster: CDNA FLJ43617 fis, clone SPLEN2016863;
           n=2; Homo sapiens|Rep: CDNA FLJ43617 fis, clone
           SPLEN2016863 - Homo sapiens (Human)
          Length = 358

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 32/118 (27%), Positives = 47/118 (39%), Gaps = 2/118 (1%)
 Frame = -3

Query: 454 SSQTGC*RWRVQRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRER 275
           +++TG   W VQR P   R  R H+  C+   H +       +Q +  R RD    G   
Sbjct: 223 AAETGV-LWAVQRSPPRSRDGRPHRQ-CRGHHHTAETGVLWAVQRSPPRSRDRRPVGSAE 280

Query: 274 GQLRRQEDLGIEWFQ*EETHLVFIPGKGGRPTAVPHREPGVPAG--TEAGRERGLIRG 107
                Q  LG+ W +     + F P K  +P+     +   P     EA   RGL +G
Sbjct: 281 VTTLSQTVLGLPWVEHRMKTMCFEPWKDNQPSQSQSLKQAAPRAQLQEAASSRGLQQG 338


>UniRef50_UPI0000DB700C Cluster: PREDICTED: hypothetical protein;
           n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein
           - Apis mellifera
          Length = 532

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 1/81 (1%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLAS-TTTA*PGET 396
           +RT+    +T T++++TS  +S S +T    ++S   T   +    T    ++TA    T
Sbjct: 411 NRTTTDAMSTTTTTELTSPTSSTSPTTTTTTTTSTTSTTTTTTTTTTQQPPSSTATSTTT 470

Query: 395 EKTTPATMSAGNSSLFGKTTT 333
             TT +T +A NSS    TTT
Sbjct: 471 TSTTTSTTTADNSSTTTTTTT 491


>UniRef50_Q7YZI0 Cluster: MBCTL1; n=3; root|Rep: MBCTL1 - Monosiga
           brevicollis
          Length = 916

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 22/80 (27%), Positives = 38/80 (47%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S +S  T  + T++  TS   + +  T    ++S   T   +   LT ++TTTA    T 
Sbjct: 334 STSSTSTSTSSTTTVTTSTTTTTTTVTTSTTTTSTTSTTSTTTTTLTTSTTTTATTSTTT 393

Query: 392 KTTPATMSAGNSSLFGKTTT 333
            +T +T S  +++    TTT
Sbjct: 394 TSTTSTTSTTSTTTTSSTTT 413



 Score = 33.9 bits (74), Expect = 5.1
 Identities = 23/78 (29%), Positives = 39/78 (50%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           TS  +  T TSS  ++ + S++ ST+   S+S + +   +    T  +TTT     T  +
Sbjct: 308 TSSTSSTTSTSSTSSTSSTSSTSSTSSTSSTSTSTSSTTTVTTSTTTTTTTVTTSTTTTS 367

Query: 386 TPATMSAGNSSLFGKTTT 333
           T +T S   ++L   TTT
Sbjct: 368 TTSTTSTTTTTLTTSTTT 385


>UniRef50_Q2VMT1 Cluster: Phenylalanine ammonia lyase; n=1;
           Rhodotorula glutinis|Rep: Phenylalanine ammonia lyase -
           Rhodotorula glutinis (Yeast)
          Length = 714

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +3

Query: 51  SRSTRGCRRLSRCSPTQGGPRMSPRSRPASVPAGTPGSR 167
           +RST GC R +R + + GG   S RSRPA     +PG+R
Sbjct: 517 NRSTSGCSRTTRTTSSSGGTTRS-RSRPAPSSKPSPGTR 554


>UniRef50_Q8TFG9 Cluster: Uncharacterized serine/threonine-rich
           protein PB15E9.01c precursor; n=2; Schizosaccharomyces
           pombe|Rep: Uncharacterized serine/threonine-rich protein
           PB15E9.01c precursor - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 943

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 2/69 (2%)
 Frame = -2

Query: 554 TRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGET--EKTTP 381
           T AT TSS ++S A SNS +++   SSS N T   +    +++ST ++    T    TT 
Sbjct: 204 TSATATSSSLSSTAASNSATSSSLASSSLNSTTSATATSSSISSTVSSSTPLTSSNSTTA 263

