SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0033
         (887 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P04179 Cluster: Superoxide dismutase [Mn], mitochondria...   308   1e-82
UniRef50_P09671 Cluster: Superoxide dismutase [Mn], mitochondria...   305   9e-82
UniRef50_Q00637 Cluster: Superoxide dismutase [Mn], mitochondria...   304   2e-81
UniRef50_Q5MIQ2 Cluster: Superoxide dismutase; n=2; Stegomyia|Re...   298   1e-79
UniRef50_Q27YV0 Cluster: Superoxide dismutase; n=15; Coelomata|R...   274   2e-72
UniRef50_O81235 Cluster: Superoxide dismutase [Mn], mitochondria...   241   1e-62
UniRef50_P09233 Cluster: Superoxide dismutase [Mn] 3.1, mitochon...   227   3e-58
UniRef50_Q92429 Cluster: Superoxide dismutase [Mn], mitochondria...   217   2e-55
UniRef50_Q9Y783 Cluster: Superoxide dismutase [Mn], mitochondria...   208   2e-52
UniRef50_Q873M4 Cluster: Superoxide dismutase; n=2; Basidiomycot...   196   5e-49
UniRef50_P19666 Cluster: Superoxide dismutase [Fe]; n=3; Tetrahy...   196   8e-49
UniRef50_Q2B678 Cluster: Superoxide dismutase; n=1; Bacillus sp....   195   1e-48
UniRef50_Q01E96 Cluster: Superoxide dismutase; n=1; Ostreococcus...   191   2e-47
UniRef50_P0A4J6 Cluster: Superoxide dismutase [Mn]; n=170; Bacte...   188   2e-46
UniRef50_Q5WH01 Cluster: Superoxide dismutase [Cu-Zn]; n=1; Baci...   187   4e-46
UniRef50_O35023 Cluster: Probable superoxide dismutase [Fe]; n=3...   186   7e-46
UniRef50_Q9Y8H8 Cluster: Superoxide dismutase [Mn/Fe]; n=7; Arch...   185   1e-45
UniRef50_Q9KD10 Cluster: Superoxide dismutase [Mn]; n=68; cellul...   184   4e-45
UniRef50_Q5KXL3 Cluster: Superoxide dismutase; n=20; cellular or...   182   1e-44
UniRef50_Q81T03 Cluster: Superoxide dismutase; n=10; Bacillus ce...   179   1e-43
UniRef50_O51917 Cluster: Superoxide dismutase [Fe-Zn] 1; n=260; ...   177   3e-43
UniRef50_A0BGP5 Cluster: Superoxide dismutase; n=2; Paramecium t...   175   9e-43
UniRef50_Q6CBQ1 Cluster: Superoxide dismutase; n=1; Yarrowia lip...   175   9e-43
UniRef50_P00447 Cluster: Superoxide dismutase [Mn], mitochondria...   175   1e-42
UniRef50_Q81JK8 Cluster: Superoxide dismutase [Mn] 2; n=13; Bact...   172   9e-42
UniRef50_P18868 Cluster: Superoxide dismutase [Fe]; n=10; Euryar...   171   2e-41
UniRef50_A6GX90 Cluster: Probable superoxide dismutase; n=1; Fla...   170   5e-41
UniRef50_Q67T03 Cluster: Superoxide dismutase; n=4; Firmicutes|R...   169   6e-41
UniRef50_P46728 Cluster: Superoxide dismutase [Mn]; n=16; Actino...   169   6e-41
UniRef50_Q59094 Cluster: Superoxide dismutase [Mn] precursor; n=...   169   1e-40
UniRef50_O74200 Cluster: Manganese superoxide dismutase precurso...   166   6e-40
UniRef50_P43019 Cluster: Superoxide dismutase [Mn]; n=299; cellu...   166   6e-40
UniRef50_P43725 Cluster: Superoxide dismutase [Mn]; n=122; cellu...   165   2e-39
UniRef50_Q9RUV2 Cluster: Superoxide dismutase [Mn]; n=20; cellul...   161   2e-38
UniRef50_A3XNP8 Cluster: Superoxide dismutase; n=1; Leeuwenhoeki...   161   3e-38
UniRef50_Q9TW89 Cluster: Superoxide dismutase [Fe]; n=251; cellu...   161   3e-38
UniRef50_Q03302 Cluster: Superoxide dismutase [Mn]; n=9; Halobac...   160   4e-38
UniRef50_Q0LCP1 Cluster: Twin-arginine translocation pathway sig...   159   9e-38
UniRef50_Q8SQV7 Cluster: Superoxide dismutase; n=1; Encephalitoz...   158   2e-37
UniRef50_Q07V83 Cluster: Superoxide dismutase precursor; n=5; Pr...   158   2e-37
UniRef50_Q4C9Q7 Cluster: Superoxide dismutase precursor; n=2; Ba...   156   6e-37
UniRef50_P80857 Cluster: Superoxide dismutase [Fe]; n=4; Thermop...   154   2e-36
UniRef50_O30826 Cluster: Superoxide dismutase [Mn]; n=65; root|R...   154   3e-36
UniRef50_P53638 Cluster: Superoxide dismutase [Fe]; n=9; Bactero...   153   6e-36
UniRef50_A7D0S4 Cluster: Superoxide dismutase; n=2; Halorubrum l...   153   8e-36
UniRef50_A7AGL0 Cluster: Putative uncharacterized protein; n=1; ...   152   1e-35
UniRef50_A6TPE4 Cluster: Superoxide dismutase; n=11; Bacteria|Re...   152   1e-35
UniRef50_Q9KNN7 Cluster: Superoxide dismutase; n=23; Vibrionacea...   151   3e-35
UniRef50_A7CXL5 Cluster: Superoxide dismutase precursor; n=1; Op...   150   5e-35
UniRef50_Q89AR7 Cluster: Superoxide dismutase [Mn]; n=4; Enterob...   150   5e-35
UniRef50_A0Q0B4 Cluster: Superoxide dismutase; n=1; Clostridium ...   149   9e-35
UniRef50_A3J5A6 Cluster: Superoxide dismutase; n=1; Flavobacteri...   148   2e-34
UniRef50_P19665 Cluster: Superoxide dismutase [Mn/Fe]; n=14; cel...   147   4e-34
UniRef50_Q2GCT5 Cluster: Superoxide dismutase, Fe; n=1; Neoricke...   146   5e-34
UniRef50_Q85M64 Cluster: Superoxide dismutase; n=1; Toxoplasma g...   146   5e-34
UniRef50_Q7NZQ4 Cluster: Superoxide dismutase; n=16; Bacteria|Re...   146   7e-34
UniRef50_Q30RH4 Cluster: Superoxide dismutase; n=1; Thiomicrospi...   144   2e-33
UniRef50_P18655 Cluster: Superoxide dismutase [Fe]; n=10; cellul...   142   8e-33
UniRef50_Q3YB09 Cluster: Manganese superoxide dismutase; n=4; ce...   141   2e-32
UniRef50_Q9A2K4 Cluster: Superoxide dismutase; n=3; Alphaproteob...   139   8e-32
UniRef50_Q8YFZ5 Cluster: SUPEROXIDE DISMUTASE; n=7; Rhizobiales|...   139   8e-32
UniRef50_A5FGP6 Cluster: Superoxide dismutase precursor; n=1; Fl...   139   1e-31
UniRef50_Q4ULI1 Cluster: Superoxide dismutase [Mn/Fe]; n=18; Pro...   139   1e-31
UniRef50_Q9KQF3 Cluster: Superoxide dismutase; n=35; Bacteria|Re...   138   1e-31
UniRef50_Q6MHD3 Cluster: Superoxide dismutase; n=1; Bdellovibrio...   138   1e-31
UniRef50_Q4QIE0 Cluster: Superoxide dismutase; n=14; Trypanosoma...   138   2e-31
UniRef50_Q89CM3 Cluster: Superoxide dismutase; n=2; Rhizobiales|...   137   3e-31
UniRef50_P77968 Cluster: Superoxide dismutase [Fe]; n=105; cellu...   137   3e-31
UniRef50_Q8GR34 Cluster: Superoxide dismutase precursor; n=9; ce...   135   2e-30
UniRef50_O30563 Cluster: Superoxide dismutase [Fe]; n=4; Borreli...   135   2e-30
UniRef50_Q6QF29 Cluster: Superoxide dismutase; n=1; Mycobacteriu...   134   4e-30
UniRef50_Q71S90 Cluster: Superoxide dismutase; n=13; Eukaryota|R...   134   4e-30
UniRef50_A5GMK3 Cluster: Superoxide dismutase [Fe]; n=10; cellul...   133   7e-30
UniRef50_A6LUJ7 Cluster: Superoxide dismutase; n=2; Clostridium ...   132   9e-30
UniRef50_Q6G141 Cluster: Superoxide dismutase; n=31; Bacteria|Re...   132   1e-29
UniRef50_Q8RPM8 Cluster: Superoxide dismutase; n=10; Alphaproteo...   130   5e-29
UniRef50_A1XRG3 Cluster: Superoxide dismutase; n=10; Ehrlichia r...   130   6e-29
UniRef50_Q0PBW9 Cluster: Superoxide dismutase [Fe]; n=60; Proteo...   128   2e-28
UniRef50_P21276 Cluster: Superoxide dismutase [Fe], chloroplast ...   127   3e-28
UniRef50_Q76B44 Cluster: Iron-superoxide dismutase; n=2; cellula...   127   4e-28
UniRef50_Q5NNM6 Cluster: Superoxide dismutase; n=3; Sphingomonad...   126   8e-28
UniRef50_Q5FB28 Cluster: Chloroplastic iron-superoxide dismutase...   126   8e-28
UniRef50_Q3SGN8 Cluster: Superoxide dismutase; n=1; Thiobacillus...   124   2e-27
UniRef50_Q6J6P7 Cluster: Superoxide dismutase; n=6; Plasmodium|R...   124   4e-27
UniRef50_Q1FM05 Cluster: Superoxide dismutase; n=1; Clostridium ...   123   5e-27
UniRef50_Q5CFH8 Cluster: Superoxide dismutase; n=4; Cryptosporid...   123   7e-27
UniRef50_Q4UIZ9 Cluster: Fe/Mn superoxide dismutase (SOD), putat...   123   7e-27
UniRef50_Q1GWF8 Cluster: Superoxide dismutase; n=4; Sphingomonad...   122   1e-26
UniRef50_UPI0000588D7C Cluster: PREDICTED: similar to manganese ...   120   4e-26
UniRef50_Q8YSZ1 Cluster: Superoxide dismutase [Fe]; n=26; Bacter...   120   7e-26
UniRef50_Q2GPK6 Cluster: Superoxide dismutase; n=1; Chaetomium g...   118   2e-25
UniRef50_Q8ISI9 Cluster: Superoxide dismutase; n=1; Perkinsus ma...   118   3e-25
UniRef50_A7RUV6 Cluster: Predicted protein; n=1; Nematostella ve...   118   3e-25
UniRef50_Q96UQ8 Cluster: Superoxide dismutase; n=1; Rhodotorula ...   116   6e-25
UniRef50_Q3SAW8 Cluster: Superoxide dismutase; n=3; Magnoliophyt...   116   1e-24
UniRef50_A4GXC5 Cluster: Superoxide dismutase; n=3; Plasmodium (...    91   1e-23
UniRef50_Q6BQZ0 Cluster: Superoxide dismutase; n=1; Debaryomyces...   111   3e-23
UniRef50_O67470 Cluster: Superoxide dismutase [Fe]; n=7; cellula...   109   1e-22
UniRef50_Q5IZD9 Cluster: Superoxide dismutase; n=1; Acanthamoeba...   108   2e-22
UniRef50_Q7CVP7 Cluster: Superoxide dismutase; n=2; Agrobacteriu...   108   2e-22
UniRef50_Q4N3K2 Cluster: Fe-superoxide dismutase, putative; n=2;...   106   9e-22
UniRef50_Q4Q512 Cluster: Superoxide dismutase, putative; n=9; Tr...   104   3e-21
UniRef50_Q2P0Y1 Cluster: Superoxide dismutase; n=11; Gammaproteo...   102   1e-20
UniRef50_Q5DGW3 Cluster: Superoxide dismutase; n=1; Schistosoma ...    98   2e-19
UniRef50_O08460 Cluster: Superoxide dismutase [Mn] 2; n=1; Halof...    97   4e-19
UniRef50_Q92454 Cluster: Manganese superoxide dismutase 2; n=1; ...    80   2e-18
UniRef50_A2EGG9 Cluster: Superoxide dismutase; n=17; Trichomonad...    94   4e-18
UniRef50_Q759W2 Cluster: Superoxide dismutase; n=1; Eremothecium...    92   2e-17
UniRef50_Q6QMV0 Cluster: Superoxide dismutase; n=12; Firmicutes|...    91   5e-17
UniRef50_Q4VG07 Cluster: Superoxide dismutase; n=1; Antonospora ...    90   6e-17
UniRef50_Q2I123 Cluster: Superoxide dismutase; n=1; Micromonospo...    80   6e-14
UniRef50_Q05FP8 Cluster: Superoxide dismutase; n=1; Candidatus C...    80   6e-14
UniRef50_Q2V193 Cluster: Superoxide dismutase; n=2; Streptococcu...    77   5e-13
UniRef50_Q89BS5 Cluster: Bll8073 protein; n=2; Rhizobiales|Rep: ...    75   2e-12
UniRef50_Q869C6 Cluster: Similar to Trichomonas vaginalis. Iron-...    74   4e-12
UniRef50_Q1GS79 Cluster: Manganese and iron superoxide dismutase...    73   1e-11
UniRef50_Q6L1T7 Cluster: Superoxide dismutase [Fe]; n=2; Thermop...    71   5e-11
UniRef50_P17550 Cluster: Superoxide dismutase [Fe]; n=9; Bacteri...    66   1e-09
UniRef50_A5V9D0 Cluster: Manganese and iron superoxide dismutase...    65   3e-09
UniRef50_Q8RBG3 Cluster: Superoxide dismutase; n=1; Thermoanaero...    64   3e-09
UniRef50_A4J6B5 Cluster: Manganese and iron superoxide dismutase...    64   5e-09
UniRef50_A5N0Y7 Cluster: Sod; n=1; Clostridium kluyveri DSM 555|...    63   1e-08
UniRef50_Q97G07 Cluster: Superoxide dismutase; n=1; Clostridium ...    62   2e-08
UniRef50_A7HBL1 Cluster: Manganese and iron superoxide dismutase...    60   7e-08
UniRef50_Q3ZXS9 Cluster: Superoxide dismutase; n=10; Bacteria|Re...    56   9e-07
UniRef50_O74379 Cluster: Mitochondrial ribosomal protein subunit...    56   9e-07
UniRef50_A5HZ65 Cluster: Superoxide dismutase [fe]; n=4; Clostri...    52   3e-05
UniRef50_Q95066 Cluster: Iron superoxide dismutase; n=5; Trichom...    52   3e-05
UniRef50_A5DI52 Cluster: Putative uncharacterized protein; n=1; ...    52   3e-05
UniRef50_Q75PV6 Cluster: Superoxide dismutase; n=1; Paramecium b...    51   3e-05
UniRef50_UPI000023DF06 Cluster: hypothetical protein FG07069.1; ...    48   4e-04
UniRef50_A0BGE1 Cluster: Chromosome undetermined scaffold_106, w...    43   0.009
UniRef50_O42919 Cluster: Superoxide dismutase; n=1; Schizosaccha...    43   0.012
UniRef50_Q2HFL4 Cluster: Putative uncharacterized protein; n=1; ...    42   0.028
UniRef50_Q4P0E6 Cluster: Putative uncharacterized protein; n=1; ...    41   0.048
UniRef50_Q59593 Cluster: Superoxide dismutase; n=1; Nocardia ast...    40   0.064
UniRef50_A4RF21 Cluster: Putative uncharacterized protein; n=1; ...    40   0.064
UniRef50_A0D834 Cluster: Superoxide dismutase; n=1; Paramecium t...    40   0.085
UniRef50_Q7S2H6 Cluster: Putative uncharacterized protein NCU073...    39   0.20 
UniRef50_P47141 Cluster: Mitochondrial 37S ribosomal protein S26...    39   0.20 
UniRef50_Q848L2 Cluster: SodA; n=1; uncultured bacterium|Rep: So...    38   0.26 
UniRef50_A5VNS3 Cluster: Fe-superoxide dismutase; n=1; Brucella ...    38   0.45 
UniRef50_A5DIH0 Cluster: Putative uncharacterized protein; n=1; ...    36   1.8  
UniRef50_Q1V005 Cluster: Phosphoribosylaminoimidazole carboxylas...    35   3.2  
UniRef50_Q5A922 Cluster: Potential mitochondrial protein Fmp29; ...    34   4.2  
UniRef50_Q1HG45 Cluster: Superoxide dismutase; n=1; Sporothrix s...    34   4.2  
UniRef50_Q0UWI2 Cluster: Putative uncharacterized protein; n=1; ...    34   4.2  
UniRef50_A6SRX5 Cluster: Putative uncharacterized protein; n=2; ...    34   4.2  
UniRef50_Q07GT1 Cluster: VirB4 protein, putative; n=1; Roseobact...    34   5.6  
UniRef50_A0D7E8 Cluster: Chromosome undetermined scaffold_4, who...    34   5.6  
UniRef50_Q2U4N0 Cluster: Predicted protein; n=1; Aspergillus ory...    33   7.4  

>UniRef50_P04179 Cluster: Superoxide dismutase [Mn], mitochondrial
           precursor; n=175; root|Rep: Superoxide dismutase [Mn],
           mitochondrial precursor - Homo sapiens (Human)
          Length = 222

 Score =  308 bits (757), Expect = 1e-82
 Identities = 135/196 (68%), Positives = 161/196 (82%), Gaps = 1/196 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 22  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQ 81

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+D  K +L+ ASV 
Sbjct: 82  IALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVG 141

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 142 VQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 201

Query: 675 KAIFDVANWNDISQRY 722
           KAI++V NW ++++RY
Sbjct: 202 KAIWNVINWENVTERY 217


>UniRef50_P09671 Cluster: Superoxide dismutase [Mn], mitochondrial
           precursor; n=49; Eukaryota|Rep: Superoxide dismutase
           [Mn], mitochondrial precursor - Mus musculus (Mouse)
          Length = 222

 Score =  305 bits (749), Expect = 9e-82
 Identities = 133/208 (63%), Positives = 166/208 (79%), Gaps = 1/208 (0%)
 Frame = +3

Query: 102 QRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKL 281
           +R+G +   AG SR KH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLN  EEK 
Sbjct: 11  RRLGPVAGAAG-SRHKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNATEEKY 69

Query: 282 AQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWD 458
            +A AKGD+ T + L PALKFNGGGHINH+IFW NLSP GG +P   L +A+++DFGS++
Sbjct: 70  HEALAKGDVTTQVALQPALKFNGGGHINHTIFWTNLSPKGGGEPKGELLEAIKRDFGSFE 129

Query: 459 NIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAY 638
             K +L+  SV VQGSGWGWLG+NK+  +LQIA C NQDPLQ TTGL+PL GIDVWEHAY
Sbjct: 130 KFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAY 189

Query: 639 YLQYKNVRADYVKAIFDVANWNDISQRY 722
           YLQYKNVR DY+KAI++V NW ++++RY
Sbjct: 190 YLQYKNVRPDYLKAIWNVINWENVTERY 217


>UniRef50_Q00637 Cluster: Superoxide dismutase [Mn], mitochondrial
           precursor; n=6; Diptera|Rep: Superoxide dismutase [Mn],
           mitochondrial precursor - Drosophila melanogaster (Fruit
           fly)
          Length = 217

 Score =  304 bits (747), Expect = 2e-81
 Identities = 132/197 (67%), Positives = 163/197 (82%)
 Frame = +3

Query: 141 RQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTII 320
           R KHTLP+LPY+Y ALEP+I REIM LHH KHH TY+NNLN AEE+L +A++K D   +I
Sbjct: 16  RGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTKLI 75

Query: 321 NLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQ 500
            LAPAL+FNGGGHINH+IFW NLSPN  +PSD L KA+E  + S +  K +L+T +VAVQ
Sbjct: 76  QLAPALRFNGGGHINHTIFWQNLSPNKTQPSDDLKKAIESQWKSLEEFKKELTTLTVAVQ 135

Query: 501 GSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKA 680
           GSGWGWLG+NK+  KLQ+A   NQDPL+A+TGL+PLFGIDVWEHAYYLQYKNVR  YV+A
Sbjct: 136 GSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYVEA 195

Query: 681 IFDVANWNDISQRYEKA 731
           I+D+ANW+DIS R+++A
Sbjct: 196 IWDIANWDDISCRFQEA 212


>UniRef50_Q5MIQ2 Cluster: Superoxide dismutase; n=2; Stegomyia|Rep:
           Superoxide dismutase - Aedes albopictus (Forest day
           mosquito)
          Length = 219

 Score =  298 bits (732), Expect = 1e-79
 Identities = 136/218 (62%), Positives = 161/218 (73%), Gaps = 2/218 (0%)
 Frame = +3

Query: 84  VIMLMSQRIGSLIRVAGA--SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINN 257
           ++ L S  +GS   VA     R KHTLP+LPY++ ALEPVI REIM +HH KHH  Y+ N
Sbjct: 1   MLALRSAVLGSSRNVAAVLGCRNKHTLPDLPYDFGALEPVICREIMEVHHQKHHNAYVTN 60

Query: 258 LNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVE 437
           LN AEE+L +A AK D   II L  ALKFNGGGHINHSIFW NLSP+   PS  L K ++
Sbjct: 61  LNAAEEQLKEAVAKNDASKIIQLGSALKFNGGGHINHSIFWKNLSPDRSDPSAELKKLLD 120

Query: 438 KDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGI 617
           +D    DN K ++  A+VAVQGSGW WLGYNK+ K LQ+A C NQDPL+ATTGLVPLFGI
Sbjct: 121 RDLQGLDNFKKEMKAAAVAVQGSGWAWLGYNKKTKALQVAACPNQDPLEATTGLVPLFGI 180

Query: 618 DVWEHAYYLQYKNVRADYVKAIFDVANWNDISQRYEKA 731
           DVWEHAYYLQYKN+R +YV AI+DV NW D+S+R  KA
Sbjct: 181 DVWEHAYYLQYKNLRPNYVDAIWDVVNWKDVSERLAKA 218


>UniRef50_Q27YV0 Cluster: Superoxide dismutase; n=15; Coelomata|Rep:
           Superoxide dismutase - Penaeus vannamei (Penoeid shrimp)
           (European white shrimp)
          Length = 287

 Score =  274 bits (672), Expect = 2e-72
 Identities = 118/201 (58%), Positives = 153/201 (76%), Gaps = 1/201 (0%)
 Frame = +3

Query: 132 GASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDID 311
           G  R  H LP L Y++NALEP IS  IM +HH+KHH  YINNL  A +KL +A+A  D+ 
Sbjct: 81  GEERGAHALPPLKYDFNALEPHISGMIMEIHHTKHHQGYINNLIAATKKLVEAEAANDVS 140

Query: 312 TIINLAPALKFNGGGHINHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTAS 488
            +  L PA+KFNGGGH+NH+IFW N++P+ GG+P   + +A+++ FGS+ + K++ S AS
Sbjct: 141 AMNALLPAIKFNGGGHLNHTIFWTNMAPDAGGEPQGAVAQAIDESFGSFQSFKDKFSAAS 200

Query: 489 VAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRAD 668
           V V+GSGWGWLGY     KL+IATCQNQDPLQ T GLVPL G+DVWEHAYYLQYKN+RAD
Sbjct: 201 VGVKGSGWGWLGYCPNQNKLEIATCQNQDPLQITHGLVPLLGLDVWEHAYYLQYKNLRAD 260

Query: 669 YVKAIFDVANWNDISQRYEKA 731
           YVKA F+V NW ++++R+E A
Sbjct: 261 YVKAFFNVINWENVNERHENA 281


>UniRef50_O81235 Cluster: Superoxide dismutase [Mn], mitochondrial
           precursor; n=52; cellular organisms|Rep: Superoxide
           dismutase [Mn], mitochondrial precursor - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 231

 Score =  241 bits (591), Expect = 1e-62
 Identities = 115/209 (55%), Positives = 144/209 (68%), Gaps = 5/209 (2%)
 Frame = +3

Query: 117 LIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQA 296
           L+R+ G   Q  TLP+LPY+Y ALEP IS EIM +HH KHH  Y+ N N A E+L QA  
Sbjct: 22  LLRIRGI--QTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVN 79

Query: 297 KGDIDTIINLAPALKFNGGGHINHSIFWHNLSPN---GGK-PSDVLTKAVEKDFGSWDNI 464
           KGD  T++ L  A+KFNGGGH+NHSIFW NL+P+   GG+ P   L  A++  FGS + +
Sbjct: 80  KGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSSEGGGEPPKGSLGSAIDAHFGSLEGL 139

Query: 465 KNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTG-LVPLFGIDVWEHAYY 641
             ++S    AVQGSGW WLG +K++KKL + T  NQDPL    G LVPL GIDVWEHAYY
Sbjct: 140 VKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYY 199

Query: 642 LQYKNVRADYVKAIFDVANWNDISQRYEK 728
           LQYKNVR +Y+K ++ V NW   S+ YEK
Sbjct: 200 LQYKNVRPEYLKNVWKVINWKYASEVYEK 228


>UniRef50_P09233 Cluster: Superoxide dismutase [Mn] 3.1,
           mitochondrial precursor; n=9; Eukaryota|Rep: Superoxide
           dismutase [Mn] 3.1, mitochondrial precursor - Zea mays
           (Maize)
          Length = 235