Query: 380 ATMSAGNSS 354
           AT ++  SS
Sbjct: 264 ATSASATSS 272


>UniRef50_Q12215 Cluster: Cell wall integrity and stress response
           component 3 precursor; n=2; Saccharomyces
           cerevisiae|Rep: Cell wall integrity and stress response
           component 3 precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 556

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 20/78 (25%), Positives = 42/78 (53%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           ++  T ++ TSS  +S  +S + ST    +SS+  +   S    T +STT++    T  +
Sbjct: 187 STTSTTSSSTSSTTSSTTSSTTSSTTSSTTSSSTSSTTSSTTSSTTSSTTSSTTSSTTSS 246

Query: 386 TPATMSAGNSSLFGKTTT 333
           T ++ ++  +S+F  T++
Sbjct: 247 TTSSTTSSTTSIFSVTSS 264


>UniRef50_Q8N9R0 Cluster: Putative uncharacterized protein C16orf81;
           n=3; Homo/Pan/Gorilla group|Rep: Putative
           uncharacterized protein C16orf81 - Homo sapiens (Human)
          Length = 145

 Score = 35.1 bits (77), Expect = 2.2
 Identities = 21/49 (42%), Positives = 25/49 (51%)
 Frame = -3

Query: 184 PTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQPRVLRLHNPA 38
           P   PH   G PA TEAGR   L+R  P VG +  + + PR L    PA
Sbjct: 39  PCWAPHSPCGSPAATEAGR---LMRRLPSVGGRMTAPKTPRFLTRRPPA 84


>UniRef50_Q9XA04 Cluster: Putative serine/threonine protein kinase;
           n=4; Streptomyces|Rep: Putative serine/threonine protein
           kinase - Streptomyces coelicolor
          Length = 576

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 22/42 (52%), Positives = 24/42 (57%), Gaps = 3/42 (7%)
 Frame = +3

Query: 78  LSRCSP-TQGGPRMSPRSRPASVPAGTPGSR*GT--AVGLPP 194
           L R SP + G P   P S PAS P GTP +  GT  A GLPP
Sbjct: 345 LDRPSPGSPGPPPTGPDSTPASPPPGTPVTATGTPSAPGLPP 386


>UniRef50_Q86AK1 Cluster: Similar to Delayed Anaerobic Gene; Dan4p;
           n=2; Dictyostelium discoideum|Rep: Similar to Delayed
           Anaerobic Gene; Dan4p - Dictyostelium discoideum (Slime
           mold)
          Length = 457

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 2/80 (2%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+  T  T T+SK T+ + +++ ST     ++ + T   S    T   TTT+    T KT
Sbjct: 336 TTSTTSTTSTTSKPTTTSTTSTTSTTS-KPTTTSTTSTTSTTSTTSKPTTTSTTSTTSKT 394

Query: 386 T--PATMSAGNSSLFGKTTT 333
           T   +T + G+S+  G +TT
Sbjct: 395 TTGSSTTTTGSSTTTGSSTT 414


>UniRef50_Q4J9N9 Cluster: Conserved T+S rich domain protein; n=1;
           Sulfolobus acidocaldarius|Rep: Conserved T+S rich domain
           protein - Sulfolobus acidocaldarius
          Length = 521

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 20/77 (25%), Positives = 41/77 (53%)
 Frame = -2

Query: 563 SCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKTT 384
           S  T  T T+S  TS + + S S+    S++++ T + ++   +  STTT+    T  ++
Sbjct: 399 SSSTTTTSTTSTTTSTSTTTSTSSTTTTSTTSSTTTQTTSQTTSTTSTTTSSTSSTSSSS 458

Query: 383 PATMSAGNSSLFGKTTT 333
            ++ ++ ++S    TTT
Sbjct: 459 VSSSTSTSTSSQSSTTT 475


>UniRef50_UPI0000D8A0A1 Cluster: hypothetical protein E1126G04.tmp1;
            n=1; Eimeria tenella|Rep: hypothetical protein
            E1126G04.tmp1 - Eimeria tenella
          Length = 1566

 Score = 34.3 bits (75), Expect = 3.9
 Identities = 16/43 (37%), Positives = 22/43 (51%)
 Frame = +3

Query: 99   QGGPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPGIKTRCVSS 227
            QGGP+  P   P   P G+PG   G + G PPL  ++  C  +
Sbjct: 1491 QGGPQGPPEGPPGGPPRGSPGGPPGPSGG-PPLHALRLCCAGA 1532


>UniRef50_Q8EWQ9 Cluster: Putative uncharacterized protein MYPE1440;
           n=1; Mycoplasma penetrans|Rep: Putative uncharacterized
           protein MYPE1440 - Mycoplasma penetrans
          Length = 159

 Score = 34.3 bits (75), Expect = 3.9
 Identities = 20/64 (31%), Positives = 31/64 (48%)
 Frame = -1

Query: 468 KHYNQALKLDANVGEYNDRLTWGDGKDYTSHHVSWQLISLWEDNNVIFKILNTEYEMYLK 289
           K++ + +K D  +   N  + W D        +S + I L  D+N  FKILN  Y+ +L 
Sbjct: 36  KYFYKYIKND--IKNSNSAIDWQDAVKLLDKIISDKKIILKNDDNNDFKILNNSYKKFLN 93

Query: 288 LDVN 277
            D N
Sbjct: 94  KDFN 97


>UniRef50_Q1Q4M6 Cluster: Similar to chromosomal condensation
           regulatory protein; n=1; Candidatus Kuenenia
           stuttgartiensis|Rep: Similar to chromosomal condensation
           regulatory protein - Candidatus Kuenenia stuttgartiensis
          Length = 620

 Score = 34.3 bits (75), Expect = 3.9
 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 4/54 (7%)
 Frame = +3

Query: 96  TQGGPRMSPRSRPASV---PAGTPGSR*-GTAVGLPPLPGIKTRCVSSHWNHSI 245
           TQ  P  SPR RP      P  +P  R  GT     P PG+ T  +S  W+HS+
Sbjct: 115 TQPQPGFSPRPRPTGTQPQPGFSPRPRPTGTQPQPAPTPGVVTPQISGGWSHSL 168


>UniRef50_A4J9J1 Cluster: ABC transporter related; n=3;
           Clostridiales|Rep: ABC transporter related -
           Desulfotomaculum reducens MI-1
          Length = 299

 Score = 34.3 bits (75), Expect = 3.9
 Identities = 20/71 (28%), Positives = 34/71 (47%)
 Frame = -1

Query: 246 GSNGSSEKRHTWSLYPVKVGDQQLFLIENREYRQGLKLDANVDSYGDRLVWGSNGTVADN 67
           GSNG+ +     ++  V  GDQ    IE +E  + +++ A +    D L + S  +V D 
Sbjct: 34  GSNGAGKTTLLKTMVGVYQGDQGTCCIEGQEVFENVEIKAKIIFIPDALYFFSTYSVRDM 93

Query: 66  PEYYGFIIQPW 34
            ++Y  I   W
Sbjct: 94  AKFYSNIYPSW 104


>UniRef50_Q626F7 Cluster: Putative uncharacterized protein CBG00999;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG00999 - Caenorhabditis
           briggsae
          Length = 1266

 Score = 34.3 bits (75), Expect = 3.9
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 3/80 (3%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           TS    ++ T+    S + + S ST R  ++  ++T   +  + +L+STT     ET  T
Sbjct: 553 TSSVYESSTTNDPEVSTSPTTSSSTTRTTANDTDVTTTAT--IGSLSSTTVVTTAETTVT 610

Query: 386 T---PATMSAGNSSLFGKTT 336
           T   P T S+GNS+ FG  T
Sbjct: 611 TTSLPDTASSGNSTTFGGAT 630


>UniRef50_P14328 Cluster: Spore coat protein SP96; n=3;
           Dictyostelium discoideum|Rep: Spore coat protein SP96 -
           Dictyostelium discoideum (Slime mold)
          Length = 600

 Score = 34.3 bits (75), Expect = 3.9
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSAN-ITIKLSNWMLTLASTTTA*PGETEK 390
           +S  + +  +SS  +S A S+S S++   SSSA+      +  + T A+TTTA    T  
Sbjct: 499 SSASSSSAPSSSASSSSAPSSSASSSSASSSSASSAATTAATTIATTAATTTATTTATTA 558