 Score =  227 bits (555), Expect = 3e-58
 Identities = 106/199 (53%), Positives = 134/199 (67%), Gaps = 5/199 (2%)
 Frame = +3

Query: 153 TLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAP 332
           TLP+L Y++ ALEP IS EIM LHH KHHATY+ N N A E+L  A +KGD   ++ L  
Sbjct: 36  TLPDLSYDFGALEPAISGEIMRLHHQKHHATYVANYNKALEQLETAVSKGDASAVVQLQA 95

Query: 333 ALKFNGGGHINHSIFWHNLSP---NGGK-PSDVLTKAVEKDFGSWDNIKNQLSTASVAVQ 500
           A+KFNGGGH+NHSIFW NL P    GG+ P   L  A+++DFGS++ +  +++    A+Q
Sbjct: 96  AIKFNGGGHVNHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSFEALVKKMNAEGAALQ 155

Query: 501 GSGWGWLGYNKQMKKLQIATCQNQDPLQAT-TGLVPLFGIDVWEHAYYLQYKNVRADYVK 677
           GSGW WL  +K+ KK+ + T  NQDPL      LVPL GIDVWEHAYYLQYKNVR DY+ 
Sbjct: 156 GSGWVWLALDKEAKKVSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLN 215

Query: 678 AIFDVANWNDISQRYEKAL 734
            I+ V NW    + YE  L
Sbjct: 216 NIWKVMNWKYAGEVYENVL 234


>UniRef50_Q92429 Cluster: Superoxide dismutase [Mn], mitochondrial
           precursor; n=46; Agaricomycotina|Rep: Superoxide
           dismutase [Mn], mitochondrial precursor - Ganoderma
           microsporum
          Length = 200

 Score =  217 bits (531), Expect = 2e-55
 Identities = 105/202 (51%), Positives = 138/202 (68%), Gaps = 8/202 (3%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           H LP+LPY YNALEP IS++IM LHH KHH TY+N+LN AE+  A+A    +    I L 
Sbjct: 3   HVLPDLPYAYNALEPFISQQIMELHHKKHHQTYVNSLNAAEQAYAKASTPKE---RIALQ 59

Query: 330 PALKFNGGGHINHSIFWHNLSP-------NGGKPSD-VLTKAVEKDFGSWDNIKNQLSTA 485
            ALKFNGGGHINHS+FW NL+P       NGG  +D  L  A+E+++GS DN   + +  
Sbjct: 60  SALKFNGGGHINHSLFWKNLAPAKSEGKGNGGALADGPLKSAIEQNWGSVDNFIKEFNAT 119

Query: 486 SVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRA 665
           + A+QGSGWGWLG N   K+L+I T  NQDPL +    VP+ G+D+WEHA+YLQY NV+A
Sbjct: 120 TAAIQGSGWGWLGLNPATKRLEITTTANQDPLLSH---VPIIGVDIWEHAFYLQYLNVKA 176

Query: 666 DYVKAIFDVANWNDISQRYEKA 731
           DY+ AI+ V N+ +  +R  +A
Sbjct: 177 DYLAAIWIVINFKEAERRLIEA 198


>UniRef50_Q9Y783 Cluster: Superoxide dismutase [Mn], mitochondrial
           precursor; n=42; Dikarya|Rep: Superoxide dismutase [Mn],
           mitochondrial precursor - Neurospora crassa
          Length = 245

 Score =  208 bits (507), Expect = 2e-52
 Identities = 104/213 (48%), Positives = 136/213 (63%), Gaps = 8/213 (3%)
 Frame = +3

Query: 111 GSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQA 290
           G+   +AG +   ++LP+LPY YNALEP IS +IM LHHSKHH TY+ NLN A +    A
Sbjct: 23  GNATTMAGLAT--YSLPQLPYAYNALEPYISAQIMELHHSKHHQTYVTNLNNALKVHVAA 80

Query: 291 QAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSP------NGGKPSDVLTKAVEKDFGS 452
            A  DI   I   PA+KFNGGGHINHS+FW NL+P      N  K +  L   +EK +GS
Sbjct: 81  IASSDIPAQIAQQPAIKFNGGGHINHSLFWKNLAPAETPETNYSKAAPSLAAEIEKTWGS 140

Query: 453 WDNIKNQLSTASVAVQGSGWGWLGYNKQMKK--LQIATCQNQDPLQATTGLVPLFGIDVW 626
           +D  K   S A + +QGSGWGWL      +K  L+I T ++QDP+    G VP+FG+D+W
Sbjct: 141 FDEFKKAFSAALLGIQGSGWGWLVKESTAEKGRLRIITTKDQDPV--VGGEVPVFGVDMW 198

Query: 627 EHAYYLQYKNVRADYVKAIFDVANWNDISQRYE 725
           EHAYYLQY N +A YV+ I+ V NW    +R++
Sbjct: 199 EHAYYLQYLNGKAAYVENIWKVINWKTAEERFQ 231


>UniRef50_Q873M4 Cluster: Superoxide dismutase; n=2;
           Basidiomycota|Rep: Superoxide dismutase - Malassezia
           sympodialis (Opportunistic yeast)
          Length = 237

 Score =  196 bits (479), Expect = 5e-49
 Identities = 93/214 (43%), Positives = 134/214 (62%), Gaps = 4/214 (1%)
 Frame = +3

Query: 105 RIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLA 284
           R+    R A  +  +HTLP LPYEYNALEP IS +IM +HH KHH TY+NNLN + +   
Sbjct: 24  RLFRFSRTAARAGTEHTLPPLPYEYNALEPFISADIMMVHHGKHHQTYVNNLNASTKAYN 83

Query: 285 QAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSP---NGGKPSD-VLTKAVEKDFGS 452
            A    D+   + L  A+KFNGGGH+NH++FW  ++P    GG+ +D  L +A++K+FG 
Sbjct: 84  DAVQAQDVLKQMELLTAVKFNGGGHVNHALFWKTMAPQSQGGGQLNDGPLKQAIDKEFGD 143

Query: 453 WDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEH 632
           ++  K   +  ++ +QGSGW WLG +K    L +   ++QD L   T   P+ G D WEH
Sbjct: 144 FEKFKAAFTAKALGIQGSGWCWLGLSK-TGSLDLVVAKDQDTL---TTHHPIIGWDGWEH 199

Query: 633 AYYLQYKNVRADYVKAIFDVANWNDISQRYEKAL 734
           A+YLQYKN +A Y+K  ++V NW++   RY + L
Sbjct: 200 AWYLQYKNDKASYLKQWWNVVNWSEAESRYSEGL 233


>UniRef50_P19666 Cluster: Superoxide dismutase [Fe]; n=3;
           Tetrahymena|Rep: Superoxide dismutase [Fe] - Tetrahymena
           pyriformis
          Length = 196

 Score =  196 bits (477), Expect = 8e-49
 Identities = 89/196 (45%), Positives = 127/196 (64%), Gaps = 6/196 (3%)
 Frame = +3

Query: 165 LPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKF 344
           L YEY+ LEPV+S  ++S HH KHH  Y+NNLN   E++A A  + D   I  L  AL+F
Sbjct: 1   LNYEYSDLEPVLSAHLLSFHHGKHHQAYVNNLNATYEQIAAATKENDAHKIATLQSALRF 60

Query: 345 NGGGHINHSIFWHNLSP---NGGKPSD---VLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
           N GGH+NH I+W NL+P    GG   D    LTKA+++ +GS++N     +T + A+QGS
Sbjct: 61  NLGGHVNHWIYWDNLAPVKSGGGVLPDEHSPLTKAIKEKWGSYENFITLFNTRTAAIQGS 120

Query: 507 GWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
           GWGWLGY+   K L++    NQD +   + +VPL  IDVWEHAYYL Y+N+R  Y+  ++
Sbjct: 121 GWGWLGYDTVSKSLRLFELGNQD-MPEWSSIVPLLTIDVWEHAYYLDYQNLRPKYLTEVW 179

Query: 687 DVANWNDISQRYEKAL 734
            + NW ++ +RY +A+
Sbjct: 180 KIVNWREVEKRYLQAI 195


>UniRef50_Q2B678 Cluster: Superoxide dismutase; n=1; Bacillus sp.
           NRRL B-14911|Rep: Superoxide dismutase - Bacillus sp.
           NRRL B-14911
          Length = 296

 Score =  195 bits (476), Expect = 1e-48
 Identities = 89/195 (45%), Positives = 128/195 (65%), Gaps = 1/195 (0%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           H+LP LPY Y++LEP I+ EIM LHH+KHH +Y++ LN AEE L +A+  GD   + + +
Sbjct: 95  HSLPPLPYGYDSLEPYIAEEIMRLHHTKHHQSYVDGLNRAEEMLKKARQDGDFKLVKHWS 154

Query: 330 PALKFNGGGHINHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
             L F+G GH  H+IFW+N+SP+ GGKPS  L   +EK FGS++  K   S A+  V+G 
Sbjct: 155 RELAFHGSGHYLHTIFWNNMSPSGGGKPSGALLGEIEKYFGSFEQFKKHFSEAAKQVEGV 214

Query: 507 GWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
           GW  L ++ + + L+I   + +  L      +P+  +DVWEHAYYLQYKN RADYV   +
Sbjct: 215 GWAILVWSPRSRHLEILQSE-RHMLLTQWDTIPILALDVWEHAYYLQYKNNRADYVNNWW 273

Query: 687 DVANWNDISQRYEKA 731
           ++ NW D  +R++KA
Sbjct: 274 NIVNWKDAEERFQKA 288


>UniRef50_Q01E96 Cluster: Superoxide dismutase; n=1; Ostreococcus
           tauri|Rep: Superoxide dismutase - Ostreococcus tauri
          Length = 213

 Score =  191 bits (465), Expect = 2e-47
 Identities = 87/152 (57%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPA 335
           LP+L Y+++ALEPVIS EIM LHH KHH  Y+ N NVA+EKLA+AQAKGD  T I + PA
Sbjct: 27  LPDLEYDFSALEPVISGEIMELHHQKHHKAYVTNFNVAQEKLAEAQAKGDFSTAIAMQPA 86

Query: 336 LKFNGGGHINHSIFWHNLS--PNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSG 509
           +KFNGGGH+NHS+FW  L+   +   P   L K +E+DFGS   +++  + A+VAVQGSG
Sbjct: 87  IKFNGGGHVNHSMFWKCLTAPKDYALPEGALLKMIERDFGSLSAMQDTFTAATVAVQGSG 146

Query: 510 WGWLGYNKQMKKLQIATCQNQDPLQATTGLVP 605
           WGWLGY+K  K+L + T  NQDP   TTGL P
Sbjct: 147 WGWLGYDKANKRLAVTTTANQDPC-VTTGLTP 177


>UniRef50_P0A4J6 Cluster: Superoxide dismutase [Mn]; n=170;
           Bacteria|Rep: Superoxide dismutase [Mn] - Streptococcus
           pneumoniae
          Length = 201

 Score =  188 bits (457), Expect = 2e-46
 Identities = 89/198 (44%), Positives = 122/198 (61%), Gaps = 6/198 (3%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAK-----GDIDTI- 317
           LPELPY Y+ALEP I  E M LHH KHH TY+NN N A EK  +          D+++I 
Sbjct: 5   LPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEKHPEIGEDLEALLADVESIP 64

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAV 497
            ++  AL  NGGGH+NH++FW  ++P    PS  L  A++  FGS++  +   + A+   
Sbjct: 65  ADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAIDATFGSFEEFQAAFTAAATTR 124

Query: 498 QGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVK 677
            GSGW WL  NK+  KL++ +  NQD    + G  P+ G+DVWEHAYY++Y+NVR DY+K
Sbjct: 125 FGSGWAWLVVNKE-GKLEVTSTANQD-TPISEGKKPILGLDVWEHAYYVKYRNVRPDYIK 182

Query: 678 AIFDVANWNDISQRYEKA 731
           A F V NWN + + Y  A
Sbjct: 183 AFFSVINWNKVDELYAAA 200


>UniRef50_Q5WH01 Cluster: Superoxide dismutase [Cu-Zn]; n=1;
           Bacillus clausii KSM-K16|Rep: Superoxide dismutase
           [Cu-Zn] - Bacillus clausii (strain KSM-K16)
          Length = 288

 Score =  187 bits (455), Expect = 4e-46
 Identities = 85/195 (43%), Positives = 121/195 (62%), Gaps = 1/195 (0%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           H LP +PY YNALEP I  + M LHH KHH TY+N+LN AE+++ +A+  G+ D I +  
Sbjct: 87  HRLPPMPYSYNALEPYIDAKTMRLHHLKHHQTYVNDLNKAEKEMEKARRTGNYDLIKHWE 146

Query: 330 PALKFNGGGHINHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
               FNG GH  H++FWH +SPN GG+P  +L   + +DFGS+  +K   S A+  V+G 
Sbjct: 147 REAAFNGAGHYLHTLFWHVMSPNGGGEPQGLLKARITEDFGSFQKMKAHFSNAAEKVEGG 206

Query: 507 GWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
           GW  L Y  +  +L+I   +    L +    VPL  +DVWEHAYYL+Y+N R  Y++A +
Sbjct: 207 GWAMLIYAPRSHRLEILQAEKHQNL-SQQDQVPLLVLDVWEHAYYLKYQNERKAYIEAWW 265

Query: 687 DVANWNDISQRYEKA 731
           +V NW +   RY +A
Sbjct: 266 NVVNWKEAENRYRQA 280


>UniRef50_O35023 Cluster: Probable superoxide dismutase [Fe]; n=3;
           Bacillus|Rep: Probable superoxide dismutase [Fe] -
           Bacillus subtilis
          Length = 281

 Score =  186 bits (453), Expect = 7e-46
 Identities = 87/196 (44%), Positives = 127/196 (64%), Gaps = 1/196 (0%)
 Frame = +3

Query: 147 KHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINL 326
           KH LP+LPY+Y+ALEP ISR+IM LHH+KHH +Y++ LN AE +L +A+A  + D I + 
Sbjct: 79  KHVLPKLPYKYSALEPYISRDIMILHHTKHHQSYVDGLNKAESELKKARATKNYDLITHW 138

Query: 327 APALKFNGGGHINHSIFWHNLSPNG-GKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG 503
              L F+G GH  HSIFW ++ PNG  +P+  L + ++  FGS+   K   + AS  V+G
Sbjct: 139 ERELAFHGAGHYLHSIFWFSMHPNGKRRPTGALFQMIDLSFGSYSAFKEHFTQASKKVEG 198

Query: 504 SGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAI 683
            GW  L +  +  +L+I T +    L +   ++PL  +DVWEHAYYLQYKN RA YV   
Sbjct: 199 VGWAILVWAPRSGRLEILTAEKHQ-LFSQWDVIPLLPLDVWEHAYYLQYKNDRASYVDHW 257

Query: 684 FDVANWNDISQRYEKA 731
           ++V +W +  +R+E+A
Sbjct: 258 WNVVDWREAEKRFEQA 273


>UniRef50_Q9Y8H8 Cluster: Superoxide dismutase [Mn/Fe]; n=7;
           Archaea|Rep: Superoxide dismutase [Mn/Fe] - Aeropyrum
           pernix
          Length = 214

 Score =  185 bits (451), Expect = 1e-45
 Identities = 91/203 (44%), Positives = 123/203 (60%), Gaps = 4/203 (1%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           S +++ LP LPY YNALEP I  EIM LHH KHH TY+   N A EK+ +   KG+I   
Sbjct: 3   SFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKI-EKHLKGEIQID 61

Query: 318 INLAPA-LKFNGGGHINHSIFWHNLSP---NGGKPSDVLTKAVEKDFGSWDNIKNQLSTA 485
           +        FN  GHI H+IFW N++P    GG P   +   +EK FG ++  K   S A
Sbjct: 62  VRAVMRDFSFNYAGHIMHTIFWPNMAPPGKGGGTPGGRVADLIEKQFGGFEKFKALFSAA 121

Query: 486 SVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRA 665
           +  V+G GWG L ++   ++L+I   +  + L  T GLVP+  IDVWEHAYYLQYKN R 
Sbjct: 122 AKTVEGVGWGVLAFDPLTEELRILQVEKHNVLM-TAGLVPILVIDVWEHAYYLQYKNDRG 180

Query: 666 DYVKAIFDVANWNDISQRYEKAL 734
            YV+  ++V NW+D+ +R E+AL
Sbjct: 181 SYVENWWNVVNWDDVEKRLEQAL 203


>UniRef50_Q9KD10 Cluster: Superoxide dismutase [Mn]; n=68; cellular
           organisms|Rep: Superoxide dismutase [Mn] - Bacillus
           halodurans
          Length = 202

 Score =  184 bits (447), Expect = 4e-45
 Identities = 92/201 (45%), Positives = 126/201 (62%), Gaps = 9/201 (4%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEE---KLAQAQAKG---DIDTI 317
           LP+LPY  NALEP I    M++HH KHH TY+  LN A E    LA+   +    D+D +
Sbjct: 5   LPKLPYPANALEPHIDEATMNIHHGKHHNTYVTKLNAALEGHSALAEKSIEALVSDLDAV 64

Query: 318 I-NLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASV 491
             N+  A++ NGGGH NH++FW  LSPNGG  P+  L  A+  +FGS+D  K + + A+ 
Sbjct: 65  PENIRTAVRNNGGGHANHTLFWQILSPNGGGAPTGELADAINAEFGSFDQFKEKFADAAA 124

Query: 492 AVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQYKNVRAD 668
              GSGW WL  N    KL+I +  NQD PL    G  P+ G+DVWEHAYYL Y+N R D
Sbjct: 125 NRFGSGWAWLVVNDG--KLEITSTPNQDTPLME--GKTPILGLDVWEHAYYLNYQNRRPD 180

Query: 669 YVKAIFDVANWNDISQRYEKA 731
           Y+ A ++V NW+++++RY +A
Sbjct: 181 YISAFWNVVNWDEVAKRYNEA 201


>UniRef50_Q5KXL3 Cluster: Superoxide dismutase; n=20; cellular
           organisms|Rep: Superoxide dismutase - Geobacillus
           kaustophilus
          Length = 411

 Score =  182 bits (443), Expect = 1e-44
 Identities = 81/196 (41%), Positives = 123/196 (62%), Gaps = 1/196 (0%)
 Frame = +3

Query: 147 KHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINL 326
           +H LP LPY Y+ALEP IS EIM LHH+KHH +Y++ LN AE  +A+A+   + D + + 
Sbjct: 209 RHVLPPLPYRYDALEPHISEEIMRLHHTKHHQSYVDGLNQAERMMAEARRTNNFDLLKHW 268

Query: 327 APALKFNGGGHINHSIFWHNLSP-NGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG 503
                F+G GH  H+IFW+N+ P  GG+P   L   +E+DFGS+   +   + A+ + +G
Sbjct: 269 EREAAFHGSGHYLHTIFWYNMHPEGGGEPRGELRAQIERDFGSFTAFRRHFTEAAKSAEG 328

Query: 504 SGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAI 683
            GW  L +  +  +L+I   +    L A   ++PL  +DVWEHAYYLQYKN RA Y++  
Sbjct: 329 VGWALLVWAPRAHRLEILQAEKHQ-LMAQWDVIPLLVLDVWEHAYYLQYKNDRAAYIEHW 387

Query: 684 FDVANWNDISQRYEKA 731
           ++V NW ++ +R+ +A
Sbjct: 388 WNVVNWRNVEERFHEA 403


>UniRef50_Q81T03 Cluster: Superoxide dismutase; n=10; Bacillus
           cereus group|Rep: Superoxide dismutase - Bacillus
           anthracis
          Length = 304

 Score =  179 bits (435), Expect = 1e-43
 Identities = 84/195 (43%), Positives = 118/195 (60%), Gaps = 1/195 (0%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           HTLP LPY YNALEP ISREIM LHH KHH +Y+  LN AE+ + +A+     D I +  
Sbjct: 103 HTLPPLPYPYNALEPYISREIMMLHHDKHHRSYVEGLNKAEKMMEEARKTNQFDLIKHWE 162

Query: 330 PALKFNGGGHINHSIFWHNLSP-NGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
               F+G GH  H+IFW+N+    GG P   L+  +E+DFGS+   +   + A+  V+GS
Sbjct: 163 REAAFHGSGHYLHTIFWNNMKKGGGGSPRGALSHRIEQDFGSFLRFQKHFTEAASKVEGS 222

Query: 507 GWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
           GW  L +  +  +L+I        L      +PL  +DVWEHAYYLQY+N + +Y+K  +
Sbjct: 223 GWAILVWVPRSGRLEILQ-STLHQLFTQWDTIPLLVLDVWEHAYYLQYQNRKDEYIKNWW 281

Query: 687 DVANWNDISQRYEKA 731
           +V NW D+ +R+E A
Sbjct: 282 NVVNWPDVEKRFESA 296


>UniRef50_O51917 Cluster: Superoxide dismutase [Fe-Zn] 1; n=260;
           cellular organisms|Rep: Superoxide dismutase [Fe-Zn] 1 -
           Streptomyces coelicolor
          Length = 213

 Score =  177 bits (431), Expect = 3e-43
 Identities = 87/200 (43%), Positives = 120/200 (60%), Gaps = 6/200 (3%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           +TLPELPY+Y+AL PVIS EI+ LHH KHHA Y+   N   E+LA+A+ K    +I  L 
Sbjct: 4   YTLPELPYDYSALAPVISPEIIELHHDKHHAAYVKGANDTLEQLAEARDKETWGSINGLE 63

Query: 330 PALKFNGGGHINHSIFWHNLS-PNGGKPSD-----VLTKAVEKDFGSWDNIKNQLSTASV 491
             L F+  GHI HSI+WHN++   GG+P D      L  A+ + FGS+   + QL+ A+ 
Sbjct: 64  KNLAFHLSGHILHSIYWHNMTGDGGGEPLDKDGVGELADAIAESFGSFAGFRAQLTKAAA 123

Query: 492 AVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADY 671
             QGSGWG L Y     +L +    +        G  P+   D WEHA+YLQYKN + D+
Sbjct: 124 TTQGSGWGVLAYEPLSGRLIVEQIYDHQG-NVGQGSTPILVFDAWEHAFYLQYKNQKVDF 182

Query: 672 VKAIFDVANWNDISQRYEKA 731
           + A++ V NW D+++RYE A
Sbjct: 183 IDAMWAVVNWQDVARRYEAA 202


>UniRef50_A0BGP5 Cluster: Superoxide dismutase; n=2; Paramecium
           tetraurelia|Rep: Superoxide dismutase - Paramecium
           tetraurelia
          Length = 206

 Score =  175 bits (427), Expect = 9e-43
 Identities = 85/198 (42%), Positives = 118/198 (59%), Gaps = 4/198 (2%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           HTLP L Y Y+ LEPV+S  ++  HHSKHH  YINNLN A+E+L  A  K D+  I  L 
Sbjct: 17  HTLPALKYGYSDLEPVLSATLLEFHHSKHHQAYINNLNAAQEQLEDALTKNDVQKIATLQ 76

Query: 330 PALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSW---DNIKNQLSTA-SVAV 497
             +KFN GGH+NHS+    L PN         +   +   SW    +++NQ     + A+
Sbjct: 77  GTIKFNLGGHLNHSVVLGELDPN---------QEWRRTITSWKQCSSLRNQQKLGKTAAI 127

Query: 498 QGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVK 677
           QGSGWG+LG ++Q KKL+     NQ+ +    GL P+  IDVWEHAY+  YKNVR +++ 
Sbjct: 128 QGSGWGFLGVDQQSKKLRYLELPNQE-IPQNYGLTPILTIDVWEHAYWWDYKNVRPNFLA 186

Query: 678 AIFDVANWNDISQRYEKA 731
            ++ + NW D+  RY +A
Sbjct: 187 NVWKIVNWKDVEARYNQA 204


>UniRef50_Q6CBQ1 Cluster: Superoxide dismutase; n=1; Yarrowia
           lipolytica|Rep: Superoxide dismutase - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 206

 Score =  175 bits (427), Expect = 9e-43
 Identities = 86/178 (48%), Positives = 114/178 (64%), Gaps = 4/178 (2%)
 Frame = +3

Query: 183 ALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHI 362
           ALEP IS +IM +HHSKHH TY+NNLN A ++L +A A  D+   I L  A+ FNGGGH+
Sbjct: 18  ALEPQISAQIMEIHHSKHHQTYVNNLNAATKQLQEAVAANDVVRQIALQKAINFNGGGHV 77

Query: 363 NHSIFWHNLSP---NGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWL-GYN 530
           NHSIFW +L+P   +G K    L + + K FGS D  K +L    +A+QGSGW WL  Y 
Sbjct: 78  NHSIFWKSLTPSSSDGAKGGAKLKEEIAKQFGSLDEFKAKLKADLLALQGSGWAWLVSYP 137

Query: 531 KQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWN 704
               K+++ +  NQD + A  G V L GID WEHAYY+QY N +A Y   +++V NW+
Sbjct: 138 DGTLKIEVTS--NQDAISA-PGAVTLLGIDFWEHAYYIQYYNNKAAYFDNLWEVLNWD 192


>UniRef50_P00447 Cluster: Superoxide dismutase [Mn], mitochondrial
           precursor; n=17; Saccharomycetales|Rep: Superoxide
           dismutase [Mn], mitochondrial precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 233

 Score =  175 bits (426), Expect = 1e-42
 Identities = 90/209 (43%), Positives = 128/209 (61%), Gaps = 12/209 (5%)
 Frame = +3

Query: 135 ASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEK-------LAQAQ 293
           A R K TLP+L +++ ALEP IS +I  LH++KHH TY+N  N A ++       LA+  
Sbjct: 23  ARRTKVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQFQELSDLLAKEP 82