Query: 389 TTPATMSAGNSSLFGKTTT 333
           TT AT +A  ++    TTT
Sbjct: 559 TTTATTTATTTAATIATTT 577


>UniRef50_Q9XZT3 Cluster: EG:80H7.11 protein; n=3; Drosophila
           melanogaster|Rep: EG:80H7.11 protein - Drosophila
           melanogaster (Fruit fly)
          Length = 352

 Score = 33.9 bits (74), Expect = 5.1
 Identities = 16/56 (28%), Positives = 26/56 (46%)
 Frame = -3

Query: 418 RPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRERGQLRRQED 251
           RPP +G + RL   P +   H   G          ++ +DV ET R++   +R E+
Sbjct: 190 RPPGVGAKLRLEWSPPRHREHEGAGASATSAAPKAYQFKDVYETKRQQAMRKRSEE 245


>UniRef50_Q5CFZ6 Cluster: Putative uncharacterized protein; n=3;
            Cryptosporidium|Rep: Putative uncharacterized protein -
            Cryptosporidium hominis
          Length = 1646

 Score = 33.9 bits (74), Expect = 5.1
 Identities = 20/78 (25%), Positives = 36/78 (46%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
            T+  T+ T T++  T+   + + +T    +++   T   +    T ++TTT     T  T
Sbjct: 1082 TTTTTKPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSTTTTTTTTTTTTT 1141

Query: 386  TPATMSAGNSSLFGKTTT 333
             P T +  N+S    TTT
Sbjct: 1142 KPTTTTTTNTSTTTTTTT 1159


>UniRef50_Q550Q0 Cluster: F-Box A protein; n=4; Dictyostelium
           discoideum|Rep: F-Box A protein - Dictyostelium
           discoideum AX4
          Length = 1247

 Score = 33.9 bits (74), Expect = 5.1
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 2/89 (2%)
 Frame = -1

Query: 798 GYELPADLKTQTAFSTKMVFADATSINNHLYNLVTGGDYINAVKTVRSLVDNQGSDVCRD 619
           GY  P + +  T      + ++  SI NH+  L  G + I  +  + S+  +     C D
Sbjct: 404 GYPTPWEEEMVTKMFAARIISNQNSIINHVNKLTGGSEMIRELPVIPSVQHH-----CGD 458

Query: 618 VVSRLVSQGIKNTM--SFAYKLWHEGHKD 538
           V S + +  + N M  +FA  L  EG+KD
Sbjct: 459 VGSHIGTPQVYNAMVENFADILLDEGNKD 487


>UniRef50_UPI00015C62FA Cluster: hypothetical protein CKO_03758;
           n=1; Citrobacter koseri ATCC BAA-895|Rep: hypothetical
           protein CKO_03758 - Citrobacter koseri ATCC BAA-895
          Length = 297

 Score = 33.5 bits (73), Expect = 6.8
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = -1

Query: 438 ANVGEYNDRLTW-GDGKDYTSHHVSWQLISLWE 343
           A  GE+ND L+W GD  D   H V W +   W+
Sbjct: 234 AGAGEHNDMLSWIGDWCDPDKHPVCWSVTQRWQ 266


>UniRef50_UPI0000F2C566 Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 181

 Score = 33.5 bits (73), Expect = 6.8
 Identities = 22/81 (27%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S +S  + ++ +SS  +S ++S+S S++   SSS++ ++   +   T +S++++    T 
Sbjct: 48  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSLAQGSKAHTSSSSSSSSSSSTS 107

Query: 392 KT-TPATMSAGNSSLFGKTTT 333
            + TP T+SA ++S     TT
Sbjct: 108 SSITPTTLSASSTSTKSSPTT 128


>UniRef50_UPI0000F2BCED Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 300

 Score = 33.5 bits (73), Expect = 6.8
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = -2

Query: 554 TRATRTSSKITSRANSNSYSTNR*LSSSANITIKL-SNWMLTLASTTTA*PGETEKTTPA 378
           T  T T++  T      S ST+   +SS+  T+ + S  M T A+ +TA    T  T+ +
Sbjct: 191 TTITTTTTTTTPNFTLMSSSTDSATASSSTATLAIMSATMSTAATMSTAATSATTSTSSS 250

Query: 377 TMSAGNSSLFGKTTT 333
           TMS   SS     TT
Sbjct: 251 TMSTATSSSTATLTT 265


>UniRef50_UPI0000E48EBC Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 588

 Score = 33.5 bits (73), Expect = 6.8
 Identities = 24/80 (30%), Positives = 39/80 (48%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S T+  T  TRT++  T+++ + + +T     S+   T   +    T  STT++  G T 
Sbjct: 269 SSTTGTTTTTRTTTGSTTKSTTGTTTTRPSTGSTTKSTTGTTTSRTTTGSTTSSTTGTT- 327

Query: 392 KTTPATMSAGNSSLFGKTTT 333
            +T  T  +  SS  G TTT
Sbjct: 328 -STRTTTESTTSSTAGTTTT 346


>UniRef50_Q6FW57 Cluster: Candida glabrata strain CBS138 chromosome
           D complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome D complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 463

 Score = 33.5 bits (73), Expect = 6.8
 Identities = 20/66 (30%), Positives = 39/66 (59%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S +S  T +T ++S  +S ++++S ST+   SSS++ +   S+   TLA +TT+    T 
Sbjct: 135 STSSTSTSSTSSTSSTSSTSSTSSTSTSSTSSSSSSTSSTRSSSRTTLAPSTTSSSSRTR 194

Query: 392 KTTPAT 375
            ++ A+
Sbjct: 195 SSSEAS 200


>UniRef50_Q6CTJ9 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome C of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 423

 Score = 33.5 bits (73), Expect = 6.8
 Identities = 26/80 (32%), Positives = 42/80 (52%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S TS  T ++ TS+  +S A + S S     SSS + T  LS+   ++ASTT+     T 
Sbjct: 146 SSTSSSTSSSATSTDSSSTAATTSSSDTSGTSSSTDST--LSSLSSSIASTTSHSKVVTT 203

Query: 392 KTTPATMSAGNSSLFGKTTT 333
           + +  T++  + S+   TTT
Sbjct: 204 QVSVITLNGESRSIVAVTTT 223


>UniRef50_Q07283 Cluster: Trichohyalin; n=9; Eukaryota|Rep:
            Trichohyalin - Homo sapiens (Human)
          Length = 1898

 Score = 33.5 bits (73), Expect = 6.8
 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 1/87 (1%)
 Frame = -3

Query: 478  AHRQTLQSSSQTG-C*RWRVQRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIR 302
            AHRQ  +   +     +W+ +   + GR++   +PP +      L  ++R  Q  E R  
Sbjct: 772  AHRQQQEEEQRRDFTWQWQAEEKSERGRQRLSARPPLREQRERQLRAEER--QQREQRFL 829

Query: 301  DVLETGRERGQLRRQEDLGIEWFQ*EE 221
               E   +RG+ RR+ +  +++ + EE
Sbjct: 830  PEEEEKEQRGRQRREREKELQFLEEEE 856


>UniRef50_UPI00015B625F Cluster: PREDICTED: similar to CG18076-PB;
            n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
            CG18076-PB - Nasonia vitripennis
          Length = 5350

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 19/37 (51%), Positives = 21/37 (56%)
 Frame = +3

Query: 84   RCSPTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPP 194
            R + T GG R  P SRPAS PA  PGSR  +  G  P
Sbjct: 5222 RSTLTPGGSR--PSSRPASRPASRPGSRPASRQGSKP 5256


>UniRef50_UPI0000E25AAE Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 322

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = +3

Query: 87  CSPTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPGIKTRC 218
           C PT     + PRSR A+ P G+ GS    A+  P   G+ +RC
Sbjct: 277 CPPTPRPAALRPRSRDAAPPPGS-GSGSAAALAPPSASGVPSRC 319


>UniRef50_UPI00005A28DE Cluster: PREDICTED: hypothetical protein
           XP_851201; n=1; Canis lupus familiaris|Rep: PREDICTED:
           hypothetical protein XP_851201 - Canis familiaris
          Length = 843

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 20/37 (54%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +3

Query: 63  RGCRRLSRCS--PTQGGPRMSPRSRPASVPAGTPGSR 167
           R  RR  R +  PT  GP +SPRS PAS P  TP SR
Sbjct: 732 RAARRAPRATSAPTPVGPWLSPRSAPAS-PLLTPASR 767