Query: 294 AKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPN---GGKP-SDVLTKAVEKDFGSWDN 461
           +  +   +I +   +KF+GGG  NH +FW NL+P    GG+P +  L KA+++ FGS D 
Sbjct: 83  SPANARKMIAIQQNIKFHGGGFTNHCLFWENLAPESQGGGEPPTGALAKAIDEQFGSLDE 142

Query: 462 IKNQLSTASVAVQGSGWGWLGYN-KQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAY 638
           +    +T    VQGSGW ++  N     KL +    NQD +  T  LVPL  ID WEHAY
Sbjct: 143 LIKLTNTKLAGVQGSGWAFIVKNLSNGGKLDVVQTYNQDTV--TGPLVPLVAIDAWEHAY 200

Query: 639 YLQYKNVRADYVKAIFDVANWNDISQRYE 725
           YLQY+N +ADY KAI++V NW + S+R++
Sbjct: 201 YLQYQNKKADYFKAIWNVVNWKEASRRFD 229


>UniRef50_Q81JK8 Cluster: Superoxide dismutase [Mn] 2; n=13;
           Bacteria|Rep: Superoxide dismutase [Mn] 2 - Bacillus
           anthracis
          Length = 208

 Score =  172 bits (419), Expect = 9e-42
 Identities = 85/202 (42%), Positives = 130/202 (64%), Gaps = 9/202 (4%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINL--- 326
           LP+L Y+Y+ LEP I    +S+HH KHHATY+NNLN A E  ++   K   + + NL   
Sbjct: 6   LPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENYSELHNKSLEELLCNLETL 65

Query: 327 ----APALKFNGGGHINHSIFWHNLSP-NGGKPSDVLTKAVEKDFGSWDNIKNQLSTASV 491
                 A++ NGGGH  HS+FW  +SP  GG+P+  + K ++  F ++DN+K+QLS A++
Sbjct: 66  PKEIVTAVRNNGGGHYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAI 125

Query: 492 AVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQYKNVRAD 668
           +  GSG+GWL  + +  +L + +  NQD PLQ   G +PL  IDVWEHAYYL+Y+N R +
Sbjct: 126 SRFGSGYGWLVLDGE--ELSVMSTPNQDTPLQ--EGKIPLLVIDVWEHAYYLKYQNRRPE 181

Query: 669 YVKAIFDVANWNDISQRYEKAL 734
           +V   +   NW+ ++++Y +A+
Sbjct: 182 FVTNWWHTVNWDRVNEKYLQAI 203


>UniRef50_P18868 Cluster: Superoxide dismutase [Fe]; n=10;
           Euryarchaeota|Rep: Superoxide dismutase [Fe] -
           Methanobacterium thermoautotrophicum
          Length = 205

 Score =  171 bits (416), Expect = 2e-41
 Identities = 81/199 (40%), Positives = 123/199 (61%), Gaps = 4/199 (2%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           + LPELPY Y+ALEP ISRE +++HH KHH  Y++  N    KL +A+ + D D  I  A
Sbjct: 9   YELPELPYPYDALEPHISREQLTIHHQKHHQAYVDGANALLRKLDEAR-ESDTDVDIKAA 67

Query: 330 -PALKFNGGGHINHSIFWHNLSPN---GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAV 497
              L F+ GG++ H  FW N+ P    GG+PS  L + +EKDFGS++  + + S A+++ 
Sbjct: 68  LKELSFHVGGYVLHLFFWGNMGPADECGGEPSGKLAEYIEKDFGSFERFRKEFSQAAISA 127

Query: 498 QGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVK 677
           +GSGW  L Y ++  +L I   +  + +        L  +DVWEHAYY+ Y+NVR DYV+
Sbjct: 128 EGSGWAVLTYCQRTDRLFIMQVEKHN-VNVIPHFRILLVLDVWEHAYYIDYRNVRPDYVE 186

Query: 678 AIFDVANWNDISQRYEKAL 734
           A +++ NW ++ +R+E  L
Sbjct: 187 AFWNIVNWKEVEKRFEDIL 205


>UniRef50_A6GX90 Cluster: Probable superoxide dismutase; n=1;
           Flavobacterium psychrophilum JIP02/86|Rep: Probable
           superoxide dismutase - Flavobacterium psychrophilum
           (strain JIP02/86 / ATCC 49511)
          Length = 288

 Score =  170 bits (413), Expect = 5e-41
 Identities = 80/193 (41%), Positives = 117/193 (60%), Gaps = 5/193 (2%)
 Frame = +3

Query: 162 ELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLA-QAQAKGDIDTIINLAPA- 335
           ELPY Y ALEP      + +H+SKHH  Y+NNLN A      +  A  DI   +NL+   
Sbjct: 61  ELPYTYKALEPNFDATTLEIHYSKHHLGYVNNLNKAIIGTKYETLALNDIFKNLNLSDTE 120

Query: 336 LKFNGGGHINHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGW 512
           ++ N GG  NH++FW N++ N GG+P   L +A+ +DFGS+D  + Q + AS+ V GSGW
Sbjct: 121 IRNNAGGFYNHNLFWENMAANAGGEPEGDLLEAIIRDFGSFDGFRTQFTEASLKVFGSGW 180

Query: 513 GWLGYNKQMKKLQIATCQNQDPLQATTGL--VPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
            WL  +K  K   + T  N +PL    G   +PL  +D+WEHAYYL+++N + +YV   F
Sbjct: 181 AWLVSDKYGKLRIVTTPNNDNPLMKNLGFTGIPLLNLDLWEHAYYLKFQNKKREYVNTFF 240

Query: 687 DVANWNDISQRYE 725
            V NWN++ ++Y+
Sbjct: 241 SVINWNEVLKKYD 253


>UniRef50_Q67T03 Cluster: Superoxide dismutase; n=4; Firmicutes|Rep:
           Superoxide dismutase - Symbiobacterium thermophilum
          Length = 312

 Score =  169 bits (412), Expect = 6e-41
 Identities = 78/195 (40%), Positives = 116/195 (59%), Gaps = 1/195 (0%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           H LP LPY Y+ALEP I  E M LHH +HH +Y+  LN AE  LA+A+A GD   + +  
Sbjct: 111 HRLPPLPYPYDALEPYIDAETMRLHHDRHHRSYVEGLNRAERALAEARAAGDWALVKHWE 170

Query: 330 PALKFNGGGHINHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
             L FNG GH  H++FW +++P  GG+P   +   + +DFG +   + Q S A+  V+G 
Sbjct: 171 RELAFNGAGHYLHTLFWESMAPGAGGEPGGEVLAQIRQDFGDFRRFREQFSKAAENVEGG 230

Query: 507 GWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
           GW    +  +  + +I T +    L +   +VPL  +DVWEHAYYL+Y+N RA Y++  +
Sbjct: 231 GWAVWVWAPRANRTEILTAEKHQNL-SQWDVVPLLPLDVWEHAYYLKYRNDRAAYIEQWW 289

Query: 687 DVANWNDISQRYEKA 731
           +V NW  + +R  +A
Sbjct: 290 NVVNWPAVERRLREA 304


>UniRef50_P46728 Cluster: Superoxide dismutase [Mn]; n=16;
           Actinomycetales|Rep: Superoxide dismutase [Mn] -
           Mycobacterium intracellulare
          Length = 163

 Score =  169 bits (412), Expect = 6e-41
 Identities = 80/164 (48%), Positives = 107/164 (65%), Gaps = 1/164 (0%)
 Frame = +3

Query: 219 LHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPN 398
           LHHSKHHATY+  +N A  KL +A+A  D   I      L F+ GGH+NHSI+W NLSP+
Sbjct: 1   LHHSKHHATYVKGVNDALSKLEEARANEDHAAIFLNEKNLAFHLGGHVNHSIWWKNLSPD 60

Query: 399 GG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQD 575
           GG KP+  L  A++  FGS+D  + Q S A+  +QGSGW  LGY+    +L      +Q 
Sbjct: 61  GGDKPTGELAAAIDDAFGSFDRFRAQFSAAANGLQGSGWAVLGYDTLGNRLLTFQLYDQQ 120

Query: 576 PLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWND 707
                 G++PL  +D+WEHA+YLQYKNV+ADYVKA ++V NW+D
Sbjct: 121 -ANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKAFWNVVNWDD 163


>UniRef50_Q59094 Cluster: Superoxide dismutase [Mn] precursor;
           n=104; Bacteria|Rep: Superoxide dismutase [Mn] precursor
           - Acinetobacter sp. (strain ADP1)
          Length = 228

 Score =  169 bits (410), Expect = 1e-40
 Identities = 86/199 (43%), Positives = 119/199 (59%), Gaps = 9/199 (4%)
 Frame = +3

Query: 165 LPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDI----DTIINLAP 332
           LPY  NAL+P I ++ M +H+ KHH  Y++NLN A+ K      K D+      I     
Sbjct: 30  LPYATNALQPAIDQQTMEIHYGKHHKAYVDNLN-AQIKTYPELDKTDLIQLQKQISKYNT 88

Query: 333 ALKFNGGGHINHSIFWHNLSPNG--GKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
           A++ NGGGH NH+ FW +L+     G+PS  L K + +DFGS D  K + + A+    GS
Sbjct: 89  AVRNNGGGHFNHTFFWESLAATNKTGQPSPALVKQITQDFGSLDAFKQKFNEAASGRFGS 148

Query: 507 GWGWLGYNKQMKKLQIATCQNQD-PLQ--ATTGLVPLFGIDVWEHAYYLQYKNVRADYVK 677
           GW WL       KL + +  NQD PL   + T   PL G+DVWEHAYYL+Y+N RADY+K
Sbjct: 149 GWAWLIVTPN-GKLAVTSTPNQDNPLMDLSETKGTPLLGLDVWEHAYYLKYQNRRADYIK 207

Query: 678 AIFDVANWNDISQRYEKAL 734
           A + V NWN +++RY +A+
Sbjct: 208 AFWSVVNWNKVNERYNEAI 226


>UniRef50_O74200 Cluster: Manganese superoxide dismutase precursor;
           n=6; Pneumocystis|Rep: Manganese superoxide dismutase
           precursor - Pneumocystis carinii
          Length = 220

 Score =  166 bits (404), Expect = 6e-40
 Identities = 83/204 (40%), Positives = 124/204 (60%), Gaps = 7/204 (3%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           S  KH LP LPY+Y ALEP +S +++ LH+++HH  Y+ NLN   EK  +   +  +D+ 
Sbjct: 21  SHSKHVLPSLPYDYQALEPYLSADLIELHYNQHHRAYVTNLNKTIEKYYEGN-ESSLDSF 79

Query: 318 I---NLAPALKFNGGGHINHSIFWHNLSPN---GGK-PSDVLTKAVEKDFGSWDNIKNQL 476
           I   NL  ++KF  GGHINHS++W NL PN   GG+  +  L +A++K++ S D      
Sbjct: 80  INRLNLLTSIKFFAGGHINHSLYWENLLPNKQGGGEIINGPLVEAIKKEWKSVDEFIRIF 139

Query: 477 STASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKN 656
           +     +QGSGW WL  +   ++L I    NQD +  T G V + GID WEH+YY+QY N
Sbjct: 140 NMQLAGIQGSGWAWLVKSPFSQRLSIQITMNQDVV--TQGKV-ILGIDAWEHSYYVQYLN 196

Query: 657 VRADYVKAIFDVANWNDISQRYEK 728
            +  Y + I++V NW  ++QR+E+
Sbjct: 197 NKTKYFENIWNVINWKVMNQRFEQ 220


>UniRef50_P43019 Cluster: Superoxide dismutase [Mn]; n=299; cellular
           organisms|Rep: Superoxide dismutase [Mn] - Salmonella
           typhimurium
          Length = 206

 Score =  166 bits (404), Expect = 6e-40
 Identities = 86/203 (42%), Positives = 121/203 (59%), Gaps = 12/203 (5%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQ--AQAKGDIDTIIN 323
           +TLP LPY Y+ALEP   ++ M +HH+KHH TY+NN N A E L +  +    ++ T ++
Sbjct: 3   YTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFASLPVEELITKLD 62

Query: 324 LAPA-----LKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTAS 488
             PA     L+ N GGH NHS+FW  L        D L  A+E+DFGS DN K +   A+
Sbjct: 63  QVPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGD-LKAAIERDFGSVDNFKAEFEKAA 121

Query: 489 VAVQGSGWGWLGYNKQMKKLQIATCQNQD-PL--QATTGL--VPLFGIDVWEHAYYLQYK 653
               GSGW WL       KL + +  NQD PL  +A +G    P+ G+DVWEHAYYL+++
Sbjct: 122 ATRFGSGWAWLVLKGD--KLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQ 179

Query: 654 NVRADYVKAIFDVANWNDISQRY 722
           N R DY+K  ++V NW++ + R+
Sbjct: 180 NRRPDYIKEFWNVVNWDEAAARF 202


>UniRef50_P43725 Cluster: Superoxide dismutase [Mn]; n=122; cellular
           organisms|Rep: Superoxide dismutase [Mn] - Haemophilus
           influenzae
          Length = 215

 Score =  165 bits (400), Expect = 2e-39
 Identities = 84/205 (40%), Positives = 117/205 (57%), Gaps = 12/205 (5%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAK---GDIDTII 320
           +TLPEL Y YNALEP    + M +HHSKHH  Y+NN N A E L     +   G + + +
Sbjct: 3   YTLPELGYAYNALEPHFDAQTMEIHHSKHHQAYVNNANAALEGLPAELVEMYPGHLISNL 62

Query: 321 NLAPA-----LKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTA 485
           +  PA     L+ N GGH NHS+FW +L   G      L  A+E+DFGS D  K +   A
Sbjct: 63  DKIPAEKRGALRNNAGGHTNHSLFWKSLK-KGTTLQGALKDAIERDFGSVDAFKAEFEKA 121

Query: 486 SVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQA--TTGL--VPLFGIDVWEHAYYLQYK 653
           +    GSGW WL    + K   ++T    +PL      G    PL G+DVWEHAYYL+++
Sbjct: 122 AATRFGSGWAWLVLTAEGKLAVVSTANQDNPLMGKEVAGCEGFPLLGLDVWEHAYYLKFQ 181

Query: 654 NVRADYVKAIFDVANWNDISQRYEK 728
           N R DY+K  ++V NW+ +++R+E+
Sbjct: 182 NRRPDYIKEFWNVVNWDFVAERFEQ 206


>UniRef50_Q9RUV2 Cluster: Superoxide dismutase [Mn]; n=20; cellular
           organisms|Rep: Superoxide dismutase [Mn] - Deinococcus
           radiodurans
          Length = 211

 Score =  161 bits (392), Expect = 2e-38
 Identities = 88/210 (41%), Positives = 120/210 (57%), Gaps = 16/210 (7%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEE-----KLAQAQAKGDIDT 314
           +TLP+LPY Y+ALEP I    M +HH+KHH TY++N N A E      L   Q    +D 
Sbjct: 3   YTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLDR 62

Query: 315 I-INLAPALKFNGGGHINHSIFWHNLSPNGGK-----PSDVLTKAVEKDFGSWDNIKNQL 476
           +  +   AL+ N GGH NHS+FW  +    G+     PS  L  A+   FGS+D  K + 
Sbjct: 63  VPADKKGALRNNAGGHANHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQKF 122

Query: 477 STASVAVQGSGWGWLGYNKQMKKLQIATCQNQD-PL--QATTGL--VPLFGIDVWEHAYY 641
             A+    GSGW WL       KL + +  NQD PL  +A  G+   P+ G+DVWEHAYY
Sbjct: 123 EDAAKTRFGSGWAWLVVKDG--KLDVVSTANQDNPLMGEAIAGVSGTPILGVDVWEHAYY 180

Query: 642 LQYKNVRADYVKAIFDVANWNDISQRYEKA 731
           L Y+N R DY+ A ++V NW+++S+RY  A
Sbjct: 181 LNYQNRRPDYLAAFWNVVNWDEVSKRYAAA 210


>UniRef50_A3XNP8 Cluster: Superoxide dismutase; n=1;
           Leeuwenhoekiella blandensis MED217|Rep: Superoxide
           dismutase - Leeuwenhoekiella blandensis MED217
          Length = 241

 Score =  161 bits (390), Expect = 3e-38
 Identities = 74/189 (39%), Positives = 106/189 (56%)
 Frame = +3

Query: 165 LPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKF 344
           LPY    LEP +  E + LH   HH   +   N    K+ +    GD+D +      L +
Sbjct: 49  LPYNKTFLEPHMDEETLHLHFEFHHGGAVKGANTDLIKIKEHLKSGDLDQVDLWTRKLAY 108

Query: 345 NGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLG 524
           +   H+ HSIFW NL+    +P   L K +EKDFGS+D +K+ +   S  V+GSGWG LG
Sbjct: 109 HFSSHVLHSIFWTNLTNKKTEPKTELLKQIEKDFGSFDKLKSYIGKISKTVEGSGWGILG 168

Query: 525 YNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWN 704
           Y      L +  C+N   L    G+VP+  IDVWEHAYYL+YKN RAD+V  + ++ NW+
Sbjct: 169 YQPYSDSLTLLQCENHQKL-TQWGVVPILVIDVWEHAYYLKYKNKRADFVDTVLEIINWD 227

Query: 705 DISQRYEKA 731
           +++ R+  A
Sbjct: 228 NVADRFMTA 236


>UniRef50_Q9TW89 Cluster: Superoxide dismutase [Fe]; n=251; cellular
           organisms|Rep: Superoxide dismutase [Fe] - Plasmodium
           falciparum
          Length = 198

 Score =  161 bits (390), Expect = 3e-38
 Identities = 77/196 (39%), Positives = 119/196 (60%), Gaps = 2/196 (1%)
 Frame = +3

Query: 153 TLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAP 332
           TLP+L Y  NAL P IS E ++ H++KHHA Y+N LN   +    A+ K  +D +   + 
Sbjct: 4   TLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAE-KSLLDIVKESSG 62

Query: 333 ALKFNGGGHI-NHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
           A+ FN    I NH+ +W ++ P+ GG+P   + + +++DFGS++N K Q S       GS
Sbjct: 63  AI-FNNAAQIWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGS 121

Query: 507 GWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
           GWGWL  N   K + + T    +P++  TG +P+   D+WEHAYY+ Y+N RA YVKA +
Sbjct: 122 GWGWLALNNNNKLVILQTHDAGNPIKDNTG-IPILTCDIWEHAYYIDYRNDRASYVKAWW 180

Query: 687 DVANWNDISQRYEKAL 734
           ++ NWN  ++  +KA+
Sbjct: 181 NLVNWNFANENLKKAM 196


>UniRef50_Q03302 Cluster: Superoxide dismutase [Mn]; n=9;
           Halobacteriaceae|Rep: Superoxide dismutase [Mn] -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 203

 Score =  160 bits (389), Expect = 4e-38
 Identities = 75/194 (38%), Positives = 111/194 (57%), Gaps = 1/194 (0%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPA 335
           LP LPY+Y+ALEP IS ++++ HH  HH  Y+N L  AEE LA+ +  GD  +       
Sbjct: 9   LPPLPYDYDALEPHISEQVLTWHHDTHHQGYVNGLESAEETLAENRDAGDFGSSAAAMGN 68

Query: 336 LKFNGGGHINHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGW 512
           +  NG GH  H++FW N+ PN GG+P   L   +E+DFGS++  K +   A+ A    GW
Sbjct: 69  VTHNGCGHYLHTLFWENMDPNGGGEPEGELLDRIEEDFGSYEGWKGEFEAAASA--AGGW 126

Query: 513 GWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDV 692
             L Y+   K+L+       D   A  G  P+  +DVWEH+YY  Y   R D++ A F+V
Sbjct: 127 ALLVYDPVAKQLRNVPVDKHDQ-GALWGSHPILALDVWEHSYYYDYGPARGDFIDAFFEV 185

Query: 693 ANWNDISQRYEKAL 734
            +W+  ++ YEK++
Sbjct: 186 VDWDKAAEEYEKSV 199


>UniRef50_Q0LCP1 Cluster: Twin-arginine translocation pathway signal
           precursor; n=2; Herpetosiphon aurantiacus ATCC
           23779|Rep: Twin-arginine translocation pathway signal
           precursor - Herpetosiphon aurantiacus ATCC 23779
          Length = 255

 Score =  159 bits (386), Expect = 9e-38
 Identities = 78/204 (38%), Positives = 116/204 (56%), Gaps = 8/204 (3%)
 Frame = +3

Query: 147 KHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINL 326
           K TLP LPY+Y  LEP +  E M +HH KHH   + NLN A     + Q+    + +  L
Sbjct: 52  KFTLPALPYDYGDLEPHLDAETMYIHHQKHHQALVTNLNAALADYPKLQSMNVAELLHGL 111

Query: 327 AP-------ALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLST 482
           +        A++ N GGH NH+I+W  LSP GG      L  A+   +GS+++ K   + 
Sbjct: 112 SSLPSAIQTAVRNNAGGHANHAIWWATLSPKGGGNAGGALAAAINAKYGSFNSFKTTFND 171

Query: 483 ASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVR 662
            +    GSGWGWL  + +   L +A+  NQD      GL PL G+DVWEHAYYL+++  R
Sbjct: 172 IAARRFGSGWGWLSTDSK-GTLYLASYPNQDS-PYMEGLTPLLGVDVWEHAYYLKFRQKR 229

Query: 663 ADYVKAIFDVANWNDISQRYEKAL 734
           A+++ A ++V NW ++ +RY+ A+
Sbjct: 230 AEFLSAWWNVINWGEVGRRYDLAI 253


>UniRef50_Q8SQV7 Cluster: Superoxide dismutase; n=1; Encephalitozoon
           cuniculi|Rep: Superoxide dismutase - Encephalitozoon
           cuniculi
          Length = 233

 Score =  158 bits (384), Expect = 2e-37
 Identities = 86/203 (42%), Positives = 118/203 (58%), Gaps = 12/203 (5%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNL-------NVAEEKLAQAQAKG-DID 311
           LPEL Y Y+ALEP+I  E M  HHSKHH  YIN+L       ++  + L     KG  I 
Sbjct: 12  LPELDYPYDALEPIIDEETMRTHHSKHHQAYINSLEKTLRSNSIKGKSLYYYVTKGRGIR 71

Query: 312 TIINLAPALKFN-GGGHINHSIFWHNLSPNG--GKPSDVLTKAVEKDFGSWDNIKNQLST 482
            + + A     N  GGH NHS+FW  + P G  G  S  L + +E+ FGS + +  + S 
Sbjct: 72  GVKSSARRDLLNFSGGHYNHSLFWKMMCPPGTSGPMSPRLLEYIERSFGSQEKMVKEFSN 131

Query: 483 ASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPL-QATTGLVPLFGIDVWEHAYYLQYKNV 659
           A+V++ GSGW WL Y +    L I    NQD +   T+  VP+ G+DVWEHAYYL+YKNV
Sbjct: 132 AAVSLFGSGWVWLCYRQSEGILVIRKTYNQDAICMKTSSTVPILGLDVWEHAYYLKYKNV 191

Query: 660 RADYVKAIFDVANWNDISQRYEK 728
           R++YV   + V NW  +S+ +E+
Sbjct: 192 RSEYVANWWKVVNWGLVSRLFEE 214


>UniRef50_Q07V83 Cluster: Superoxide dismutase precursor; n=5;
           Proteobacteria|Rep: Superoxide dismutase precursor -
           Rhodopseudomonas palustris (strain BisA53)
          Length = 245

 Score =  158 bits (383), Expect = 2e-37
 Identities = 88/209 (42%), Positives = 121/209 (57%), Gaps = 8/209 (3%)
 Frame = +3

Query: 129 AGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN-VAEE--KLAQA--- 290
           A A     TLP LPY   ALEP I  + M +HH KHH  Y++NLN  A++  KLAQ    
Sbjct: 33  AAAPGGPFTLPPLPYPVAALEPHIDAKTMEIHHGKHHQAYVSNLNNFAKDNPKLAQLPVP 92

Query: 291 QAKGDI-DTIINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIK 467
           +  G++ D   ++   ++ N GGH NH++FW  + PNGGKPS  +  A+++D G  +  +
Sbjct: 93  EVLGNLGDVPESIRTGVRNNLGGHANHTMFWEIMGPNGGKPSGDVLAAIDRDLGGMEKFQ 152

Query: 468 NQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYL 644
              + A     GSGW ++  +K   KL I T  NQD P+    G   L G DVWEHAYYL
Sbjct: 153 TDFNAAGGRQFGSGWVFVTVSKD-GKLAIETRPNQDNPMM--DGKRVLLGNDVWEHAYYL 209

Query: 645 QYKNVRADYVKAIFDVANWNDISQRYEKA 731
            Y+N RADY+KA ++  NW+ I +RY  A
Sbjct: 210 NYQNRRADYLKAWWNTVNWSKIGERYAAA 238


>UniRef50_Q4C9Q7 Cluster: Superoxide dismutase precursor; n=2;
           Bacteria|Rep: Superoxide dismutase precursor -
           Crocosphaera watsonii
          Length = 254

 Score =  156 bits (379), Expect = 6e-37
 Identities = 79/212 (37%), Positives = 120/212 (56%), Gaps = 9/212 (4%)
 Frame = +3

Query: 123 RVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAK- 299
           ++A  S        LPY+YNALEP I  + M +H++ HH  Y+       EK  + + K 
Sbjct: 43  QIAQTSNGDFVQAPLPYDYNALEPFIDAKTMEIHYTGHHGGYLKKFKKTLEKHPELKGKT 102

Query: 300 -----GDIDTI-INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWD 458
                G+ID I  ++  +++ NGGGH NH++FW  ++PNGG +P+     A+   FGS++
Sbjct: 103 LEQILGNIDNIPSDIRTSIRNNGGGHYNHTVFWAIMTPNGGGEPNGEFATAINNSFGSFE 162