>UniRef50_Q3W7V4 Cluster: Putative uncharacterized protein; n=1;
           Frankia sp. EAN1pec|Rep: Putative uncharacterized
           protein - Frankia sp. EAN1pec
          Length = 651

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%)
 Frame = -3

Query: 202 PGKGGRPTAVPHREPGVPAGTEAGRERGLIRG--PPCVGEQRDS 77
           PG G RP   PHR P    G   GR   + RG   P  G++ D+
Sbjct: 12  PGGGDRPVQSPHRRPAPRTGPGPGRPGRVRRGGAVPATGDRADA 55


>UniRef50_Q8WR08 Cluster: Dystroglycan type I; n=9; Diptera|Rep:
           Dystroglycan type I - Drosophila melanogaster (Fruit
           fly)
          Length = 1179

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 21/72 (29%), Positives = 40/72 (55%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           +S  T+AT+ ++  +S ++S+S +T    +++ + T   S+   T  +TTT      E  
Sbjct: 452 SSVPTQATQPTTSASSFSSSSSTTTTS-TTATVSTTTTASSTATTTTTTTTLSESPKEGG 510

Query: 386 TPATMSAGNSSL 351
            P  +S+GN+SL
Sbjct: 511 EPDAISSGNNSL 522


>UniRef50_Q8IMS9 Cluster: CG31439-PA; n=3; Eukaryota|Rep: CG31439-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 881

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 19/78 (24%), Positives = 34/78 (43%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+C    T T++  T+   + + +T    +++   T   +    T  +TTT  P  T   
Sbjct: 458 TTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTPTTTTTC 517

Query: 386 TPATMSAGNSSLFGKTTT 333
           TP T +   ++    TTT
Sbjct: 518 TPTTTTTTTTTTTTTTTT 535


>UniRef50_Q54IY4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 970

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 22/78 (28%), Positives = 40/78 (51%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+  T    T++   +   +++ +T    ++SA  T   ++   T  +TT A P  +  T
Sbjct: 462 TTAATTTAATTTTTAATPTTSTTTTTGATTTSATPTTTTTSTPTTTTTTTAATPPPS--T 519

Query: 386 TPATMSAGNSSLFGKTTT 333
           TP+T +A +SS+   TTT
Sbjct: 520 TPSTTAATSSSISTTTTT 537


>UniRef50_Q5KD42 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 403

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 3/83 (3%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSS---ANITIKLSNWMLTLASTTTA*PG 402
           +R+S     T + S I++  ++ SY++    S++   A+ T  LSN + T+A+TTT    
Sbjct: 288 TRSSSSAEETNSPSSISAIDSTTSYTSYTSPSNTTVFASATSTLSN-LSTVATTTTIITS 346

Query: 401 ETEKTTPATMSAGNSSLFGKTTT 333
            +  + P+  S  +SS    TTT
Sbjct: 347 ASSSSVPSFSSTSSSSSNAATTT 369


>UniRef50_Q4PEH1 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 4044

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 14/29 (48%), Positives = 18/29 (62%)
 Frame = +3

Query: 81   SRCSPTQGGPRMSPRSRPASVPAGTPGSR 167
            S  S + G PR+SP  R  ++PAG PG R
Sbjct: 2028 SGVSASSGSPRLSPSRRTRALPAGEPGPR 2056


>UniRef50_P53832 Cluster: Cell wall integrity and stress response
           component 2 precursor; n=2; Saccharomyces
           cerevisiae|Rep: Cell wall integrity and stress response
           component 2 precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 503

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 4/77 (5%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSK--ITSRANSNSYSTNR*LSSSANITIKLSNWMLTLAST--TTA*P 405
           ++TS  + AT +SS    TS   S+S +T    SSS++ +   ++   T +ST  T++ P
Sbjct: 153 TKTSTSSSATHSSSSSSTTSTTTSSSETTTSSSSSSSSSSTSTTSTTSTTSSTTSTSSSP 212

Query: 404 GETEKTTPATMSAGNSS 354
             T  +T A+ S+  SS
Sbjct: 213 STTSSSTSASSSSETSS 229


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 803,590,966
Number of Sequences: 1657284
Number of extensions: 16631351
Number of successful extensions: 68262
Number of sequences better than 10.0: 57
Number of HSP's better than 10.0 without gapping: 60511
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67614
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 73373641369
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).