Query: 459 NIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHA 635
             K Q    S    GSGW WL  +K   +L+I +   QD P+    G  P+ G DVWEHA
Sbjct: 163 EFKAQFKAESFKRFGSGWVWLVRDKN-GRLEITSSPGQDNPIME--GKYPILGTDVWEHA 219

Query: 636 YYLQYKNVRADYVKAIFDVANWNDISQRYEKA 731
           YYL YKN R  YV A ++  NW++++ R++++
Sbjct: 220 YYLNYKNSRGSYVDAWWNTINWDEVNARFKES 251


>UniRef50_P80857 Cluster: Superoxide dismutase [Fe]; n=4;
           Thermoprotei|Rep: Superoxide dismutase [Fe] - Sulfolobus
           solfataricus
          Length = 211

 Score =  154 bits (374), Expect = 2e-36
 Identities = 80/205 (39%), Positives = 121/205 (59%), Gaps = 8/205 (3%)
 Frame = +3

Query: 144 QKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDT--- 314
           +K+ LP LPY+ +ALEP IS++I+ +H++ HH  Y+N  N   E+L +   KGD+ T   
Sbjct: 8   KKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGYVNGANSLLERLEKV-VKGDLQTGQY 66

Query: 315 -IINLAPALKFNGGGHINHSIFWHNLSPNG---GKPSDVLTKAVEKDFGSWDNIKNQLST 482
            I  +   L FN  GH  H+++W N++P+G   GKP   L   + K +GS+D  K   + 
Sbjct: 67  DIQGIIRGLTFNINGHKLHALYWENMAPSGKGGGKPGGALADLINKQYGSFDRFKQVFTE 126

Query: 483 ASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGI-DVWEHAYYLQYKNV 659
            + ++ G+GW  L Y+ +   LQI T +N    Q     +P+  I D +EHAYYLQYKN 
Sbjct: 127 TANSLPGTGWAVLYYDTESGNLQIMTFENH--FQNHIAEIPIILILDEFEHAYYLQYKNK 184

Query: 660 RADYVKAIFDVANWNDISQRYEKAL 734
           RADYV A ++V NW+   ++ +K L
Sbjct: 185 RADYVNAWWNVVNWDAAEKKLQKYL 209


>UniRef50_O30826 Cluster: Superoxide dismutase [Mn]; n=65; root|Rep:
           Superoxide dismutase [Mn] - Haemophilus ducreyi
          Length = 213

 Score =  154 bits (373), Expect = 3e-36
 Identities = 82/205 (40%), Positives = 117/205 (57%), Gaps = 12/205 (5%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAK--GDIDTIIN 323
           + LPEL Y Y+ALEP   +E M +HHSKHH  Y+NN N   EK  +   K  G +   + 
Sbjct: 3   YQLPELGYAYDALEPYFDKETMEIHHSKHHQAYVNNSNALLEKHPELLEKCPGALLKDLT 62

Query: 324 LAPA-----LKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTAS 488
             PA     ++ N GGH+NH++FW  L   G      L  A+ +DFGS +  + +   A+
Sbjct: 63  QVPAEKRTAVRNNLGGHVNHTLFWKGLK-TGTTLQGALKDAIIRDFGSVEAFQAEFEQAA 121

Query: 489 VAVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQA--TTGL--VPLFGIDVWEHAYYLQYK 653
               GSGW WL   +   KL + +  NQD P+      G+   P+F +DVWEHAYYL Y+
Sbjct: 122 ATRFGSGWAWLVLEEG--KLAVVSTANQDSPIMGKDVAGVSGYPIFTLDVWEHAYYLHYQ 179

Query: 654 NVRADYVKAIFDVANWNDISQRYEK 728
           N R DY+KA ++V NW++ S+R+E+
Sbjct: 180 NRRPDYIKAFWNVVNWDEASRRFEE 204


>UniRef50_P53638 Cluster: Superoxide dismutase [Fe]; n=9;
           Bacteroidales|Rep: Superoxide dismutase [Fe] -
           Bacteroides fragilis
          Length = 193

 Score =  153 bits (371), Expect = 6e-36
 Identities = 79/195 (40%), Positives = 123/195 (63%), Gaps = 5/195 (2%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           + +P+LPY  NALEPVIS++ +  H+ KH  TY+NNLN       + + K  ++ I+  A
Sbjct: 3   YEMPKLPYANNALEPVISQQTIDYHYGKHLQTYVNNLNSLVPG-TEYEGK-TVEAIVASA 60

Query: 330 P--ALKFNGGGHINHSIFWHNLSPNGGK--PSDVLTKAVEKDFGSWDNIKNQLSTASVAV 497
           P  A+  N G  +NH++++   +P   K  P+  L +A+++DFGS++N K + + ASV +
Sbjct: 61  PDGAIFNNAGQVLNHTLYFLQFAPKPAKNEPAGKLGEAIKRDFGSFENFKKEFNAASVGL 120

Query: 498 QGSGWGWLGYNKQMKKLQIATCQN-QDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
            GSGW WL  +K   KL I    N  +P++A  GL PL G DVWEHAYYL Y+N RAD+V
Sbjct: 121 FGSGWAWLSVDKD-GKLHITKEPNGSNPVRA--GLKPLLGFDVWEHAYYLDYQNRRADHV 177

Query: 675 KAIFDVANWNDISQR 719
             ++++ +W+ + +R
Sbjct: 178 NKLWEIIDWDVVEKR 192


>UniRef50_A7D0S4 Cluster: Superoxide dismutase; n=2; Halorubrum
           lacusprofundi ATCC 49239|Rep: Superoxide dismutase -
           Halorubrum lacusprofundi ATCC 49239
          Length = 216

 Score =  153 bits (370), Expect = 8e-36
 Identities = 75/196 (38%), Positives = 107/196 (54%), Gaps = 1/196 (0%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           + L  LPY+Y+ALEP IS +++  HH  HH  Y+N  N AEE L   +  GD  +     
Sbjct: 20  YELDPLPYDYDALEPHISEQVLEWHHDTHHQGYVNGWNSAEETLEANRDAGDFSSSGGAI 79

Query: 330 PALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
             +  N  GHI H +FW N+SP GG +P   L   +E+DFGS+D  K +   A+ A   S
Sbjct: 80  RNVTHNSSGHILHDLFWQNMSPEGGDEPEGALADQIEEDFGSYDAWKGEFEAAASA--AS 137

Query: 507 GWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
           GW  L Y+    +L+       D   A  G  P+  +DVWEH+YY  Y   R ++V   F
Sbjct: 138 GWALLVYDTFSNQLRNVVVDKHDQ-GAIWGGHPILALDVWEHSYYHDYGPARGEFVDNFF 196

Query: 687 DVANWNDISQRYEKAL 734
           +V +WN+ + RYE+A+
Sbjct: 197 EVVDWNEPATRYEQAV 212


>UniRef50_A7AGL0 Cluster: Putative uncharacterized protein; n=1;
           Parabacteroides merdae ATCC 43184|Rep: Putative
           uncharacterized protein - Parabacteroides merdae ATCC
           43184
          Length = 219

 Score =  152 bits (369), Expect = 1e-35
 Identities = 77/217 (35%), Positives = 120/217 (55%), Gaps = 2/217 (0%)
 Frame = +3

Query: 78  SLVIMLMSQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINN 257
           SL++++ +    S I        K  L +LPY  NALEPVIS+E +  HH KH  TY+NN
Sbjct: 7   SLLLLITNNSNNSQITDKKEKVMKFELIQLPYAANALEPVISKETIEFHHGKHLQTYVNN 66

Query: 258 LNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGH-INHSIFWHNLSP-NGGKPSDVLTKA 431
           LN   +      A   ++ I+  +    FN  G  +NH++++   SP  GG+P+  L KA
Sbjct: 67  LNNLIQGTKFENAT--LEQIVAESDGAIFNNAGQTLNHNLYFTQFSPYGGGRPTGALAKA 124

Query: 432 VEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLF 611
           ++  +GS++N + +   A   + GSGW WL  +K  K          +P+    GL P+ 
Sbjct: 125 IDATWGSFENFQKEFVAAGTGLFGSGWVWLAKDKDGKLSITKEANGSNPV--AHGLKPIL 182

Query: 612 GIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 722
           G DVWEHAYYL Y+N R D++ A++ + +W+ + +RY
Sbjct: 183 GFDVWEHAYYLDYRNRRPDHLNALWKIIDWDTVGKRY 219


>UniRef50_A6TPE4 Cluster: Superoxide dismutase; n=11; Bacteria|Rep:
           Superoxide dismutase - Alkaliphilus metalliredigens QYMF
          Length = 225

 Score =  152 bits (369), Expect = 1e-35
 Identities = 76/208 (36%), Positives = 116/208 (55%), Gaps = 16/208 (7%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAP- 332
           L  +PY Y  LEP I +E M++HHS+HH  Y+N  N   +   +   K  ++ +      
Sbjct: 21  LNNIPYSYEDLEPYIDKETMNIHHSRHHDAYVNGANKGLQDFPEPHNKSSVELLKGFNDL 80

Query: 333 ----------ALKFNGGGHINHSIFWHNLSPNGG----KPSDVLTKAVEKDFGSWDNIKN 470
                     A++ + GGH NH++FW  ++PN      +PS  L++ + + FGS+D  KN
Sbjct: 81  STDLPDSARNAVRNHVGGHTNHALFWEIMAPNSTGEERRPSGELSERITETFGSFDEFKN 140

Query: 471 QLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQ 647
           Q   A+    GSGW WL  +K   +L++ +  NQD P     G  P+ GIDVWEHAYYL+
Sbjct: 141 QFEAAATTRFGSGWAWLVIDKG--ELKVTSSANQDRPYMG--GQTPILGIDVWEHAYYLK 196

Query: 648 YKNVRADYVKAIFDVANWNDISQRYEKA 731
           Y+N R  YV   + V NW+++++RY+ A
Sbjct: 197 YQNKRGSYVSNFWYVINWDEVARRYKAA 224


>UniRef50_Q9KNN7 Cluster: Superoxide dismutase; n=23;
           Vibrionaceae|Rep: Superoxide dismutase - Vibrio cholerae
          Length = 222

 Score =  151 bits (365), Expect = 3e-35
 Identities = 77/201 (38%), Positives = 118/201 (58%), Gaps = 6/201 (2%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINN-LNVAEEKLAQAQAKGDIDTIINL 326
           H  P+LPY Y+ALEP I  + M +H+SKHH TY +  L+  +    + +   +I   ++ 
Sbjct: 20  HLFPDLPYAYDALEPYIDTKTMEVHYSKHHRTYYDKFLSAIKGTEHEDRPLSEIFARVST 79

Query: 327 APA-LKFNGGGHINHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQ 500
            PA ++ +GGG+ NH ++W+ + PN GG+P   L   +E+ FGS+   K   S A+V   
Sbjct: 80  LPAAVRNHGGGYYNHIVYWNCMKPNAGGEPQGELAAEIERQFGSFAQFKEAFSQAAVNTF 139

Query: 501 GSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGL--VPLFGIDVWEHAYYLQYKNVRADY 671
           GSG+ WL    Q  +L I +  NQD PL     +   P+  +DVWEHAYY++Y+N R +Y
Sbjct: 140 GSGFVWLIV--QQGQLSITSTSNQDNPLMDVVAVRGEPILALDVWEHAYYIRYQNRRPEY 197

Query: 672 VKAIFDVANWNDISQRYEKAL 734
           + A ++V NW  +S+ Y  AL
Sbjct: 198 IDAWWNVVNWEAVSENYAIAL 218


>UniRef50_A7CXL5 Cluster: Superoxide dismutase precursor; n=1;
           Opitutaceae bacterium TAV2|Rep: Superoxide dismutase
           precursor - Opitutaceae bacterium TAV2
          Length = 289

 Score =  150 bits (363), Expect = 5e-35
 Identities = 87/208 (41%), Positives = 114/208 (54%), Gaps = 11/208 (5%)
 Frame = +3

Query: 144 QKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEK------LAQAQAKGD 305
           Q   LP LP+  +ALEP I    MS+HH KHH  YI N N A +       L+ AQ   +
Sbjct: 76  QPFVLPPLPFAPDALEPSIGARTMSIHHGKHHQAYITNANTALKSHPQLLSLSAAQLLQN 135

Query: 306 IDTIIN-LAPALKFNGGGHINHSIFWHNL---SPNGGKPSDVLTKAVEKDFGSWDNIKNQ 473
           +D+I   +  A++ N GGH NHS FW  L   SP+ G     L  A+ + FGS D     
Sbjct: 136 LDSIPEEIRTAVRNNVGGHANHSFFWPLLTASSPSPGHAHGALRTAIVETFGSLDAFIAG 195

Query: 474 LSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQY 650
            + A+ +  GSGW WL +  Q  +L I +  NQD PL  + G  P+ G+DVWEHAYYL Y
Sbjct: 196 FNQAAASCFGSGWAWLVW--QDGRLAIISTANQDSPL--SLGARPVIGLDVWEHAYYLDY 251

Query: 651 KNVRADYVKAIFDVANWNDISQRYEKAL 734
           +N RADY KA + V NW+     Y  A+
Sbjct: 252 QNRRADYTKAFWAVLNWSQAEANYTAAI 279


>UniRef50_Q89AR7 Cluster: Superoxide dismutase [Mn]; n=4;
           Enterobacteriaceae|Rep: Superoxide dismutase [Mn] -
           Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 208

 Score =  150 bits (363), Expect = 5e-35
 Identities = 83/202 (41%), Positives = 116/202 (57%), Gaps = 11/202 (5%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN-----VAEEKLAQAQAKGDIDT 314
           + LP LPY YN+LEP    + M +HH++HH  YINN N        E L   +    ++ 
Sbjct: 3   YVLPSLPYSYNSLEPFFDEKTMIIHHTRHHQAYINNTNSILNGTHYENLLIEELISKLNI 62

Query: 315 I-INLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASV 491
           + I    AL+ N GGHINHS+FW  L  N     D     +EK+F S D  K Q    ++
Sbjct: 63  LSIENKLALQNNAGGHINHSLFWKWLKLNTILKDDFKI-ILEKNFKSVDFFKKQFEKIAL 121

Query: 492 AVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQAT--TGL--VPLFGIDVWEHAYYLQYKN 656
           +  GSGW WL   K    L+I T  NQ+ PL     +G+  +P+ G+D+WEHAYYL+YKN
Sbjct: 122 SHFGSGWIWL-IKKYDNTLRIVTTVNQNTPLMGKEISGISGIPILGLDLWEHAYYLKYKN 180

Query: 657 VRADYVKAIFDVANWNDISQRY 722
            R+DYV A ++V NW+++S R+
Sbjct: 181 NRSDYVNAFWNVVNWDEVSYRF 202


>UniRef50_A0Q0B4 Cluster: Superoxide dismutase; n=1; Clostridium
           novyi NT|Rep: Superoxide dismutase - Clostridium novyi
           (strain NT)
          Length = 216

 Score =  149 bits (361), Expect = 9e-35
 Identities = 75/203 (36%), Positives = 109/203 (53%), Gaps = 7/203 (3%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SR   TL  LPY Y  LEP I RE +++HH KH   Y++ LN A  K  +   KG  + +
Sbjct: 14  SRTTFTLTPLPYGYEHLEPSIDRETVTIHHDKHQQAYVDKLNAAISKHPELFKKGVFEIL 73

Query: 318 --INLAP-----ALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQL 476
             +N  P     A+  NGGG  NH  +W  L       +  L KA+ +DFGS++  K+  
Sbjct: 74  SDLNALPEDIKKAVINNGGGVFNHEFYWSILGSKALNENSNLAKAITRDFGSFEAFKDIF 133

Query: 477 STASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKN 656
           +   +   GSGW WL  +    KL + +  NQD    + G +P+  +DVWEHAYYLQY+N
Sbjct: 134 TQTGITTFGSGWAWL-ISDANGKLSVVSTSNQD-CPISEGKIPILTMDVWEHAYYLQYQN 191

Query: 657 VRADYVKAIFDVANWNDISQRYE 725
            R +Y+   F++ +W+   Q Y+
Sbjct: 192 KRPEYITNFFNIIDWSKCEQYYD 214


>UniRef50_A3J5A6 Cluster: Superoxide dismutase; n=1; Flavobacteria
           bacterium BAL38|Rep: Superoxide dismutase -
           Flavobacteria bacterium BAL38
          Length = 243

 Score =  148 bits (359), Expect = 2e-34
 Identities = 76/196 (38%), Positives = 113/196 (57%), Gaps = 6/196 (3%)
 Frame = +3

Query: 165 LPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDIDTIINLAPAL 338
           L Y Y+ LEP I    M +H+SKHH  Y N LN  V    L     +  +  +      +
Sbjct: 46  LKYAYDGLEPHIDGRTMEIHYSKHHLGYANKLNKAVLGTDLELKTVEEILKNLDTNNKEI 105

Query: 339 KFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWG 515
           + N GG+ NH++F+  L+P GG  P+  L +A+  + GS+DN++ QL+ A+    GSGW 
Sbjct: 106 RNNAGGYYNHNLFFEILNPKGGGTPNGALAEAITTEMGSFDNLQKQLTEAAARQFGSGWA 165

Query: 516 WLGYNKQMKKLQIATCQNQD-PLQATTGL--VPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
           WL   +   KL I +  NQD PL     +   P+  IDVWEHAYYL Y+N R++Y+ +IF
Sbjct: 166 WLVVTRD-GKLAITSTANQDNPLMPNAEVRGTPILAIDVWEHAYYLNYQNKRSEYLTSIF 224

Query: 687 DVANWNDISQRYEKAL 734
           +V +WN ++ +YE A+
Sbjct: 225 NVIDWNIVNAKYETAV 240


>UniRef50_P19665 Cluster: Superoxide dismutase [Mn/Fe]; n=14;
           cellular organisms|Rep: Superoxide dismutase [Mn/Fe] -
           Porphyromonas gingivalis (Bacteroides gingivalis)
          Length = 191

 Score =  147 bits (356), Expect = 4e-34
 Identities = 76/194 (39%), Positives = 113/194 (58%), Gaps = 3/194 (1%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           H L  LPY  +AL PVIS+E +  HH KH  TY++NLN  +  +       D++TI+  +
Sbjct: 3   HELISLPYAVDALAPVISKETVEFHHGKHLKTYVDNLN--KLIIGTEFENADLNTIVQKS 60

Query: 330 PALKFNGGGH-INHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG 503
               FN  G  +NH++++    P  GG P   L +A++K FGS++  K + +TA   + G
Sbjct: 61  EGGIFNNAGQTLNHNLYFTQFRPGKGGAPKGKLGEAIDKQFGSFEKFKEEFNTAGTTLFG 120

Query: 504 SGWGWLGYNKQMKKLQIATCQNQ-DPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKA 680
           SGW WL  +    KL I    N  +P++   GL PL G DVWEHAYYL Y+N RAD++K 
Sbjct: 121 SGWVWLASDAN-GKLSIEKEPNAGNPVRK--GLNPLLGFDVWEHAYYLTYQNRRADHLKD 177

Query: 681 IFDVANWNDISQRY 722
           ++ + +W+ +  RY
Sbjct: 178 LWSIVDWDIVESRY 191


>UniRef50_Q2GCT5 Cluster: Superoxide dismutase, Fe; n=1;
           Neorickettsia sennetsu str. Miyayama|Rep: Superoxide
           dismutase, Fe - Neorickettsia sennetsu (strain Miyayama)
          Length = 205

 Score =  146 bits (355), Expect = 5e-34
 Identities = 81/202 (40%), Positives = 112/202 (55%), Gaps = 9/202 (4%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPA 335
           LP LPY  +ALEP+IS + +S H+ KHH+ Y+N LN    K   +   G +D II  +  
Sbjct: 5   LPSLPYHKDALEPLISEKTLSFHYDKHHSGYVNKLNELLVKSEFSHGYGLVD-IIRKSYG 63

Query: 336 LK-----FNGGGHI-NHSIFWHNL-SPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASV 491
            +     FN    + NHS +W+++ SP+   +P D   K V +DFGS D +K QL  A++
Sbjct: 64  REGCEGIFNNAAQVWNHSFYWNSMCSPSYRPQPDDAFMKQVIRDFGSLDILKEQLGLAAI 123

Query: 492 AVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADY 671
           +  GSGW W+ ++K   KL I    N +      GL PL  IDVWEHAYYL Y+N R DY
Sbjct: 124 SQFGSGWAWVVFDKFKNKLAILKTSNAETPLTVEGLSPLLVIDVWEHAYYLDYQNRRPDY 183

Query: 672 VKAIF-DVANWNDISQRYEKAL 734
           V A    + NW   S  Y  ++
Sbjct: 184 VAAFLGQLLNWEFASANYAASI 205


>UniRef50_Q85M64 Cluster: Superoxide dismutase; n=1; Toxoplasma
           gondii|Rep: Superoxide dismutase - Toxoplasma gondii
          Length = 258

 Score =  146 bits (355), Expect = 5e-34
 Identities = 75/202 (37%), Positives = 114/202 (56%), Gaps = 3/202 (1%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           S  K  LP LPY+YNALEP IS + +  HH KHHATY+ NLN   +       K  ++ I
Sbjct: 48  STGKFELPALPYDYNALEPYISAKTLKFHHDKHHATYVKNLNELIKGTDYENQK--LEDI 105

Query: 318 INLAPALKFNGGGHI-NHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASV 491
           I  A    FN      NH+ FW+++ PN GG+P+ ++ + +++ F S+   K + S  + 
Sbjct: 106 IRNADGPTFNNAAQAWNHTFFWNSMKPNGGGEPTGLVKEQIDRCFSSFSKYKEEFSEKAT 165

Query: 492 AVQGSGWGWLGYNKQMKKLQ-IATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRAD 668
              GSGW WL +  + ++L+ I T    +P+  T    P+   D+WEH YYL  +N R  
Sbjct: 166 KHFGSGWAWLVWCNEKRRLEVIETHDAGNPI--TMKKWPIITCDLWEHGYYLDRQNDRGA 223

Query: 669 YVKAIFDVANWNDISQRYEKAL 734
           YVK+ + V NW+  +++ EKA+
Sbjct: 224 YVKSWWSVVNWDFANEKLEKAM 245


>UniRef50_Q7NZQ4 Cluster: Superoxide dismutase; n=16; Bacteria|Rep:
           Superoxide dismutase - Chromobacterium violaceum
          Length = 234

 Score =  146 bits (354), Expect = 7e-34
 Identities = 85/208 (40%), Positives = 115/208 (55%), Gaps = 7/208 (3%)
 Frame = +3

Query: 129 AGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKG 302
           A  +     LP LPY  NALEPVIS   +  H+ KHH  Y++NLN  +A    A    + 
Sbjct: 32  AAHASSAQVLPPLPYADNALEPVISARTIGFHYGKHHKAYLDNLNKLIAGRDYADLPLED 91

Query: 303 DIDTIINLAP-ALKFNGGGHI-NHSIFWHNLSPNGGK-PSDVLTKAVEKDFGSWDNIKNQ 473
            +      A  A  FN    + NH+ +W ++ P GG  P   L + +E  FGS D  K Q
Sbjct: 92  ILTRSFGPASDAAVFNNAAQLWNHTFYWRSMRPKGGGIPPQGLREKIEASFGSVDACKRQ 151

Query: 474 LSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQY 650
           L+ A+++  GSGW WL  +    KL++    N D PL  T+GL PL  +DVWEHAYYL Y
Sbjct: 152 LAGAAISQFGSGWAWLVQDGD--KLRVVKTGNADNPL--TSGLTPLLNVDVWEHAYYLDY 207

Query: 651 KNVRADYVKAIFD-VANWNDISQRYEKA 731
           +N RADYV A+ D + +W + +QR  KA
Sbjct: 208 QNRRADYVNAVLDKLIDW-EFAQRNLKA 234


>UniRef50_Q30RH4 Cluster: Superoxide dismutase; n=1; Thiomicrospira
           denitrificans ATCC 33889|Rep: Superoxide dismutase -
           Thiomicrospira denitrificans (strain ATCC 33889 / DSM
           1351)
          Length = 225

 Score =  144 bits (350), Expect = 2e-33
 Identities = 72/193 (37%), Positives = 109/193 (56%), Gaps = 2/193 (1%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQA-KGDIDTIINLAP 332
           L +LP+ ++ALEP IS+E +  H+ KHH  Y+N LN   E +  ++  K  +  II  + 
Sbjct: 4   LTKLPFTHDALEPFISKETIEYHYGKHHTGYVNKLN---ELIKDSEFDKMSLSAIIRDSD 60

Query: 333 ALKFNGGGHI-NHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSG 509
              FN    + NHS +W++L+ +  KPS  L + ++ DFGS D ++ +   A V + GSG
Sbjct: 61  GAVFNNAAQVFNHSFYWNSLASSKSKPSKKLQEKIDNDFGSLDKLREEFIKAGVTLFGSG 120

Query: 510 WGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFD 689
           W WL    +   +   T     PL   + L+P+F  DVWEHAYYL YKN+R  Y++  ++
Sbjct: 121 WVWLCREPKGMLVLKQTSNAHTPL--ASNLIPIFVCDVWEHAYYLDYKNLRQKYLEEFWE 178

Query: 690 VANWNDISQRYEK 728
             NW   +Q YEK
Sbjct: 179 HINWEFATQAYEK 191


>UniRef50_P18655 Cluster: Superoxide dismutase [Fe]; n=10; cellular
           organisms|Rep: Superoxide dismutase [Fe] - Synechococcus
           sp. (strain PCC 7942) (Anacystis nidulans R2)
          Length = 201

 Score =  142 bits (345), Expect = 8e-33
 Identities = 77/201 (38%), Positives = 106/201 (52%), Gaps = 6/201 (2%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDIDTII- 320
           + LP LP++Y AL P I++E +  HH KHHA Y+NN N  V +  L     +  I  I  
Sbjct: 3   YELPALPFDYTALAPYITKETLEFHHDKHHAAYVNNYNNAVKDTDLDGQPIEAVIKAIAG 62

Query: 321 NLAPALKFNGGGHI-NHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           + + A  FN      NHS +W+++ PN GG P+  L   +  DFGS++N   +   A+  
Sbjct: 63  DASKAGLFNNAAQAWNHSFYWNSIKPNGGGAPTGALADKIAADFGSFENFVTEFKQAAAT 122

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
             GSGW WL  +     L+I    N D      G  PL  IDVWEHAYYL Y+N R DY+
Sbjct: 123 QFGSGWAWLVLDN--GTLKITKTGNAD-TPIAHGQTPLLTIDVWEHAYYLDYQNRRPDYI 179

Query: 675 KAIFD-VANWNDISQRYEKAL 734
               + +ANW+  S  Y  A+
Sbjct: 180 STFVEKLANWDFASANYAAAI 200


>UniRef50_Q3YB09 Cluster: Manganese superoxide dismutase; n=4;
           cellular organisms|Rep: Manganese superoxide dismutase -
           Porphyra yezoensis
          Length = 224

 Score =  141 bits (341), Expect = 2e-32
 Identities = 79/210 (37%), Positives = 124/210 (59%), Gaps = 18/210 (8%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEK------LAQAQAKGDID 311
           LP LPY Y+ALEP I    M++HH+KHH TY+ N+N  +A E       L+ +  + ++ 
Sbjct: 5   LPPLPYAYDALEPYIDSTTMNIHHTKHHNTYVTNVNNVLAGENGGALKGLSLSAIQKEVV 64

Query: 312 TI-INLAPALKFNGGGHINHSIFWHNLSPNGG---KPSDVLTKAVEKDFGSWDNIKNQLS 479
           T+  ++  A++ +GGGH NHS FW  +   G     P+  L  ++E  FGS D ++ + +
Sbjct: 65  TLPDSIKTAVRNSGGGHWNHSFFWSVMGKTGSIAEAPTGDLKSSIESTFGSLDEMQKKFN 124

Query: 480 TASVAVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLV-----PLFGIDVWEHAYY 641
           TA+ +  GSGW WL  N    +L I++  NQD PL    G+V     P+ G+DVWEHAYY
Sbjct: 125 TAAASRFGSGWAWLSVNAD-GQLFISSTPNQDNPLM--EGIVDQPGTPILGLDVWEHAYY 181

Query: 642 LQYKNVRADYVKAIFDVANWNDISQRYEKA 731
           L+Y+N R +Y+ + +   +++ I++ Y  A
Sbjct: 182 LKYQNRRPEYIASWWKTVDFDVIAKNYSAA 211


>UniRef50_Q9A2K4 Cluster: Superoxide dismutase; n=3;
           Alphaproteobacteria|Rep: Superoxide dismutase -
           Caulobacter crescentus (Caulobacter vibrioides)
          Length = 206

 Score =  139 bits (337), Expect = 8e-32
 Identities = 75/197 (38%), Positives = 101/197 (51%), Gaps = 3/197 (1%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           +TLP+LPY Y+ALEP IS   +  HH KHHA Y+  LN     L     KG ++ +I  A
Sbjct: 3   YTLPDLPYAYDALEPTISANTLRFHHDKHHAAYVTALN----GLLNGDDKGSLEAVIKGA 58

Query: 330 -PALKFNGGGHI-NHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG 503
            P   FN      NH+ FW  LSP    P   L  A++  FG  D +K +     +   G
Sbjct: 59  GPGKVFNNAAQAWNHAFFWDGLSPTKTAPGAELAAAIDATFGGMDALKEKFVAEGIGHFG 118

Query: 504 SGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAI 683
           SGW WL  +       I+T   + P+  T  L  L   DVWEHAYYL Y+N+R  +++A+
Sbjct: 119 SGWVWLVSDASGALKIISTHDAESPV--TQDLTALVVADVWEHAYYLDYQNLRKGFLEAV 176

Query: 684 FD-VANWNDISQRYEKA 731
           FD + NW     +Y  A
Sbjct: 177 FDNLINWTLADSQYAAA 193


>UniRef50_Q8YFZ5 Cluster: SUPEROXIDE DISMUTASE; n=7;
           Rhizobiales|Rep: SUPEROXIDE DISMUTASE - Brucella
           melitensis
          Length = 243

 Score =  139 bits (337), Expect = 8e-32
 Identities = 75/198 (37%), Positives = 103/198 (52%), Gaps = 6/198 (3%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEE--KLAQAQAKGDIDTIINLA 329
           LP LPY+Y+AL P +SRE +  HH KHH  Y+ N N   E   L     +  +       
Sbjct: 49  LPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKESFGKN 108

Query: 330 PALKFNGGGHINHSIFWHNLSPNGG--KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG 503
            AL  N G H NH +FW  +  +GG  K    L KA + D G +D  +     A     G
Sbjct: 109 QALFNNAGQHYNHILFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGAGQFG 168

Query: 504 SGWGWLGYNKQMKKLQIATCQN-QDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKA 680
           SGW WL       KL+I+   N ++PL    G  P+ G+DVWEH+YY+ Y+N R  Y++A
Sbjct: 169 SGWAWLSVKD--GKLEISKTPNGENPL--VHGAAPILGVDVWEHSYYIDYRNARPKYLEA 224

Query: 681 IFD-VANWNDISQRYEKA 731
             D + NW+ + + YEKA
Sbjct: 225 FVDSLVNWDYVLEMYEKA 242


>UniRef50_A5FGP6 Cluster: Superoxide dismutase precursor; n=1;
           Flavobacterium johnsoniae UW101|Rep: Superoxide
           dismutase precursor - Flavobacterium johnsoniae UW101
          Length = 260

 Score =  139 bits (336), Expect = 1e-31
 Identities = 72/198 (36%), Positives = 114/198 (57%), Gaps = 5/198 (2%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLA-QAQAKGDIDTIINLAP 332
           L +LP+ Y+ L P +    M  H+SKH+ +Y NN N A      +     DI   ++L  
Sbjct: 58  LTKLPFAYDGLSPALRSLTMETHYSKHYLSYTNNFNKAIVSTEFENMPIEDILKKLDLNN 117

Query: 333 A-LKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSG 509
           A L+ N GG+ NH+++++ L+P    P D L+ ++ K+FGS++N+  Q    +    GSG
Sbjct: 118 AKLRQNAGGYYNHTLYFNILTPKEQTPKDTLSGSINKEFGSFNNLTTQFKGQAEKQFGSG 177

Query: 510 WGWLGYNKQMKKLQIATCQNQD-PLQATTGL--VPLFGIDVWEHAYYLQYKNVRADYVKA 680
           W WL  ++   KLQI T ++QD PL     +   P+ GID+WEHAYYL Y+N +  Y+ A
Sbjct: 178 WVWLVVDR-YGKLQITTTEDQDNPLMKNALIPGTPILGIDLWEHAYYLDYQNRKGSYIDA 236

Query: 681 IFDVANWNDISQRYEKAL 734
            ++  NW  +++ Y +AL
Sbjct: 237 FYEHINWEKVNEYYIEAL 254


>UniRef50_Q4ULI1 Cluster: Superoxide dismutase [Mn/Fe]; n=18;
           Proteobacteria|Rep: Superoxide dismutase [Mn/Fe] -
           Rickettsia felis (Rickettsia azadi)
          Length = 209

 Score =  139 bits (336), Expect = 1e-31
 Identities = 76/198 (38%), Positives = 102/198 (51%), Gaps = 7/198 (3%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAP- 332
           LP+LPY+  + +P  + E    HH KHH  Y+ NLN   +   + Q K D++ II  +  
Sbjct: 16  LPDLPYDKESFKPHFTPETFDYHHGKHHNAYVQNLNNLLKDKEELQKK-DLEEIIEWSSQ 74

Query: 333 ---ALKFNGGGHI-NHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVAV 497
              A  FN    I NHS FWH++ P GG KPS  + + + KDFGS++    Q    +V  
Sbjct: 75  NSNAAIFNNAAQIWNHSFFWHSIKPQGGGKPSGKILEQINKDFGSFEGFCEQFKQEAVGQ 134

Query: 498 QGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVK 677
            GSGW WL Y+    +LQI    N        G+ PL   DVWEHAYY+ Y+N R DYV 
Sbjct: 135 FGSGWAWLVYHD--NRLQIIKTANAG-TPIANGMKPLLACDVWEHAYYIDYRNKRPDYVD 191

Query: 678 A-IFDVANWNDISQRYEK 728
             I  + NW  +     K
Sbjct: 192 IFIKHMINWKFVEDNLIK 209


>UniRef50_Q9KQF3 Cluster: Superoxide dismutase; n=35; Bacteria|Rep:
           Superoxide dismutase - Vibrio cholerae
          Length = 194

 Score =  138 bits (335), Expect = 1e-31
 Identities = 71/193 (36%), Positives = 105/193 (54%), Gaps = 2/193 (1%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPA 335
           LP LPY  +ALEP IS E +  HH KHH TY+  LN       + + K  ++ II  +  
Sbjct: 5   LPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPG-TEFENKS-LEEIIKTSTG 62

Query: 336 LKFNGGGHI-NHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSG 509
             FN    + NH+ +WH LSPNGG +P+  + +A+   FGS+ + K + + +++   GS 
Sbjct: 63  GIFNNAAQVWNHTFYWHCLSPNGGGEPTGAVAEAINAAFGSFADFKAKFTDSAINNFGSS 122

Query: 510 WGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFD 689
           W WL   K    L I    N        G+ PL  +D+WEHAYY+ Y+NVR DY+   + 
Sbjct: 123 WTWL-VKKADGTLAITNTSNAATPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFWA 181

Query: 690 VANWNDISQRYEK 728
           + NW+ ++Q   K
Sbjct: 182 LVNWDFVAQNLAK 194


>UniRef50_Q6MHD3 Cluster: Superoxide dismutase; n=1; Bdellovibrio
           bacteriovorus|Rep: Superoxide dismutase - Bdellovibrio
           bacteriovorus
          Length = 206

 Score =  138 bits (335), Expect = 1e-31
 Identities = 69/191 (36%), Positives = 99/191 (51%), Gaps = 2/191 (1%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPA 335
           LP LPY    + P+ + E M+ H+ KHH  YI+NLN   E  A  + K   +  +     
Sbjct: 4   LPNLPYAKTGIAPLFNEEQMTYHYDKHHKAYIDNLNKFMETDASLKGKSLEEITLTSTGG 63

Query: 336 LKFNGGGHINHSIFWHNLSP--NGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSG 509
           +  N     NH+ FW  +SP   GG+PS  L+ A+ +DFGS D +K +     V   GSG
Sbjct: 64  IFNNAAQAWNHTFFWFGMSPAGQGGQPSAELSAAITRDFGSMDELKAKFVDGGVKTFGSG 123

Query: 510 WGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFD 689
           W WL  +   K   ++T     P     G  PL   DVWEHAYY+ Y+N+RA Y++  + 
Sbjct: 124 WIWLCMDAAGKLSLVSTSNAAVPF-TNNGPTPLLVADVWEHAYYVDYRNLRAKYLETFWA 182

Query: 690 VANWNDISQRY 722
             NWN +S+ +
Sbjct: 183 QVNWNFVSENF 193


>UniRef50_Q4QIE0 Cluster: Superoxide dismutase; n=14;
           Trypanosomatidae|Rep: Superoxide dismutase - Leishmania
           major
          Length = 230

 Score =  138 bits (334), Expect = 2e-31
 Identities = 78/197 (39%), Positives = 108/197 (54%), Gaps = 5/197 (2%)
 Frame = +3

Query: 156 LPELPYEY-NALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDI--DTIINL 326
           LP L + Y + ++PV+S   + LH+SKHH+ Y++ LN   +       +  I   T IN 
Sbjct: 35  LPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINE 94

Query: 327 APALKFNGGGHINHSIFWHNLSPNGGKPSD-VLTKAVEKDFGSWDNIKNQLSTASVAVQG 503
           +  +      H NHS FW  LSP GGKP    L  A+ K FGS D+       A V   G
Sbjct: 95  SKVMFNQAAQHFNHSFFWKCLSP-GGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFG 153

Query: 504 SGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKA 680
           SGW WL  + Q K+L I +  N   PL  T+GL P+F  DVWEHAYY  ++N RADY+K 
Sbjct: 154 SGWTWLCVDPQTKELLIDSTSNAGCPL--TSGLRPIFTADVWEHAYYKDFENRRADYLKE 211

Query: 681 IFDVANWNDISQRYEKA 731
           ++ + +W  +   YE+A
Sbjct: 212 LWQIVDWEFVCHMYERA 228


>UniRef50_Q89CM3 Cluster: Superoxide dismutase; n=2;
           Rhizobiales|Rep: Superoxide dismutase - Bradyrhizobium
           japonicum
          Length = 213

 Score =  137 bits (332), Expect = 3e-31
 Identities = 79/210 (37%), Positives = 107/210 (50%), Gaps = 10/210 (4%)
 Frame = +3

Query: 132 GASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVA------EEKLAQAQ 293
           G      TLP LPY Y+AL   +S+E +  HH KHH  Y+ N N A      E K  +  
Sbjct: 12  GQEPMTFTLPPLPYAYDALGQFMSKETLEFHHDKHHQAYVTNGNNALKGTEWEGKSLEEI 71

Query: 294 AKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGG--KPSDVLTKAVEKDFGSWDNIK 467
            KG         PA+  N G H NH  FW  + PNGG  K    L K + +D G ++  K
Sbjct: 72  VKGS----FGKNPAVFNNAGQHYNHIHFWSWMKPNGGGTKLPGKLEKKINEDLGGFEKFK 127

Query: 468 NQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQN-QDPLQATTGLVPLFGIDVWEHAYYL 644
                A V   GSGW WL    +  KL+I+   N ++PL    G  P+ G DVWEH+YY+
Sbjct: 128 TDFQAAGVGQFGSGWCWL--QVKNGKLEISKTPNGENPL--VHGATPILGCDVWEHSYYI 183

Query: 645 QYKNVRADYVKA-IFDVANWNDISQRYEKA 731
            Y+N R DY+KA + ++ NW  +   ++KA
Sbjct: 184 DYRNRRPDYLKAFVENLVNWEYVESLFDKA 213


>UniRef50_P77968 Cluster: Superoxide dismutase [Fe]; n=105; cellular
           organisms|Rep: Superoxide dismutase [Fe] - Synechocystis
           sp. (strain PCC 6803)
          Length = 199

 Score =  137 bits (332), Expect = 3e-31
 Identities = 74/194 (38%), Positives = 101/194 (52%), Gaps = 6/194 (3%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDIDTII- 320
           + LP LPY+Y ALEP IS+  +  HH KHHA Y+NN N  VA   L     +  I  +  
Sbjct: 3   YALPNLPYDYTALEPCISKSTLEFHHDKHHAAYVNNFNNAVAGTDLDNQSIEDVIKAVAG 62

Query: 321 NLAPALKFNGGGHI-NHSIFWHNLSP-NGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           + + A  FN      NHS +W+ + P  GG+PS  L   +  DFGS+D        A   
Sbjct: 63  DASKAGIFNNAAQAWNHSFYWNCMKPGGGGQPSGALADKINADFGSFDAFVEAFKQAGAT 122

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
             GSGW WL  +    K+   T   ++P+  T G  PL  +DVWEHAYYL Y+N R DY+
Sbjct: 123 QFGSGWAWLVLDNGTLKV-TKTGNAENPM--TAGQTPLLTMDVWEHAYYLDYQNRRPDYI 179

Query: 675 KAIF-DVANWNDIS 713
                 + NW+ ++
Sbjct: 180 ADFLGKLVNWDFVA 193


>UniRef50_Q8GR34 Cluster: Superoxide dismutase precursor; n=9;
           cellular organisms|Rep: Superoxide dismutase precursor -
           Desulfovibrio vulgaris
          Length = 238

 Score =  135 bits (326), Expect = 2e-30
 Identities = 79/223 (35%), Positives = 116/223 (52%), Gaps = 8/223 (3%)
 Frame = +3

Query: 75  TSLVIMLMSQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYIN 254
           ++ V+   ++ +G  +  A  +     +P LPY  N LEP IS   +S H+ KH A Y  
Sbjct: 16  SAAVVAAGTRLLGPTVAHAADAPDAFPMPPLPYPENGLEPAISARTISFHYGKHTAAYYG 75

Query: 255 NLN--VAEEKLAQAQAKGDIDTII-NLAPALKFNGGGHI-NHSIFWHNLSPNGG-KPSDV 419
           NLN  VA   +A  + +  I ++  + A A  FN      NH+ +W  + P GG  P   
Sbjct: 76  NLNKAVAGTPMATMKLEDVIKSVAGDPAKAGLFNNAAQSWNHTFYWAGMKPGGGGTPPAK 135

Query: 420 LTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKK--LQIATCQNQDPLQATT 593
           +  A+   FGS D    QLS A+     SGW WL   ++  K  L++    N +    T 
Sbjct: 136 VADALSAAFGSVDACVTQLSDAAKTQFASGWAWLAKGRENGKDVLKVLKTGNAET-PITQ 194

Query: 594 GLVPLFGIDVWEHAYYLQYKNVRADYVKAIFD-VANWNDISQR 719
           G  P+  IDVWEHAYYL Y+N R DYV+A FD + NW+++++R
Sbjct: 195 GYTPILTIDVWEHAYYLDYQNKRPDYVQAFFDKLVNWDEVAKR 237


>UniRef50_O30563 Cluster: Superoxide dismutase [Fe]; n=4; Borrelia
           burgdorferi group|Rep: Superoxide dismutase [Fe] -
           Borrelia burgdorferi (Lyme disease spirochete)
          Length = 203

 Score =  135 bits (326), Expect = 2e-30
 Identities = 73/204 (35%), Positives = 111/204 (54%), Gaps = 11/204 (5%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIIN---- 323
           LPEL Y+Y+A+EP I  + M +HHSKHH  ++ NLN   EK+ +     D+  I+     
Sbjct: 4   LPELGYDYDAVEPYIDAKTMEIHHSKHHNGFVMNLNSILEKMGKIHLT-DVSNILKNIHD 62

Query: 324 ----LAPALKFNGGGHINHSIFWHNLSPNGGKPS--DVLTKAVEKDFGSWDNIKNQLSTA 485
                   ++ N GG+ NH++++  L P G K +  +     +   FGS D +K  L   
Sbjct: 63  FPEEFQTLIRNNAGGYSNHTLYFRTLRP-GNKDNLFEKFKDDINAAFGSLDVLKANLKDT 121

Query: 486 SVAVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQYKNVR 662
           ++ + GSGW WL    +   L++ +  NQD PL       P+ GIDVWEHAYYL+Y+N R
Sbjct: 122 AMKIFGSGWAWLVLCPE-SGLKVISMPNQDSPLM--NSYKPILGIDVWEHAYYLKYQNRR 178

Query: 663 ADYVKAIFDVANWNDISQRYEKAL 734
            +YV A     NW ++S+ Y + +
Sbjct: 179 IEYVDAFLKALNWEEVSKVYNEVI 202


>UniRef50_Q6QF29 Cluster: Superoxide dismutase; n=1; Mycobacterium
           botniense|Rep: Superoxide dismutase - Mycobacterium
           botniense
          Length = 138

 Score =  134 bits (323), Expect = 4e-30
 Identities = 68/142 (47%), Positives = 88/142 (61%), Gaps = 4/142 (2%)
 Frame = +3

Query: 219 LHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPN 398
           LHHSKHHATY+   N A EKL +A+AK D         +L FN GGHINH+++W NLSPN
Sbjct: 1   LHHSKHHATYVKGANDALEKLEEARAKDDHSATALWEKSLAFNLGGHINHTLWWKNLSPN 60

Query: 399 GG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKL---QIATCQ 566
           GG KP+  L  A++  FGS+D  + Q + A+  V GSGW  LGY+    KL   Q+   Q
Sbjct: 61  GGDKPTGELAAAIDDAFGSFDKFRAQFTAAATTVMGSGWAALGYDSLANKLLVFQVYDHQ 120

Query: 567 NQDPLQATTGLVPLFGIDVWEH 632
           +  PL    G+VPL  +D+WEH
Sbjct: 121 SNFPL----GIVPLLMLDMWEH 138


>UniRef50_Q71S90 Cluster: Superoxide dismutase; n=13; Eukaryota|Rep:
           Superoxide dismutase - Leishmania major
          Length = 208

 Score =  134 bits (323), Expect = 4e-30
 Identities = 72/192 (37%), Positives = 99/192 (51%), Gaps = 3/192 (1%)
 Frame = +3

Query: 165 LPYEYNALEPV-ISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALK 341
           LPY ++AL    +S+E ++ HH KHH  Y   L  A E  +   +K  +D II       
Sbjct: 8   LPYPHDALASKGMSKEQVTFHHEKHHKGYAVKLTAAAESNSALASKSLVD-IIKSEKGPA 66

Query: 342 FNGGGHI-NHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWG 515
           FN    I NH  FW  LSP GG KP   +  A+   FGS+ N K + + A+    GSGW 
Sbjct: 67  FNCAAQIYNHDFFWRCLSPRGGSKPHGEIASAIIDSFGSFSNFKKEFTDAANGHFGSGWA 126

Query: 516 WLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVA 695
           WL  +K   KL++    +         LVP+   DVWEHAYY+ Y+N RA YV A +++ 
Sbjct: 127 WLVKDKSSGKLKVFQTHDAGCPLTEPDLVPILACDVWEHAYYIDYRNDRASYVSAFWNMV 186

Query: 696 NWNDISQRYEKA 731
           NW+  +  Y  A
Sbjct: 187 NWSHANHCYRAA 198


>UniRef50_A5GMK3 Cluster: Superoxide dismutase [Fe]; n=10; cellular
           organisms|Rep: Superoxide dismutase [Fe] - Synechococcus
           sp. (strain WH7803)
          Length = 199

 Score =  133 bits (321), Expect = 7e-30
 Identities = 74/194 (38%), Positives = 101/194 (52%), Gaps = 6/194 (3%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKL-AQAQAKGDIDTII-- 320
           HTLP LPY  +ALEP ISR  +  HH KHH  Y+ NLN A E      ++  ++ + +  
Sbjct: 3   HTLPALPYALDALEPHISRSTLEFHHGKHHNGYVTNLNKAIEGTDLDGKSLEEVISAVSG 62

Query: 321 NLAPALKFNGGGHI-NHSIFWHNLSP-NGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           + + A  FN    + NHS +W  + P  GG+PS  L   +  DFGS+D    Q   A   
Sbjct: 63  DASKAGVFNNAAQVWNHSFYWQCMKPGGGGQPSGALLDKINADFGSYDAFVEQFKAAGAT 122

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
             GSGW WL    +   L+I    N D L    G   L  +DVWEHAYYL Y+N R DY+
Sbjct: 123 QFGSGWAWL--IVENGTLKITKTANAD-LPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 675 KAIFD-VANWNDIS 713
               + + NW+ ++
Sbjct: 180 TTYLEKLVNWDFVA 193


>UniRef50_A6LUJ7 Cluster: Superoxide dismutase; n=2; Clostridium
           beijerinckii NCIMB 8052|Rep: Superoxide dismutase -
           Clostridium beijerinckii NCIMB 8052
          Length = 206

 Score =  132 bits (320), Expect = 9e-30
 Identities = 75/199 (37%), Positives = 113/199 (56%), Gaps = 10/199 (5%)
 Frame = +3

Query: 162 ELPYEYNALEPVISREIMSLHHSKHHATYINNLN---VAEEKLAQAQAKGDIDTIINLAP 332
           EL Y YN+LEP I  E + +H++KH   Y++ LN      EK  + +    I +  N  P
Sbjct: 7   ELTYSYNSLEPYIDEETVKIHYTKHLQGYVDKLNNVLKGYEKFTEGKTLEQIISNPNKIP 66

Query: 333 ALKFN-----GGGHINHSIFWHNLSPNGGK-PSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
              +      GGG +NH++++  L P   K P   L   +   FGS + +K  +S A++ 
Sbjct: 67  KKIYRDVINQGGGVLNHNLYFSILFPYPKKEPEGKLLNEIVSTFGSLEMLKKLVSEAAIN 126

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQYKNVRADY 671
             GSG+GWL  +K   KL++A   NQD PL  + G  P+  IDVWEH+YYL+YKN+R DY
Sbjct: 127 KFGSGYGWLVKDKH-GKLKVANSSNQDTPL--SFGFTPILTIDVWEHSYYLKYKNLRGDY 183

Query: 672 VKAIFDVANWNDISQRYEK 728
           VK I+++ +W  + + Y+K
Sbjct: 184 VKNIWNLIDWARVEELYKK 202


>UniRef50_Q6G141 Cluster: Superoxide dismutase; n=31; Bacteria|Rep:
           Superoxide dismutase - Bartonella quintana (Rochalimaea
           quintana)
          Length = 200

 Score =  132 bits (319), Expect = 1e-29
 Identities = 69/195 (35%), Positives = 103/195 (52%), Gaps = 5/195 (2%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDIDTIINLA 329
           L +LPY+Y+AL P +SRE +  HH KHH  Y+ N N  V +  L     +  +       
Sbjct: 5   LAKLPYDYDALSPYMSRETLEYHHDKHHLAYLTNTNNFVKDLGLENESLEHIVKKSFGQN 64

Query: 330 PALKFNGGGHINHSIFWHNLSPNGG--KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG 503
             L  N   + NH+ FWH +   GG  K  + L KA+E D G ++  +     A+VA  G
Sbjct: 65  IGLFNNAAQYYNHNHFWHWMKKGGGGQKLPEKLAKAIESDLGGYNKFRADFIAAAVAQFG 124

Query: 504 SGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAI 683
           SGW W+   K  K   + T  +++PL       P+ G+DVWEH+YY+ Y+N R  Y++A 
Sbjct: 125 SGWAWVAV-KDGKLEIMKTSNSENPL--VHDAQPILGVDVWEHSYYIDYRNARPKYLEAF 181

Query: 684 FD-VANWNDISQRYE 725
            D + NW+ + + YE
Sbjct: 182 VDNLINWDYVLKLYE 196


>UniRef50_Q8RPM8 Cluster: Superoxide dismutase; n=10;
           Alphaproteobacteria|Rep: Superoxide dismutase -
           Anaplasma phagocytophilum (Ehrlichia phagocytophila)
          Length = 206

 Score =  130 bits (314), Expect = 5e-29
 Identities = 73/202 (36%), Positives = 107/202 (52%), Gaps = 10/202 (4%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNV----AEEKLAQAQAKGDIDTIIN 323
           L +LPYE   LEP IS  ++  H++ HH TY++ LN      E +    ++ GDI    +
Sbjct: 4   LSDLPYE--GLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFEGLGNESLGDIVVKAH 61

Query: 324 ---LAPALKFNGGGHI-NHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTAS 488
               A    FN    I NH  +W ++ PNGG  P + L + +E  FGS +   N  +T+ 
Sbjct: 62  NSGSAGRAIFNNAAQIWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSG 121

Query: 489 VAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRAD 668
           +   GSGW WL Y++  K L++ +  N D    T G +PL  +DVWEHAYYL Y N+R  
Sbjct: 122 LGQFGSGWVWLVYDEDAKALKVVSTANADSPLLTQGQLPLATMDVWEHAYYLDYLNLRKK 181

Query: 669 YVKAIFD-VANWNDISQRYEKA 731
           Y+    + + NW+ +  R E A
Sbjct: 182 YIDVFLEHLLNWDFVLGRLEDA 203


>UniRef50_A1XRG3 Cluster: Superoxide dismutase; n=10; Ehrlichia
           ruminantium|Rep: Superoxide dismutase - Ehrlichia
           ruminantium (Cowdria ruminantium)
          Length = 210

 Score =  130 bits (313), Expect = 6e-29
 Identities = 73/205 (35%), Positives = 107/205 (52%), Gaps = 11/205 (5%)
 Frame = +3

Query: 153 TLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDIDTII-- 320
           TLPELPY+ + L P +S  +++ H+ KHH  Y+N LN  VA           D+  +I  
Sbjct: 3   TLPELPYQKDDLAPYLSANVLNYHYGKHHQGYVNALNNLVAGTDFCTC-TNEDLPAVIKA 61

Query: 321 ---NLAPALKFNGGGHI-NHSIFWHNLSPNG-GKPSDVLTKAVEKDFGSWDNIKNQLSTA 485
              +LA    FN  G + NH+ +W +++ NG   P   L   + KDF S +   N  + A
Sbjct: 62  THSDLATRSIFNNAGQVWNHNFYWQSITKNGVVTPKGELLDRINKDFESVEKFNNAFTEA 121

Query: 486 SVAVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQYKNVR 662
                GSGW WL ++   +KL+I    N D P+       PL  +DVWEHAYYL Y NVR
Sbjct: 122 GKGHFGSGWVWLVFDTVEQKLKILCTANGDTPITQYPDTYPLLTMDVWEHAYYLDYFNVR 181

Query: 663 ADYVKAIF-DVANWNDISQRYEKAL 734
            +Y++     + NW+  SQR+ + +
Sbjct: 182 QNYIEIFLKHLVNWDFASQRFSQCI 206


>UniRef50_Q0PBW9 Cluster: Superoxide dismutase [Fe]; n=60;
           Proteobacteria|Rep: Superoxide dismutase [Fe] -
           Campylobacter jejuni
          Length = 220

 Score =  128 bits (308), Expect = 2e-28
 Identities = 73/204 (35%), Positives = 108/204 (52%), Gaps = 11/204 (5%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKG-DIDTIINLAP 332
           L +LPY+ NA    +S E  S HH KHH TY+ NLN     +   +  G D+ +II  + 
Sbjct: 4   LRKLPYDTNAFGDFLSAETFSYHHGKHHNTYVTNLN---NLIKDTEFAGKDLVSIIKTSN 60

Query: 333 ALKFNGGGHI-NHSIFWHNLSPN-----GGKPSDV---LTKAVEKDFGSWDNIKNQLSTA 485
              FN    + NH  ++  + P+     GG    +   L  A+EK+FGS +N K +    
Sbjct: 61  GGVFNNAAQVYNHDFYFDCIKPSTGCGCGGSCQSIDANLQAALEKEFGSLENFKAEFIKG 120

Query: 486 SVAVQGSGWGWLGYNKQMKKLQ-IATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVR 662
           +  V GSGW WL YN + +KL+ + T     P+  T   VPL  +DVWEHAYY+ ++N R
Sbjct: 121 ATGVFGSGWFWLVYNTKNQKLEFVGTSNAATPI--TEDKVPLLVVDVWEHAYYVDHRNAR 178

Query: 663 ADYVKAIFDVANWNDISQRYEKAL 734
             Y++  +   NW  +++ YE AL
Sbjct: 179 PAYLEKFYAHINWEFVAKAYEWAL 202


>UniRef50_P21276 Cluster: Superoxide dismutase [Fe], chloroplast
           precursor; n=57; cellular organisms|Rep: Superoxide
           dismutase [Fe], chloroplast precursor - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 212

 Score =  127 bits (307), Expect = 3e-28
 Identities = 71/207 (34%), Positives = 106/207 (51%), Gaps = 6/207 (2%)
 Frame = +3

Query: 129 AGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKG 302
           + A    + L   P+  +ALEP +S++ +  H  KHH  Y++NL   V   +L     + 
Sbjct: 4   SSAVTANYVLKPPPFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEH 63

Query: 303 DIDTIINLAPALK-FNGGGHI-NHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQ 473
            I +  N    L  FN      NH  FW ++ P GG KPS  L   +E+DF S++    +
Sbjct: 64  IIHSTYNNGDLLPAFNNAAQAWNHEFFWESMKPGGGGKPSGELLALLERDFTSYEKFYEE 123

Query: 474 LSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYK 653
            + A+    G+GW WL Y+ +  K+ + T    +PL    G  PL  IDVWEHAYYL ++
Sbjct: 124 FNAAAATQFGAGWAWLAYSNEKLKV-VKTPNAVNPL--VLGSFPLLTIDVWEHAYYLDFQ 180

Query: 654 NVRADYVKAIF-DVANWNDISQRYEKA 731
           N R DY+K    ++ +W  +S R E A
Sbjct: 181 NRRPDYIKTFMTNLVSWEAVSARLEAA 207


>UniRef50_Q76B44 Cluster: Iron-superoxide dismutase; n=2; cellular
           organisms|Rep: Iron-superoxide dismutase - Matteuccia
           struthiopteris (Ostrich fern)
          Length = 262

 Score =  127 bits (306), Expect = 4e-28
 Identities = 74/206 (35%), Positives = 110/206 (53%), Gaps = 14/206 (6%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDIDTIINLA 329
           L  LP+E +AL+P +S++ + +H  KHH +Y++NLN  +   +L   Q    +    N A
Sbjct: 40  LKPLPFEMDALDPHMSKQTLEIHWGKHHRSYVDNLNKQIVGTELESMQLDELLKFGYNNA 99

Query: 330 -PALKFNGGGHI-NHSIFWHNLSPNGGK-PSDVLTKAVEKDFGSWDNIKNQLSTASVAVQ 500
            P   FN  G + NH  F +++ P GGK PS  +   +++DFGS++   ++   A+ A  
Sbjct: 100 NPTAYFNNAGQVWNHDFFGNSIKPEGGKQPSGEVLYLIKRDFGSFEAFVDEFKQAAAAQF 159

Query: 501 GSGWGWLG-------YNKQMKKLQIATCQNQ-DPLQATTGLVPLFGIDVWEHAYYLQYKN 656
           GSGW WL          K   KL I    N  +PL    G +PL  IDVWEHAYYL ++N
Sbjct: 160 GSGWAWLFAKKTDPLVEKNFAKLAIEKTHNAVNPL--ILGHIPLLTIDVWEHAYYLDFQN 217

Query: 657 VRADYVKAIFD-VANWNDISQRYEKA 731
            RADY+    D + +W  +  R  +A
Sbjct: 218 RRADYISTFIDELISWETVIARLARA 243


>UniRef50_Q5NNM6 Cluster: Superoxide dismutase; n=3;
           Sphingomonadaceae|Rep: Superoxide dismutase - Zymomonas
           mobilis
          Length = 208

 Score =  126 bits (304), Expect = 8e-28
 Identities = 68/194 (35%), Positives = 100/194 (51%), Gaps = 4/194 (2%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDIDTIINLA 329
           LP LP+    LEP +S E +  HH KHH +Y++ +N  V E+KLA       I+  +   
Sbjct: 5   LPALPFGAKDLEPHMSAETLEYHHGKHHKSYVDKVNSWVDEKKLAGLSLVEVINKAVETK 64

Query: 330 PALKFNGGGHI-NHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
               FN      NH+ FW  L+  G KPS  L   +E+ FGS + +  +L+  +V   GS
Sbjct: 65  DKGLFNNAAQAWNHNFFWLGLAKAGQKPSGKLASLIEESFGSTEALLEKLAAEAVGHFGS 124

Query: 507 GWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
           GW WL       KL I +  + D   A   + PL  +DVWEHAYY+ Y+N R  Y K + 
Sbjct: 125 GWAWLVLKD--GKLAITSYHDGDTPVAHKEVKPLLTLDVWEHAYYIDYRNARPKYAKDVL 182

Query: 687 -DVANWNDISQRYE 725
            ++ NW  +++  +
Sbjct: 183 SNIINWEFVAKNLD 196


>UniRef50_Q5FB28 Cluster: Chloroplastic iron-superoxide dismutase
           precursor; n=10; Poaceae|Rep: Chloroplastic
           iron-superoxide dismutase precursor - Zea mays (Maize)
          Length = 258

 Score =  126 bits (304), Expect = 8e-28
 Identities = 72/220 (32%), Positives = 116/220 (52%), Gaps = 10/220 (4%)
 Frame = +3

Query: 102 QRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKL 281
           QR G L R        + L   PY+ +ALEP +S+  + LH  KHH  Y++ LN    +L
Sbjct: 30  QRHGGLSRRFSKVVSYYGLTTPPYKLDALEPYMSKRTVELHWGKHHQDYVDGLN---NQL 86

Query: 282 AQAQAKG-DIDTIINLA-----PALKFNGGGHI-NHSIFWHNLSPNGGK-PSDVLTKAVE 437
           A +   G  ++ +I  A     P  ++N    + NH  FW ++ P GG  P   + + +E
Sbjct: 87  ATSPLYGYTLEDLIKEAYNNGNPLPEYNNAAQVWNHHFFWESMQPEGGGLPEGGVLQQIE 146

Query: 438 KDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQ-DPLQATTGLVPLFG 614
           KDFGS+ N + +   +++ + GSGW WL   +  +KL +   +N   PL    G +P+  
Sbjct: 147 KDFGSFTNFREEFIRSALQLLGSGWVWLVLKRNERKLSVVHTRNAISPL--AFGDIPIIS 204

Query: 615 IDVWEHAYYLQYKNVRADYVKAIFD-VANWNDISQRYEKA 731
           +D+WEHAYYL YK+ +  YV    D + +W+ ++ R  +A
Sbjct: 205 LDLWEHAYYLDYKDDKLTYVTNFMDHLVSWHTVTLRMMRA 244


>UniRef50_Q3SGN8 Cluster: Superoxide dismutase; n=1; Thiobacillus
           denitrificans ATCC 25259|Rep: Superoxide dismutase -
           Thiobacillus denitrificans (strain ATCC 25259)
          Length = 234

 Score =  124 bits (300), Expect = 2e-27
 Identities = 73/197 (37%), Positives = 105/197 (53%), Gaps = 7/197 (3%)
 Frame = +3

Query: 135 ASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDI 308
           A R  + LP LPY  +AL P+IS   +  HH +HH  YI+ LN  + + +      +  I
Sbjct: 35  AMRFPYELPPLPYGPDALRPLISGNTIRFHHREHHQRYIDGLNRGIDDTEFGAMPLRAVI 94

Query: 309 -DTIINLAPALKFNGGGHI-NHSIFWHNLSP-NGGKPSDVLTKAVEKDFGSWDNIKNQLS 479
             T      A+ FN      NH+ +W +L+P  GG P   L K ++  FGS D    QL+
Sbjct: 95  RATAGKPETAVIFNNAAQAWNHAFYWDSLTPQGGGLPPPALRKMIDASFGSVDACLRQLA 154

Query: 480 TASVAVQGSGWGWLGYNKQMKKLQIA-TCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKN 656
            A++A  G+GW WL   +  KK+++  TC   +PL  T  L PL  ID+WEHAYYL Y+N
Sbjct: 155 HAAIAQFGTGWVWLA--RDDKKIRVVRTCGADNPL--TRELTPLLAIDLWEHAYYLDYQN 210

Query: 657 VRADYVKAIFD-VANWN 704
              D+V  +   + NW+
Sbjct: 211 RLEDHVSGVIGRLVNWD 227


>UniRef50_Q6J6P7 Cluster: Superoxide dismutase; n=6; Plasmodium|Rep:
           Superoxide dismutase - Plasmodium falciparum
          Length = 266

 Score =  124 bits (298), Expect = 4e-27
 Identities = 64/186 (34%), Positives = 100/186 (53%), Gaps = 2/186 (1%)
 Frame = +3

Query: 153 TLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAP 332
           +L +LP+    + P +S E +  H+SKHHATY+ NLN   E+    ++    D I     
Sbjct: 74  SLMKLPFNPQDMSPFLSEEAIKYHYSKHHATYVKNLNNLSEQHKDLKSLTLEDIIKKYDG 133

Query: 333 ALKFNGGGHINHSIFWHNL-SPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSG 509
           ++  N     NH+ FW  L    GG P   + + +++ F S++N KN+    +    GSG
Sbjct: 134 SIHNNAAQIFNHNFFWLGLKEQGGGMPYGEIKEKLDESFNSFENFKNEFIKQASGHFGSG 193

Query: 510 WGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
           W WL      +KL+I    + D P++   G  P+  +D+WEH+YY+ YKN RADY+K  F
Sbjct: 194 WIWLIIKD--RKLEIFQGHDADSPIKQNIG-KPILTLDIWEHSYYVDYKNSRADYIKEWF 250

Query: 687 DVANWN 704
           +  NW+
Sbjct: 251 NKINWD 256


>UniRef50_Q1FM05 Cluster: Superoxide dismutase; n=1; Clostridium
           phytofermentans ISDg|Rep: Superoxide dismutase -
           Clostridium phytofermentans ISDg
          Length = 223

 Score =  123 bits (297), Expect = 5e-27
 Identities = 75/207 (36%), Positives = 113/207 (54%), Gaps = 19/207 (9%)
 Frame = +3

Query: 165 LPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTII--NLAPA- 335
           LPY  +AL P IS   +  HH KH  TY++NLN A +   + Q+    + I+  NL P+ 
Sbjct: 15  LPYARDALSPNISEYTLYFHHEKHLKTYVDNLNKALKDYPEFQSWNLEELIVHNNLLPSA 74

Query: 336 ----LKFNGGGHINHSIFWHNLS-------PNGGKPSDV----LTKAVEKDFGSWDNIKN 470
               ++ N GG  NH+++++++        P     S V        + + FG+++  K 
Sbjct: 75  IQIPVQHNAGGVYNHNLYFYSMKSPSKPSMPPAQNTSQVTGNDFLNLINQTFGNFNEFKA 134

Query: 471 QLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQ 647
           ++  A++ V GSG+ WL  N +  +L I T  NQD PL  T GL+PL  IDVWEHAYYL 
Sbjct: 135 KMKEAALQVFGSGYAWLVSNSR-GELSIVTTANQDTPL--TLGLIPLLPIDVWEHAYYLD 191

Query: 648 YKNVRADYVKAIFDVANWNDISQRYEK 728
           Y+N R DY+   FD+ NW+ +   Y +
Sbjct: 192 YQNRRNDYIDEWFDLINWDFVYYLYNR 218


>UniRef50_Q5CFH8 Cluster: Superoxide dismutase; n=4;
           Cryptosporidium|Rep: Superoxide dismutase -
           Cryptosporidium hominis
          Length = 221

 Score =  123 bits (296), Expect = 7e-27
 Identities = 68/189 (35%), Positives = 102/189 (53%), Gaps = 6/189 (3%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPA 335
           LP LPY+  AL PVIS E +  HH KHHA Y+  LN +  K  + + + D+  +I  +  
Sbjct: 29  LPPLPYDKKALLPVISPETLDYHHGKHHAGYVTKLN-SLIKSTEFENETDLMKVIMKSSG 87

Query: 336 LKFNGGGHI-NHSIFWHNL-SPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
             +N    I NH+ +W  L SP+   KP+  ++K +E+ FGS+++ K   +  +    GS
Sbjct: 88  PIYNNASQIWNHTFYWSCLRSPSETNKPTSKVSKLIEESFGSFESFKESFTANATGHFGS 147

Query: 507 GWGWL---GYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVK 677
           GW W+     N Q  K+ + T    +P +   G  P+   DVWEHAYY+ Y+N R  YV 
Sbjct: 148 GWIWVVIDPINNQKLKI-VQTHDGDNPEKLGLG-KPVLTCDVWEHAYYIDYRNNRGSYVD 205

Query: 678 AIFDVANWN 704
             F + NW+
Sbjct: 206 QFFSIINWD 214


>UniRef50_Q4UIZ9 Cluster: Fe/Mn superoxide dismutase (SOD),
           putative; n=1; Theileria annulata|Rep: Fe/Mn superoxide
           dismutase (SOD), putative - Theileria annulata
          Length = 209

 Score =  123 bits (296), Expect = 7e-27
 Identities = 69/191 (36%), Positives = 102/191 (53%), Gaps = 18/191 (9%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLN-VAEEKLAQAQAKGDI--DTIINL 326
           LP LPY    L P +S E ++ H++KHHA Y+N LN +      + ++  DI  +  + +
Sbjct: 5   LPPLPYGLKDLVPHLSEETLTYHYTKHHAGYVNKLNGLVNGTALENKSLEDIVCNNYLYV 64

Query: 327 APALK------FNGGGHI-NHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLST 482
              LK      FN    + NH+ +WH++SP+GG +P   + K +++ FGS+DN K + S+
Sbjct: 65  LDLLKTESGAVFNNAAQVWNHTFYWHSMSPSGGGEPRGTVRKLLDEKFGSFDNFKKEFSS 124

Query: 483 ASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGL-------VPLFGIDVWEHAYY 641
             V   GSGWGWL          + T    +PL+   G+        PL   DVWEHAYY
Sbjct: 125 VLVGHFGSGWGWLVLKSDGTPEVVQTHDAGNPLRYIYGICCSDNTGTPLLACDVWEHAYY 184

Query: 642 LQYKNVRADYV 674
           + Y+N RA YV
Sbjct: 185 VDYRNDRASYV 195


>UniRef50_Q1GWF8 Cluster: Superoxide dismutase; n=4;
           Sphingomonadales|Rep: Superoxide dismutase -
           Sphingopyxis alaskensis (Sphingomonas alaskensis)
          Length = 208

 Score =  122 bits (294), Expect = 1e-26
 Identities = 68/196 (34%), Positives = 102/196 (52%), Gaps = 6/196 (3%)
 Frame = +3

Query: 159 PELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPA- 335
           P LPY  +AL P IS + ++ HH KHH  Y++ +N A E    A     ++ II+ A   
Sbjct: 10  PPLPYAQDALAPHISADTLATHHGKHHKAYVDKVNAAIEGTELADKS--LEEIIHHAEGS 67

Query: 336 ----LKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG 503
               L  N     NH+ +W++L+P   +P+  L  A+E+DFGS   +K +L   +V    
Sbjct: 68  GNKGLFNNSAQSWNHAFYWNSLNPTKTEPAGDLLAAIERDFGSLGELKKKLKDTAVNHFA 127

Query: 504 SGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAI 683
           SGW WL        +   T  +    +   G+ PL  IDVWEHAYY+  KN+R  YV A+
Sbjct: 128 SGWAWLIARDGTLSV---TDTHDAGTELVAGIKPLLVIDVWEHAYYIDRKNLRPAYVDAV 184

Query: 684 FD-VANWNDISQRYEK 728
            D + NW+  ++ Y +
Sbjct: 185 VDELLNWDFAAENYAR 200


>UniRef50_UPI0000588D7C Cluster: PREDICTED: similar to manganese
           superoxide dismutase; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to manganese
           superoxide dismutase - Strongylocentrotus purpuratus
          Length = 269

 Score =  120 bits (290), Expect = 4e-26
 Identities = 70/217 (32%), Positives = 116/217 (53%), Gaps = 26/217 (11%)
 Frame = +3

Query: 141 RQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVA-----EEKLAQAQAKGD 305
           R ++ LP+LP+ Y+ LEP I    +++HH  HHA Y   LN A      E+     A   
Sbjct: 38  RSEYILPDLPFGYDDLEPYIDSATLNVHHRGHHAGYTRKLNAALHQWGSEEPDSYAATSI 97

Query: 306 IDTIINL-------APALKFNGGGHINHSIFWHNLSPNGGK----PSDVLTKAVEKDFGS 452
           +D + +L         +++ NGGG +NH+I+W  ++ N       PS  L   + + FGS
Sbjct: 98  LDLLQHLDDIPPKYKQSIRNNGGGFVNHNIYWSTMASNKENVTTMPSGDLLGEINESFGS 157

Query: 453 WDNIKNQLSTASVAVQGSGWGWLGYNK----------QMKKLQIATCQNQDPLQATTGLV 602
           ++  KNQ +  ++ + GSG+ WL   K          +   L I+T  NQD    + GL 
Sbjct: 158 FEEFKNQFTGRALTLFGSGYVWLSRRKPSSPFEEVEEEPASLIISTTANQDT-PISNGLQ 216

Query: 603 PLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWNDIS 713
           P+  +DVWEHAYYL+++N RA++++  + V +W+ ++
Sbjct: 217 PILVLDVWEHAYYLKHQNKRANHIEDWWRVVDWSAVA 253


>UniRef50_Q8YSZ1 Cluster: Superoxide dismutase [Fe]; n=26;
           Bacteria|Rep: Superoxide dismutase [Fe] - Anabaena sp.
           (strain PCC 7120)
          Length = 200

 Score =  120 bits (288), Expect = 7e-26
 Identities = 69/198 (34%), Positives = 104/198 (52%), Gaps = 9/198 (4%)
 Frame = +3

Query: 165 LPYEYNALEPV-ISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA--PA 335
           LPY++NALE   +  E    H+ KHH  Y++NLN   +    A     ++ +I +A   A
Sbjct: 8   LPYDFNALEQYGMKGETFEYHYGKHHKAYVDNLNKLTDGTELADKS--LEEVIQIAFKDA 65

Query: 336 LK---FNGGGHI-NHSIFWHNLSP-NGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQ 500
            K   FN    + NH+ FW++L P  GG P+      + +DFGS+D +K + S A+    
Sbjct: 66  SKAGIFNNAAQVWNHTFFWNSLKPAGGGAPTGEFAAKINQDFGSFDKLKEEFSNAAATQF 125

Query: 501 GSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKA 680
           GSGW WL  +    K+   T   ++PL    G   L  +DVWEHAYY+ ++N R  ++K 
Sbjct: 126 GSGWAWLIDDGGTLKV-TKTPNAENPL--AHGQKALLTLDVWEHAYYIDFRNARPAFIKN 182

Query: 681 IFD-VANWNDISQRYEKA 731
             D + NW+  +  Y KA
Sbjct: 183 YLDNLVNWDFAAANYAKA 200


>UniRef50_Q2GPK6 Cluster: Superoxide dismutase; n=1; Chaetomium
           globosum|Rep: Superoxide dismutase - Chaetomium globosum
           (Soil fungus)
          Length = 171

 Score =  118 bits (285), Expect = 2e-25
 Identities = 53/98 (54%), Positives = 68/98 (69%), Gaps = 4/98 (4%)
 Frame = +3

Query: 141 RQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTII 320
           R K TLP+L Y+Y ALEP IS +IM LHH+KHH TY+N LN A + + +A++KGD     
Sbjct: 35  RGKATLPDLAYDYGALEPHISGKIMELHHAKHHQTYVNGLNSALQTIGEAESKGDFTKAA 94

Query: 321 NLAPALKFNGGGHINHSIFWHNLSP----NGGKPSDVL 422
            +AP L F+GGGHINHS+FW NL+P     GG+P   L
Sbjct: 95  TVAPLLNFHGGGHINHSLFWENLAPASRDGGGEPDGAL 132



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +3

Query: 660 RADYVKAIFDVANWNDISQRYEKA 731
           +A+Y  AI++V NW  ++ RYEKA
Sbjct: 148 KAEYFDAIWNVINWKTVASRYEKA 171


>UniRef50_Q8ISI9 Cluster: Superoxide dismutase; n=1; Perkinsus
           marinus|Rep: Superoxide dismutase - Perkinsus marinus
          Length = 280

 Score =  118 bits (283), Expect = 3e-25
 Identities = 65/188 (34%), Positives = 99/188 (52%), Gaps = 9/188 (4%)
 Frame = +3

Query: 165 LPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALK- 341
           LPY   ALEPVIS   +  H++KHH  YI  L  A       +++ ++ +++ L P    
Sbjct: 84  LPYGLEALEPVISAATVDFHYNKHHQGYIQKLLDAT---GLPESRINLKSLVTLGPDRAG 140

Query: 342 ---FNGGGHI-NHSIFWHNLSPNGGKPSDV---LTKAVEKDFGSWDNIKNQLSTASVAVQ 500
              FN  G I NH+++W ++ P  G    V   L K +   +G+ D +K      + A+ 
Sbjct: 141 ENVFNAAGQIYNHNMYWLSMVPTSGSGRHVPPRLLKLIRARWGNVDEMKENFMRKATALF 200

Query: 501 GSGWGWLGYNKQMKKLQ-IATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVK 677
           GSGW WL ++ + ++L  + T     PL    G +PLF  DVWEHAYYL Y++ RA Y+ 
Sbjct: 201 GSGWIWLVWDTRERRLDLVGTKDAHSPLSEDAGKIPLFTCDVWEHAYYLDYQHDRAAYLT 260

Query: 678 AIFDVANW 701
             + + NW
Sbjct: 261 RWWSLINW 268


>UniRef50_A7RUV6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 208

 Score =  118 bits (283), Expect = 3e-25
 Identities = 63/198 (31%), Positives = 103/198 (52%), Gaps = 4/198 (2%)
 Frame = +3

Query: 144 QKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIIN 323
           +K+TLPELPY+YN LEP I    + +HH  HHA Y   LN A + + +   + +      
Sbjct: 2   EKYTLPELPYDYNELEPHIDEATLRVHHLGHHAAYTKKLNAALKDIVEI-LRNNEQIPDK 60

Query: 324 LAPALKFNGGGHINHSIFWHNLSPNGGK----PSDVLTKAVEKDFGSWDNIKNQLSTASV 491
               +  NGGG +NH+++W  +SPN       P+  +   ++K  G++   K        
Sbjct: 61  WRTDVINNGGGFVNHALYWATMSPNPKSEPRTPTGKIGDLIDKSHGNFSMFKQWFDEQVN 120

Query: 492 AVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADY 671
           ++ GSG+ WL  +     L I    NQ+   A   L P+  ID+WEHA+YL+++N R  Y
Sbjct: 121 SMFGSGYTWLCQDVTSGFLTILNMGNQESPVAYR-LNPVLVIDLWEHAFYLKHQNKRPGY 179

Query: 672 VKAIFDVANWNDISQRYE 725
           V + + + +W  +++  E
Sbjct: 180 VHSWWHLVDWERVNELLE 197


>UniRef50_Q96UQ8 Cluster: Superoxide dismutase; n=1; Rhodotorula
           glutinis|Rep: Superoxide dismutase - Rhodotorula
           glutinis (Yeast)
          Length = 191

 Score =  116 bits (280), Expect = 6e-25
 Identities = 57/109 (52%), Positives = 70/109 (64%), Gaps = 5/109 (4%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPA 335
           LP+LP+ YNALEP IS +IM LHHSKHHATY+ N N A E +  A    DI   I L   
Sbjct: 11  LPKLPFAYNALEPAISSQIMELHHSKHHATYVANFNKAHEDIQAASQAQDIKKQIALQAT 70

Query: 336 LKFNGGGHINHSIFWHNLSP---NGGK--PSDVLTKAVEKDFGSWDNIK 467
           +KFNGGGHINH++FW NL+P    GG+   S  L   V++DFG  D  +
Sbjct: 71  VKFNGGGHINHTLFWENLAPQSQGGGQFPSSGKLHDQVQQDFGGLDGFE 119


>UniRef50_Q3SAW8 Cluster: Superoxide dismutase; n=3;
           Magnoliophyta|Rep: Superoxide dismutase - Gossypium
           hirsutum (Upland cotton) (Gossypium mexicanum)
          Length = 272

 Score =  116 bits (278), Expect = 1e-24
 Identities = 61/188 (32%), Positives = 100/188 (53%), Gaps = 9/188 (4%)
 Frame = +3

Query: 168 PYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDI--DTIINLAPA 335
           PY  + LEP +S+  + +H   HH  +++NLN  + +  +       ++   T  N  P 
Sbjct: 64  PYNLDDLEPYMSKRALEVHWGVHHRDFVDNLNKQLGKSDILYGYTMDELVKATYNNGNPL 123

Query: 336 LKFNGGGHI--NHSIFWHNLSPNGGK-PSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
            +FN       NH  FW ++ P GG  P+  L + +EKDFGS+ N +     A++++ GS
Sbjct: 124 PEFNNAAAEVWNHDFFWESMQPGGGDMPNLGLLEQIEKDFGSFTNFREMFVEAALSLFGS 183

Query: 507 GWGWLGYNKQMKKLQIATCQNQ-DPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAI 683
           GW WL   +Q K+L +    N  +P+      +P+  +D+WEH+YYL YKN +A YV   
Sbjct: 184 GWVWLVLKRQEKRLVVVKTSNSINPI--VWDDIPILNLDMWEHSYYLDYKNDKARYVSTF 241

Query: 684 FD-VANWN 704
            + + +WN
Sbjct: 242 MNHLVSWN 249


>UniRef50_A4GXC5 Cluster: Superoxide dismutase; n=3; Plasmodium
           (Vinckeia)|Rep: Superoxide dismutase - Plasmodium
           berghei
          Length = 240

 Score = 91.1 bits (216), Expect(2) = 1e-23
 Identities = 47/116 (40%), Positives = 67/116 (57%), Gaps = 2/116 (1%)
 Frame = +3

Query: 363 NHSIFWHNLSPNG-GKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQM 539
           NH+ FW  L  NG GKP   + K +E+ F S++N K Q +  + +  GSGW WL   +  
Sbjct: 118 NHNFFWLGLKNNGEGKPYGEIKKKIEESFVSFENFKEQFTKEASSHFGSGWIWLVIKEH- 176

Query: 540 KKLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWN 704
            KL+I    + + P++   G  P+  +DVWEHAYY+ YKN R DY+K  F   NW+
Sbjct: 177 -KLKIYQGHDAECPIKHRIGN-PILTLDVWEHAYYVDYKNSRNDYIKEWFSKINWD 230



 Score = 42.3 bits (95), Expect(2) = 1e-23
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = +3

Query: 153 TLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN 263
           +L +LP+    ++P +S E +  H++KHHA YI NLN
Sbjct: 77  SLMKLPFNPQEMKPFLSEESIKYHYTKHHAAYIKNLN 113


>UniRef50_Q6BQZ0 Cluster: Superoxide dismutase; n=1; Debaryomyces
           hansenii|Rep: Superoxide dismutase - Debaryomyces
           hansenii (Yeast) (Torulaspora hansenii)
          Length = 196

 Score =  111 bits (266), Expect = 3e-23
 Identities = 55/129 (42%), Positives = 83/129 (64%), Gaps = 6/129 (4%)
 Frame = +3

Query: 141 RQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTII 320
           + K  LP+L + Y++LEP IS +I  +HH KHH TY+N  N A E+L +A+++GD+   I
Sbjct: 9   KNKIELPQLDWAYDSLEPYISGKINEIHHKKHHQTYVNGHNSAIEQLIEAESQGDVKKAI 68

Query: 321 NLAPALKFNGGGHINHSIFWHNLSP---NGGK--PSDV-LTKAVEKDFGSWDNIKNQLST 482
            +   +KF+GGGH NH +FW +L+P   NGGK   SD  L K + + +GS DN+ +  + 
Sbjct: 69  VIQQNIKFHGGGHTNHVLFWKSLAPNSQNGGKHPGSDTNLGKKIIEQYGSIDNLISITNA 128

Query: 483 ASVAVQGSG 509
              ++QGSG
Sbjct: 129 KLASIQGSG 137


>UniRef50_O67470 Cluster: Superoxide dismutase [Fe]; n=7; cellular
           organisms|Rep: Superoxide dismutase [Fe] - Aquifex
           aeolicus
          Length = 213

 Score =  109 bits (261), Expect = 1e-22
 Identities = 63/186 (33%), Positives = 99/186 (53%), Gaps = 7/186 (3%)
 Frame = +3

Query: 198 ISREIMSLHHSKHHATYINNLNVAEEKLA------QAQAKGDIDTIINLAPALKFNGGGH 359
           IS E +  H   H+  Y+   N  +EKLA      +++A  +      L     FN  G 
Sbjct: 20  ISNEQIEPHFEAHYKGYVAKYNEIQEKLADQNFADRSKANQNYSEYRELKVEETFNYMGV 79

Query: 360 INHSIFWHNLSPNG-GKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQ 536
           + H +++  L+P G G+PS+ L K +E+D G  D   N+L  A++A +G  W  LG +  
Sbjct: 80  VLHELYFGMLAPGGKGEPSEALKKKIEEDLGGLDACTNELKAAAIAFRG--WAILGLDIF 137

Query: 537 MKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQ 716
             +L +      + +   TGL+PL  ID +EHAYY+ YKN R  Y+ A F   NW+ +++
Sbjct: 138 SGRLVVNGLDAHN-VYNLTGLIPLIVIDTYEHAYYVDYKNKRPPYIDAFFKNINWDVVNE 196

Query: 717 RYEKAL 734
           R+EKA+
Sbjct: 197 RFEKAM 202


>UniRef50_Q5IZD9 Cluster: Superoxide dismutase; n=1; Acanthamoeba
           castellanii|Rep: Superoxide dismutase - Acanthamoeba
           castellanii (Amoeba)
          Length = 197

 Score =  108 bits (260), Expect = 2e-22
 Identities = 65/197 (32%), Positives = 98/197 (49%), Gaps = 5/197 (2%)
 Frame = +3

Query: 153 TLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDIDTIINL 326
           TL +  Y    LEP IS + +  H + HH  Y+N  N  V    L     +  I      
Sbjct: 4   TLNDPAYLKTGLEPAISAKTLDFHFNGHHKAYLNKTNDLVKGTSLENKSLEDVILVAKTT 63

Query: 327 APALKFNGGGHI-NHSIFWHNLSPNG--GKPSDVLTKAVEKDFGSWDNIKNQLSTASVAV 497
             A  FN    + NHS FW  ++P    G+ S  L K +++ FGS  + K + + +++A 
Sbjct: 64  NNAALFNNATQLWNHSFFWDCMAPTNQTGQISPELEKLIKESFGSVADFKKKFTDSAIAN 123

Query: 498 QGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVK 677
            GSGW WL  N    KL+I    N +    T  + PL  +DVWEHAYYL ++N R +Y+ 
Sbjct: 124 FGSGWTWL-VNIN-GKLEIQNTSNAES-PVTLRVTPLLTVDVWEHAYYLDHQNRRPEYLN 180

Query: 678 AIFDVANWNDISQRYEK 728
             ++V NW  + Q+ ++
Sbjct: 181 KWWEVVNWKFVDQQLKQ 197


>UniRef50_Q7CVP7 Cluster: Superoxide dismutase; n=2; Agrobacterium
           tumefaciens str. C58|Rep: Superoxide dismutase -
           Agrobacterium tumefaciens (strain C58 / ATCC 33970)
          Length = 232

 Score =  108 bits (259), Expect = 2e-22
 Identities = 62/197 (31%), Positives = 92/197 (46%), Gaps = 8/197 (4%)
 Frame = +3

Query: 153 TLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNV--AEEKLAQAQAKGDIDTIINL 326
           T P+LP+    L PVIS   + LH+ KHH  Y + LN   A  + A  +  G +      
Sbjct: 35  TQPKLPFAEADLAPVISARTVGLHYGKHHKAYFDKLNTLAAGTRYADMELAGIVKESAGS 94

Query: 327 APALK---FNGGGHI-NHSIFWHNLSPNG-GKPSDVLTKAVEKDFGSWDNIKNQLSTASV 491
             A     FN      NH  +W    P G  +P+  L  ++ + FG +D    +    S 
Sbjct: 95  KAAADVKIFNNAAQAWNHVAYWDQFVPGGPNRPTGDLAASLNETFGDYDGFIKRAVDVSD 154

Query: 492 AVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADY 671
            V G+GW WL  +   K   I      +P+    G     GID+WEHAYYL Y+N + D+
Sbjct: 155 TVFGTGWVWLTRDDDNKLALIGYEDGNNPV--AVGRPAYLGIDIWEHAYYLDYENRKPDH 212

Query: 672 VKAIFD-VANWNDISQR 719
           ++A+ D + NW  + +R
Sbjct: 213 IRAVLDKLVNWRVVEER 229


>UniRef50_Q4N3K2 Cluster: Fe-superoxide dismutase, putative; n=2;
           Theileria|Rep: Fe-superoxide dismutase, putative -
           Theileria parva
          Length = 241

 Score =  106 bits (254), Expect = 9e-22
 Identities = 61/185 (32%), Positives = 93/185 (50%), Gaps = 2/185 (1%)
 Frame = +3

Query: 186 LEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHIN 365
           L P +S E +  H+ KHH  Y+NNLN    KL ++ A+G +            N     N
Sbjct: 70  LSPDLSEEAVRFHYLKHHQGYVNNLN----KLIRS-AEGKVYE----------NACQIWN 114

Query: 366 HSIFWHNLSPNG-GKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMK 542
           H+ +W  L P+  GKP+  +   +   F ++DN K Q   A+    GSGW WL Y K   
Sbjct: 115 HNQYWLGLDPHSAGKPTKFVEDVINLTFQTYDNFKQQFVEAAANHFGSGWVWLLYFKNEP 174

Query: 543 KLQIATCQNQD-PLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQR 719
            L+I    + D P++      PL  +D+WEHAYY+ Y+N R  Y  + F+  NWN + + 
Sbjct: 175 NLRIVDTHDGDNPIKLYNNGKPLLTLDIWEHAYYIDYRNDRRGYTNSWFNKVNWNRVEKS 234

Query: 720 YEKAL 734
            ++ +
Sbjct: 235 LKEQM 239


>UniRef50_Q4Q512 Cluster: Superoxide dismutase, putative; n=9;
           Trypanosomatidae|Rep: Superoxide dismutase, putative -
           Leishmania major
          Length = 270

 Score =  104 bits (250), Expect = 3e-21
 Identities = 60/197 (30%), Positives = 95/197 (48%), Gaps = 5/197 (2%)
 Frame = +3

Query: 156 LPELPYE-YNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAP 332
           LP L +  Y    P++S   + +H+ +HH TY+  LN   E       + D   + +   
Sbjct: 63  LPTLEFPWYKGCMPLMSSYQIRVHYGRHHRTYVEKLNQLIEGTPLYGMQLDALIVKSAHD 122

Query: 333 A-LKF---NGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQ 500
           + LK    N   H NHS FW  + P G      L+ AV   +GS +  + Q  TA+  + 
Sbjct: 123 SQLKGVYNNAAQHYNHSFFWKCIQPYGSNIPPDLSAAVSAQYGSVEKFEQQFITAAQNLF 182

Query: 501 GSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKA 680
           GSGW +  Y+K+     I +  +           PL  +DVWEHAYY+ Y+N R +Y+  
Sbjct: 183 GSGWVYWVYDKKAGAFDIVSYGDAGCPLTNYEYTPLLCVDVWEHAYYIDYENKRPEYLSK 242

Query: 681 IFDVANWNDISQRYEKA 731
            FDV +W+   + +++A
Sbjct: 243 YFDVVDWHWAERHWKRA 259


>UniRef50_Q2P0Y1 Cluster: Superoxide dismutase; n=11;
           Gammaproteobacteria|Rep: Superoxide dismutase -
           Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
          Length = 192

 Score =  102 bits (245), Expect = 1e-20
 Identities = 59/187 (31%), Positives = 89/187 (47%), Gaps = 2/187 (1%)
 Frame = +3

Query: 165 LPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKF 344
           LPY   ALEP +S   +  HH   H + +  LN   E    A+    ++ II  A    F
Sbjct: 8   LPYSRAALEPHLSSATLGAHHGVCHRSEVEQLNARIEGSEFAELT--LEQIIAQAQGTLF 65

Query: 345 NGGGHI-NHSIFWHNLSPN-GGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGW 518
           +    + NH+ +W  L    GG+P   L + + K FG + + K + +  ++   GSGW W
Sbjct: 66  HLAAQVWNHNFYWQCLRTRAGGEPLGQLGERIAKSFGDFVHFKLEFNRMALTSFGSGWVW 125

Query: 519 LGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVAN 698
           L          +AT     PL      +PL   D+WEHAYYL Y+  RA Y+ A + + N
Sbjct: 126 LVQRPDGALAVVATPNASTPLTGPD--IPLLACDIWEHAYYLDYQQDRARYLDAFWKLVN 183

Query: 699 WNDISQR 719
           W+ ++ R
Sbjct: 184 WDFVASR 190


>UniRef50_Q5DGW3 Cluster: Superoxide dismutase; n=1; Schistosoma
           japonicum|Rep: Superoxide dismutase - Schistosoma
           japonicum (Blood fluke)
          Length = 129

 Score = 98.3 bits (234), Expect = 2e-19
 Identities = 49/90 (54%), Positives = 64/90 (71%), Gaps = 2/90 (2%)
 Frame = +3

Query: 114 SLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQ 293
           S++R  G  R KHTLP LPY+ +ALEPVIS+EIM LHHSKHHA Y+NNLN+AEE+ A A 
Sbjct: 16  SVLRNYGV-RFKHTLPPLPYDTSALEPVISKEIMQLHHSKHHAAYVNNLNIAEEQFADAM 74

Query: 294 AKGDIDTIINLAPALKF--NGGGHINHSIF 377
           +K D+  +I+L  +L    N     +HS+F
Sbjct: 75  SKSDVTKMISLQVSLHLSNNFAFSKSHSLF 104


>UniRef50_O08460 Cluster: Superoxide dismutase [Mn] 2; n=1;
           Haloferax mediterranei|Rep: Superoxide dismutase [Mn] 2
           - Halobacterium mediterranei (Haloferax mediterranei)
          Length = 146

 Score = 97.5 bits (232), Expect = 4e-19
 Identities = 52/147 (35%), Positives = 78/147 (53%), Gaps = 2/147 (1%)
 Frame = +3

Query: 246 YINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPN--GGKPSDV 419
           Y+N LN AEE L + ++ GD+D       ++  NG GH  H +FW  ++PN  GG+P+  
Sbjct: 2   YVNGLNAAEETLRENRSSGDMDGSAAAMRSVSHNGCGHYLHHLFWRCMTPNGGGGEPTGD 61

Query: 420 LTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGL 599
           L   +E DFGS++  + +   A+    G GW  L Y+   K+L+    Q  +   A    
Sbjct: 62  LRDRIESDFGSYEGWEAEFREAASWPAG-GWALLVYDPVTKQLRNLAVQKHND-GALWSA 119

Query: 600 VPLFGIDVWEHAYYLQYKNVRADYVKA 680
            P+  +DVWEH+YY QY   R  +V A
Sbjct: 120 HPILALDVWEHSYYFQYGPDRGGFVDA 146


>UniRef50_Q92454 Cluster: Manganese superoxide dismutase 2; n=1;
           Hypocrea lixii|Rep: Manganese superoxide dismutase 2 -
           Trichoderma harzianum (Hypocrea lixii)
          Length = 126

 Score = 79.8 bits (188), Expect(2) = 2e-18
 Identities = 35/71 (49%), Positives = 45/71 (63%)
 Frame = +3

Query: 429 AVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPL 608
           A+ +DFGS++N+K Q + A   +QGSGW W+  +K    L   T  NQDP+  T    PL
Sbjct: 58  AINQDFGSFENLKKQTNAALAGIQGSGWAWIVKDKASGNLTFVTRANQDPV--TGNFEPL 115

Query: 609 FGIDVWEHAYY 641
            GIDVWEHAYY
Sbjct: 116 LGIDVWEHAYY 126



 Score = 35.9 bits (79), Expect(2) = 2e-18
 Identities = 12/17 (70%), Positives = 13/17 (76%)
 Frame = +3

Query: 351 GGHINHSIFWHNLSPNG 401
           GGH NH  FW NL+PNG
Sbjct: 1   GGHANHRFFWENLAPNG 17


>UniRef50_A2EGG9 Cluster: Superoxide dismutase; n=17;
           Trichomonadidae|Rep: Superoxide dismutase - Trichomonas
           vaginalis G3
          Length = 217

 Score = 94.3 bits (224), Expect = 4e-18
 Identities = 54/194 (27%), Positives = 93/194 (47%), Gaps = 1/194 (0%)
 Frame = +3

Query: 153 TLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAP 332
           T+  +PY    L   +++  + +H  KHH  YI+N N      +  + K     I   + 
Sbjct: 3   TMITVPYLNTGLPGFLTQHAVEIHVKKHHQAYIDNANKLLNG-SDYEGKPITQIIQESSG 61

Query: 333 ALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGW 512
           AL  N   H NH  FW+ LS    +    L +    +F S+DN K +    +  + GSGW
Sbjct: 62  ALFNNVAQHYNHCFFWNCLSAKIQQIPMDLEEFFTNNFKSYDNFKAEFINKASTLFGSGW 121

Query: 513 GWLGYNKQMKKLQIATCQN-QDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFD 689
            +L  + +  + +I    N  +P++   G +P+  +D WEH++Y+ Y+N +A+Y    F+
Sbjct: 122 CYLYKDTKTGEFKIDQFTNANNPVK--DGNIPILTVDTWEHSWYIDYENRKAEYFNKFFE 179

Query: 690 VANWNDISQRYEKA 731
             NW  + + Y  A
Sbjct: 180 HINWKFVLENYNTA 193


>UniRef50_Q759W2 Cluster: Superoxide dismutase; n=1; Eremothecium
           gossypii|Rep: Superoxide dismutase - Ashbya gossypii
           (Yeast) (Eremothecium gossypii)
          Length = 222

 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 49/123 (39%), Positives = 75/123 (60%), Gaps = 9/123 (7%)
 Frame = +3

Query: 102 QRIGSLIRVAG-ASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEK 278
           ++ GS +  A  A R K TLP+L +++ ALEP IS +I  LH++KHH TY+N LN A E+
Sbjct: 9   RKSGSALSAAAYAKRTKVTLPDLDWDFGALEPHISGKINELHYTKHHQTYVNGLNSALEQ 68

Query: 279 LAQAQAKGDIDT-----IINLAPALKFNGGGHINHSIFWHNLSP---NGGKPSDVLTKAV 434
             +  A+ D D+     +  L   +KF+GGG+ NH +FW NL+P    GG+P    + + 
Sbjct: 69  FHELSARVDQDSRVAAQLTALQQNIKFHGGGYRNHCLFWKNLAPASQGGGEPPPPRSGSP 128

Query: 435 EKD 443
           ++D
Sbjct: 129 DRD 131


>UniRef50_Q6QMV0 Cluster: Superoxide dismutase; n=12;
           Firmicutes|Rep: Superoxide dismutase - Clostridium
           difficile
          Length = 139

 Score = 90.6 bits (215), Expect = 5e-17
 Identities = 48/141 (34%), Positives = 78/141 (55%), Gaps = 7/141 (4%)
 Frame = +3

Query: 222 HHSKHHATYINNLNVAEEKLAQ------AQAKGDIDTII-NLAPALKFNGGGHINHSIFW 380
           HH KH+  Y++ LN A EK  +       +   ++D++  ++A  ++ N GG  NH  F+
Sbjct: 1   HHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFF 60

Query: 381 HNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIAT 560
             ++P    PS+ L +A+++DFGS++  K +   +++ V GSGW WL   K   KL I T
Sbjct: 61  DIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKD-GKLSIMT 119

Query: 561 CQNQDPLQATTGLVPLFGIDV 623
             NQD    +  L P+ G+DV
Sbjct: 120 TPNQDS-PVSKNLTPIIGLDV 139


>UniRef50_Q4VG07 Cluster: Superoxide dismutase; n=1; Antonospora
           locustae|Rep: Superoxide dismutase - Antonospora
           locustae (Nosema locustae)
          Length = 113

 Score = 90.2 bits (214), Expect = 6e-17
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +3

Query: 447 GSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQD-PLQATTGLVPLFGIDV 623
           GS DN K++ +++++ V GSGW WL Y+    +L+I T  NQD P       +P+  +DV
Sbjct: 1   GSLDNFKSEFNSSALKVFGSGWAWLVYDASSARLEITTTPNQDTPFLHNRAKLPVLCLDV 60

Query: 624 WEHAYYLQYKNVRADYVKAIFDVANWNDISQRYEK 728
           WEHAYYLQY + R+ Y +  ++V +W  +   +EK
Sbjct: 61  WEHAYYLQYMHNRSQYAECWWNVVDWKSVEHLFEK 95


>UniRef50_Q2I123 Cluster: Superoxide dismutase; n=1; Micromonospora
           sp. ATCC 39149|Rep: Superoxide dismutase -
           Micromonospora sp. ATCC 39149
          Length = 99

 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 36/87 (41%), Positives = 52/87 (59%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           ++LP++PY Y AL+P +  EI++LH SKHH  Y    N A E+LA+ + KGD   ++ L 
Sbjct: 4   YSLPDMPYAYGALKPAMPGEILTLHRSKHHTAYAKGGNDALEQLAEVRDKGDFAGLVGLE 63

Query: 330 PALKFNGGGHINHSIFWHNLSPNGGKP 410
               F   GH+ +SIFW    P+G  P
Sbjct: 64  KTFAFTLSGHVPYSIFW----PSGSSP 86


>UniRef50_Q05FP8 Cluster: Superoxide dismutase; n=1; Candidatus
           Carsonella ruddii PV|Rep: Superoxide dismutase -
           Carsonella ruddii (strain PV)
          Length = 202

 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 52/179 (29%), Positives = 92/179 (51%), Gaps = 9/179 (5%)
 Frame = +3

Query: 216 SLHHSKHHATYINNLN-VAEEKLAQAQAKGDIDTIINLAPALKFNG----GGHINHSIFW 380
           +LH S ++   IN  N + ++K+        ID I +L+   K+      GG++NH  ++
Sbjct: 21  NLHFSFYNDFKINLNNFLLKKKIIYNHKYELIDLIHDLSDIDKYKYISLLGGYLNHDYYF 80

Query: 381 HNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIAT 560
            N++ N       + K +E ++ +++N K   +  +  V   GWGWL  NK+ K   + T
Sbjct: 81  KNITFNKNFIFGNIKKIIELNYINYENFK--FNFINKFVDHIGWGWLVINKK-KICLLKT 137

Query: 561 CQNQDPLQATT----GLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQRYE 725
             N +P+ + +      +PL GID+ EH+YY+ Y N +  Y+K  F+  NW +I  R +
Sbjct: 138 KDNNNPMFSISLGGFNSIPLIGIDLHEHSYYIDYNNNKKQYIKNFFEYLNWYEIENRLQ 196


>UniRef50_Q2V193 Cluster: Superoxide dismutase; n=2;
           Streptococcus|Rep: Superoxide dismutase - Streptococcus
           sanguis
          Length = 130

 Score = 77.4 bits (182), Expect = 5e-13
 Identities = 37/106 (34%), Positives = 61/106 (57%), Gaps = 1/106 (0%)
 Frame = +3

Query: 303 DIDTI-INLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLS 479
           D+++I  ++  A+  NGGGH+NH++FW  ++P    PS      +E  FGS+++ K   +
Sbjct: 27  DVESIPADIRQAVINNGGGHLNHALFWELMTPAETSPSAEWAADIEATFGSFEDFKTSFT 86

Query: 480 TASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGI 617
            A+    GSGW WL  NK+  KL++ +  NQD    + G  P+ G+
Sbjct: 87  AAATTRIGSGWAWLVVNKEC-KLEVTSTANQD-TPISEGKTPILGL 130


>UniRef50_Q89BS5 Cluster: Bll8073 protein; n=2; Rhizobiales|Rep:
           Bll8073 protein - Bradyrhizobium japonicum
          Length = 318

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 52/184 (28%), Positives = 89/184 (48%), Gaps = 5/184 (2%)
 Frame = +3

Query: 198 ISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDID--TIINLAPALKFNGGGHINHS 371
           IS  ++  H+  ++   +N LN+  E++      GD    T+  L           + H 
Sbjct: 18  ISARLIESHYENNYGGALNRLNIISEEIELLDL-GDAPNPTLARLKRDEIVALNSTLLHE 76

Query: 372 IFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQ-LSTASVAVQGSGWGWLGYNKQMKKL 548
            ++ +L  +G    D L  A+ KDFGS D  + + +  AS    GSGW  L Y  +  +L
Sbjct: 77  FYFASLGGDGRVVPDDLASAIAKDFGSVDRWRQEFVGIASALAGGSGWVLLTYVPRDGRL 136

Query: 549 --QIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 722
             QIA+    +  Q+  G VP+  +D++EHA++L++      Y+ A     +W+ + QRY
Sbjct: 137 INQIAS----EHSQSIAGGVPILALDMYEHAFHLEFGANAGAYIAAFMRNIDWSAVKQRY 192

Query: 723 EKAL 734
           E A+
Sbjct: 193 EDAI 196


>UniRef50_Q869C6 Cluster: Similar to Trichomonas vaginalis.
           Iron-containing superoxide dismutase; n=2; Dictyostelium
           discoideum|Rep: Similar to Trichomonas vaginalis.
           Iron-containing superoxide dismutase - Dictyostelium
           discoideum (Slime mold)
          Length = 243

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 55/199 (27%), Positives = 93/199 (46%), Gaps = 4/199 (2%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATY--INNL--NVAEEKLAQAQAKGDIDTI 317
           +TLPE+PY  + ++  +S   +  H   H       NNL      E     QA     T 
Sbjct: 18  YTLPEIPYLNSGIKNFMSVPSLKQHVKLHQEDIEKANNLVQRTPWEDTTINQAIKQSFTS 77

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAV 497
           I  AP  + +   H NHS FW ++S     PS  + KA+E DFGS    + + S ++ A+
Sbjct: 78  IEDAPFFE-SVSSHYNHSFFWRSISNIKETPSAHMKKALELDFGSIAGFQQKFSQSASAL 136

Query: 498 QGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVK 677
              G+ WL ++ +  ++ I T  +  PL+      P+  +D++EHAY   + + +  Y+ 
Sbjct: 137 NVPGFTWLVFHDKALRI-ITTFGSGSPLK-LQNCHPILCLDLFEHAYVSDHGD-KNKYIA 193

Query: 678 AIFDVANWNDISQRYEKAL 734
             +   NW  +  ++  AL
Sbjct: 194 NFWSCINWKFVEAKFLNAL 212


>UniRef50_Q1GS79 Cluster: Manganese and iron superoxide dismutase
           precursor; n=2; Proteobacteria|Rep: Manganese and iron
           superoxide dismutase precursor - Sphingopyxis alaskensis
           (Sphingomonas alaskensis)
          Length = 239

 Score = 72.9 bits (171), Expect = 1e-11
 Identities = 56/205 (27%), Positives = 84/205 (40%), Gaps = 3/205 (1%)
 Frame = +3

Query: 129 AGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDI 308
           A A   KHT  +L +    L  +  R I S H   ++   +  LN  E +LA A A  D 
Sbjct: 38  AAAFAGKHTPKQLRFNPAKLTGLSERLITS-HWENNYQGSVRGLNTIETRLAAAMADPDF 96

Query: 309 DTII--NLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLS- 479
             +    L        G  + H  ++  L    G P   + +A++  FGS+   + +   
Sbjct: 97  PAVAYAGLKREELHRTGSIVLHEYYFDALG-GSGNPGGSIYEALDGWFGSFAAWEAEFRR 155

Query: 480 TASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNV 659
           TA     GSGW  L YN+    L        D +       PL  +D++EH+Y++ Y   
Sbjct: 156 TAMSLAGGSGWCILSYNRHTASLH--NYWASDHMHGAINAAPLIALDMYEHSYHMDYGAA 213

Query: 660 RADYVKAIFDVANWNDISQRYEKAL 734
            A YV A     +W  +  RY  AL
Sbjct: 214 AAKYVDAFMANLDWEVVDARYRAAL 238


>UniRef50_Q6L1T7 Cluster: Superoxide dismutase [Fe]; n=2;
           Thermoplasmatales|Rep: Superoxide dismutase [Fe] -
           Picrophilus torridus
          Length = 205

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 47/181 (25%), Positives = 79/181 (43%), Gaps = 3/181 (1%)
 Frame = +3

Query: 198 ISREIMSLHHSKHHATYINNLNVAEEKLAQ---AQAKGDIDTIINLAPALKFNGGGHINH 368
           IS + +  H   H+  Y+  LN    KL     ++A  +   +  +     FN  G + H
Sbjct: 19  ISDQQIDYHFDFHYKGYVTKLNEIWSKLPDVDLSKANQNYSDLREMKLEETFNYDGSMLH 78

Query: 369 SIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKL 548
             ++ +L+ +  +    + + +EKDFGS++           A +G  W  L ++    KL
Sbjct: 79  EYYFESLTKDHTEIPASVKEQIEKDFGSYEKFVALFKATGTAFRG--WAHLIFDLNYGKL 136

Query: 549 QIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQRYEK 728
           +I          A    + +  +DV+EHAYY  Y   RA Y+ A     NW  + +R EK
Sbjct: 137 RIVGADIHSA-GAIWNAIMILPLDVYEHAYYTDYGAKRAPYLDAFMKNVNWKVVEKRLEK 195

Query: 729 A 731
           A
Sbjct: 196 A 196


>UniRef50_P17550 Cluster: Superoxide dismutase [Fe]; n=9;
           Bacteria|Rep: Superoxide dismutase [Fe] - Ralstonia
           metallidurans (strain CH34 / ATCC 43123 / DSM 2839)
          Length = 197

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 44/181 (24%), Positives = 81/181 (44%), Gaps = 2/181 (1%)
 Frame = +3

Query: 198 ISREIMSLHHSKHHATYINNLNVAEEKLAQAQ-AKGDIDTIINLAPALKFNGGGHINHSI 374
           +S +++  H+  ++   +  LN     LA+   A   + T+  L           I H +
Sbjct: 18  LSEKLIFSHYENNYGGAVKRLNAITATLAELDMATAPVFTLNGLKREELIATNSMILHEV 77

Query: 375 FWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG-SGWGWLGYNKQMKKLQ 551
           ++ +L  +GG     L  A+E+DFGS +  + + +    A+ G SGW  L Y+ +  +L 
Sbjct: 78  YFDSLG-DGGSLDGALKTAIERDFGSVERWQAEFTAMGKALGGGSGWVLLTYSPRDGRL- 135

Query: 552 IATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQRYEKA 731
                  D      G  P+  +D++EH+Y++ Y    A YV A     +W   + R+  A
Sbjct: 136 -VNQWASDHAHTLAGGTPVLALDMYEHSYHMDYGAKAAAYVDAFMQNIHWQRAATRFAAA 194

Query: 732 L 734
           +
Sbjct: 195 V 195


>UniRef50_A5V9D0 Cluster: Manganese and iron superoxide dismutase
           precursor; n=1; Sphingomonas wittichii RW1|Rep:
           Manganese and iron superoxide dismutase precursor -
           Sphingomonas wittichii RW1
          Length = 224

 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 47/190 (24%), Positives = 81/190 (42%), Gaps = 2/190 (1%)
 Frame = +3

Query: 165 LPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKF 344
           LP++ NA+ P +S  +++ HH  ++   +  L    +  A           IN     + 
Sbjct: 37  LPFDPNAI-PGLSARLLTSHHDNNYVGAVKRLGAIRQAFAGLDPATAPGFSINGLKREEL 95

Query: 345 NG-GGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG-SGWGW 518
           +     I H +++  L    G P   L  A+E+DFGS D    +      A+ G SGW  
Sbjct: 96  SAWNSMILHELYFAGLGRPTG-PGAKLAAAIERDFGSHDRWAAEFGAMGKALGGGSGWVL 154

Query: 519 LGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVAN 698
           L ++ + ++L        D +    G  PL  +D++EHAY + Y    A YV A     +
Sbjct: 155 LMWSNRDRRL--VNQWAADHMATLAGGTPLLALDMYEHAYAIDYGAKAAAYVDAYMAAVD 212

Query: 699 WNDISQRYEK 728
           W+     + +
Sbjct: 213 WSQADHLFAR 222


>UniRef50_Q8RBG3 Cluster: Superoxide dismutase; n=1;
           Thermoanaerobacter tengcongensis|Rep: Superoxide
           dismutase - Thermoanaerobacter tengcongensis
          Length = 188

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 44/184 (23%), Positives = 82/184 (44%), Gaps = 5/184 (2%)
 Frame = +3

Query: 174 EYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLA---QAQAKGDIDTIINLAPALKF 344
           +YN +   IS+  +  H+  ++  Y+   N   EKL    +++A         L     +
Sbjct: 8   KYNLVLRGISQRTLEEHYKLYNG-YVEKTNEIREKLKTVDRSKANASYSEYRELKLEETY 66

Query: 345 NGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLG 524
           N  G   H +++ NL   GG P  ++   +  DFGS++N +       +A +G  W  L 
Sbjct: 67  NLDGVKLHELYFENLGGAGGIPDGIIAPMIALDFGSFENWRQDFIACGMASRG--WTVLC 124

Query: 525 YNKQMKKLQ--IATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVAN 698
           ++    KL   +    N   +  T   +PL  +D +EHAY++ Y   +  Y++A  +   
Sbjct: 125 FDPIDLKLHNYLQDFHNHGIVLRT---IPLLVLDTYEHAYFIDYGTDKKSYIEAFMNNIK 181

Query: 699 WNDI 710
           W ++
Sbjct: 182 WEEV 185


>UniRef50_A4J6B5 Cluster: Manganese and iron superoxide dismutase;
           n=1; Desulfotomaculum reducens MI-1|Rep: Manganese and
           iron superoxide dismutase - Desulfotomaculum reducens
           MI-1
          Length = 209

 Score = 64.1 bits (149), Expect = 5e-09
 Identities = 47/171 (27%), Positives = 76/171 (44%), Gaps = 4/171 (2%)
 Frame = +3

Query: 225 HSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHIN----HSIFWHNLS 392
           H K + +YI   N    KL     +G  ++I +   +LK +    +     H +++ NL 
Sbjct: 37  HYKIYQSYITKTNEVRMKLRSIDMQGS-NSIHSSYRSLKIDESQTVANGKLHEMYFDNLG 95

Query: 393 PNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQ 572
            NG      + + + KDFGS++  +    +  +A QG  W  LGY+     L   T Q  
Sbjct: 96  GNGRTAIGKVLEIIVKDFGSYEFWERDFRSTGLASQG--WVILGYDFDDCHLHNYT-QGA 152

Query: 573 DPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQRYE 725
             +       PL  +DV EHAY+L Y   R  Y+ A F   +W  ++ R +
Sbjct: 153 PDVVPIVRFEPLLVLDVCEHAYFLDYGTNRNSYIDAFFRNIDWYTVNSRLQ 203


>UniRef50_A5N0Y7 Cluster: Sod; n=1; Clostridium kluyveri DSM
           555|Rep: Sod - Clostridium kluyveri DSM 555
          Length = 218

 Score = 62.9 bits (146), Expect = 1e-08
 Identities = 42/196 (21%), Positives = 88/196 (44%), Gaps = 4/196 (2%)
 Frame = +3

Query: 159 PELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPAL 338
           PE+ + +N+++ +  R++    H K +  Y+N LN         Q   D +   +   +L
Sbjct: 6   PEV-FNFNSVKGISQRQLNE--HYKLYVGYVNILNQIWNTDYTPQNYTDSNPTYSKMRSL 62

Query: 339 KFNGGGHIN----HSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
           K      +N    H++++ N++     P   +  ++   F S+DN  + L+   ++++G 
Sbjct: 63  KLGETYALNGVKLHNLYFKNMTGGNTTPHGPVLNSIINQFSSYDNFLSYLTNVGLSMRG- 121

Query: 507 GWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
            W  L  +    K  I      D         P+  +DV+EHAY++ +   + +Y+    
Sbjct: 122 -WAILSIDSLDNKFHIIGSDLHDKGSVWISY-PILVMDVYEHAYFMDFGTNKKEYISTFI 179

Query: 687 DVANWNDISQRYEKAL 734
              NW  +++R++K L
Sbjct: 180 KNINWTVVNKRFQKYL 195


>UniRef50_Q97G07 Cluster: Superoxide dismutase; n=1; Clostridium
           acetobutylicum|Rep: Superoxide dismutase - Clostridium
           acetobutylicum
          Length = 220

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 48/194 (24%), Positives = 88/194 (45%), Gaps = 4/194 (2%)
 Frame = +3

Query: 156 LPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPA 335
           + E  Y +N+L    S E++  H+  +   YIN+LN   +       + D DT  +L  +
Sbjct: 2   ITEKKYNFNSLAG-FSNELLKAHYDIY-VNYINDLNKLWKVSYTPGFRSD-DTNHSLMRS 58

Query: 336 LK----FNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG 503
           LK    +   G   H +++ N++    KP   + K + K F S++N  + L+   VA+  
Sbjct: 59  LKSKEIYTLNGIKLHELYFENMTGKNTKPYGPILKEIGKQFSSYNNFISYLT--EVAISM 116

Query: 504 SGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAI 683
            GW  L  +    +  +      D   A     PL  +DV EH+Y+  + N +  YV+  
Sbjct: 117 KGWVILSIDSLDGRFHLFGNDFHDT-SAILASHPLMVLDVQEHSYFKDFINDKGKYVETF 175

Query: 684 FDVANWNDISQRYE 725
            +  +W  ++ R++
Sbjct: 176 INNLDWKILNDRFK 189


>UniRef50_A7HBL1 Cluster: Manganese and iron superoxide dismutase;
           n=3; Cystobacterineae|Rep: Manganese and iron superoxide
           dismutase - Anaeromyxobacter sp. Fw109-5
          Length = 201

 Score = 60.1 bits (139), Expect = 7e-08
 Identities = 50/174 (28%), Positives = 69/174 (39%), Gaps = 9/174 (5%)
 Frame = +3

Query: 225 HSKHHATYINNLNVAEEKL----AQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLS 392
           H K +  Y+   N   EKL    A  +A G       L   L F   G +NH  ++ N++
Sbjct: 29  HLKLYEGYVKRTNALTEKLQAICADGKASGADPVFAELTRRLGFEYSGMVNHEYYFDNMA 88

Query: 393 PNGGK--PSD-VLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATC 563
           P      PS   L KA+E  FG ++        A   + G GW     +     L     
Sbjct: 89  PGAQAEPPSGGKLRKALEASFGKYETWLADFR-AIATMPGIGWAMTFQDPTTGWLSNHWI 147

Query: 564 Q-NQDPLQATTGLVPLFGIDVWEHAYYLQY-KNVRADYVKAIFDVANWNDISQR 719
             +QD      G  P+  +D WEHAY   Y    RA YV A F   +W  + +R
Sbjct: 148 NLHQD--NVPVGFKPVLVMDGWEHAYMRDYLATERAKYVDAFFKNVSWEAVEKR 199


>UniRef50_Q3ZXS9 Cluster: Superoxide dismutase; n=10; Bacteria|Rep:
           Superoxide dismutase - Dehalococcoides sp. (strain
           CBDB1)
          Length = 192

 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 46/187 (24%), Positives = 80/187 (42%), Gaps = 4/187 (2%)
 Frame = +3

Query: 174 EYNALEPVIS-REIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDT--IINLAPALKF 344
           +Y+AL  +    + +  +H   +  Y+NN N   + L     +G   T     L     F
Sbjct: 6   DYSALTGIEGFSDTLLKNHFTLYQGYVNNTNKLADTLKAMLEEGKTATPEYAELKRRFGF 65

Query: 345 NGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWL 521
              G   H  ++ NL  +     +    +A+  +FGS+   +      S A++G GW  L
Sbjct: 66  EFDGMRLHEYYFSNLGKSVPLSETGKFYQALAAEFGSYQLWEADFKATS-AMRGIGWVIL 124

Query: 522 GYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANW 701
             + Q  +L      N+       G  P+  IDV+EHA+   Y   RA+Y+ A     NW
Sbjct: 125 YKDPQTGRL-FNQWINEHEAGHLAGATPILVIDVFEHAFLTDYGLKRAEYIAAFIKNINW 183

Query: 702 NDISQRY 722
           +++ +R+
Sbjct: 184 SEVEKRF 190


>UniRef50_O74379 Cluster: Mitochondrial ribosomal protein subunit
           S26; n=1; Schizosaccharomyces pombe|Rep: Mitochondrial
           ribosomal protein subunit S26 - Schizosaccharomyces
           pombe (Fission yeast)
          Length = 220

 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 36/138 (26%), Positives = 64/138 (46%), Gaps = 16/138 (11%)
 Frame = +3

Query: 360 INHSIFWHNL-SPNG-GKPSDV----LTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWL 521
           +NH  F+  L SP      +D+    L   ++  FGS+  +K+Q+     +V G GW WL
Sbjct: 76  VNHDFFFSGLISPERPSADADLGAINLKPGIDASFGSFGELKSQMVDVGNSVFGDGWLWL 135

Query: 522 GYNKQMKKLQIATCQNQD---------PLQATTGLVPLFGIDVWEHAYYLQY-KNVRADY 671
            Y+ +     +    N           P   T  +VPL  +++W++AY   Y  N +  Y
Sbjct: 136 VYSPEKSLFSLLCTYNASNAFLWGTGFPKFRTNAIVPLLCVNLWQYAYLDDYGLNGKKMY 195

Query: 672 VKAIFDVANWNDISQRYE 725
           +   +D+ NW  ++ R++
Sbjct: 196 ITKWWDMINWTVVNNRFQ 213


>UniRef50_A5HZ65 Cluster: Superoxide dismutase [fe]; n=4;
           Clostridium botulinum|Rep: Superoxide dismutase [fe] -
           Clostridium botulinum A str. ATCC 3502
          Length = 216

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 2/120 (1%)
 Frame = +3

Query: 366 HSIFWHNLSPNGGKPSD--VLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQM 539
           H +++ N++ +G  P +  +L K +E DF S +N          +++G  W  LG +   
Sbjct: 74  HELYFQNMT-SGHIPINGPILDKILE-DFNSVENFTELFKETGKSMRG--WVVLGIDPLD 129

Query: 540 KKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQR 719
           KKL I    + D   A     PL  +DV+EHAY++ +   +  Y+ A     NWN I+ R
Sbjct: 130 KKLHIFGSDSHDN-GAIWLAYPLLVMDVYEHAYFMDFGTDKGKYMDAFLQNVNWNLINNR 188


>UniRef50_Q95066 Cluster: Iron superoxide dismutase; n=5;
           Trichomonadida|Rep: Iron superoxide dismutase -
           Tetratrichomonas gallinarum
          Length = 125

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 2/107 (1%)
 Frame = +3

Query: 306 IDTIINLAPALKFNG-GGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLST 482
           ++ II  A    FN    H NH  FW  L+P   +    +   +EK+FGS +  K     
Sbjct: 21  MEEIIQAASGPLFNNVAQHYNHQFFWRCLTPKKVEIPAKVKAVLEKEFGSVEKFKEAFQG 80

Query: 483 ASVAVQGSGWGWLGYNKQMKKLQIATCQNQ-DPLQATTGLVPLFGID 620
            +  + GSGW +L Y  +  KL+I    N  +P++   G VP+  +D
Sbjct: 81  KASTLFGSGWAYL-YKSKEGKLEIGQFSNALNPVK--DGGVPILAVD 124


>UniRef50_A5DI52 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 191

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 29/92 (31%), Positives = 48/92 (52%)
 Frame = -1

Query: 395 W*QVVPKDRVVDVTTTIEFQGWCKVDNGVDITFSLCLCEFLFSNV*IVDISRVMFAVMKT 216
           W Q++P++ +V VTT++E     + D  +D TF L L +   S V  +DIS V+  V+K 
Sbjct: 85  WSQILPEETMVGVTTSVEIDVLLQFDCLLDFTFGLGLGKLFHSLVVTIDISLVVLCVVKF 144

Query: 215 HDFTANDRLQCIVLVRKLWQSMLLARSTGNSN 120
            + T N   Q   +  ++WQ  L +  T   +
Sbjct: 145 VNLTGNMGFQSTKVPVQIWQGNLGSNGTNRGS 176


>UniRef50_Q75PV6 Cluster: Superoxide dismutase; n=1; Paramecium
           bursaria|Rep: Superoxide dismutase - Paramecium bursaria
          Length = 130

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = +3

Query: 363 NHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQM 539
           NH+ +WH+L P GG  P+ V+   + + F + +        A++A  GSGW WL   K  
Sbjct: 46  NHTFYWHSLRPQGGGAPTGVVKDLILQSFDTVEKFNTTFKDAALAQFGSGWTWL-VEKDG 104

Query: 540 KKLQIATCQNQDPLQATTGLVPLFGIDV 623
           K   + T    +P+    G  PL  +DV
Sbjct: 105 KVSILKTANADNPI--NQGYRPLITLDV 130


>UniRef50_UPI000023DF06 Cluster: hypothetical protein FG07069.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG07069.1 - Gibberella zeae PH-1
          Length = 345

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 8/135 (5%)
 Frame = +3

Query: 141 RQKHTLPELPYEYNALEP-VISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           R  H++PELP++Y+   P ++S    SL  +++    +  LN     +       D  TI
Sbjct: 25  RSIHSVPELPHDYSQGVPNLMSSGGFSLAWTQYMTLMVEKLNAL--TVGTELEDKDTKTI 82

Query: 318 I-------NLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQL 476
                   N AP   +    H NH  F+  +SP G    D L   +E  F S + ++ + 
Sbjct: 83  ALMTAREPNQAPIFNYASMAHNNH-FFFQGISPTGTPMPDALRSELEASFSSIETLRREF 141

Query: 477 STASVAVQGSGWGWL 521
              + A+ G G+ WL
Sbjct: 142 VITASAMFGPGFLWL 156


>UniRef50_A0BGE1 Cluster: Chromosome undetermined scaffold_106,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_106,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 179

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 25/76 (32%), Positives = 40/76 (52%)
 Frame = +3

Query: 450 SWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWE 629
           ++  IK      +V   GSGW W   N+      + + ++ + L    G V +F  DVWE
Sbjct: 57  TYGKIKKNFVKYAVGQFGSGWVWFIKNRTDVS-SLRSKKDAELLLLYQGTVFVF-CDVWE 114

Query: 630 HAYYLQYKNVRADYVK 677
           H+Y L Y+N RA++V+
Sbjct: 115 HSYQLDYQNRRANHVR 130


>UniRef50_O42919 Cluster: Superoxide dismutase; n=1;
           Schizosaccharomyces pombe|Rep: Superoxide dismutase -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 277

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 53/231 (22%), Positives = 95/231 (41%), Gaps = 36/231 (15%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDIDTIIN 323
           HT+P L  + N L P+ S E + +   +H    +  LN  V   +L  +     I     
Sbjct: 39  HTVPNLS-QRNLL-PLFSPEALDIAWDQHQRQVVKELNDRVKGTELEDSSVFNIIFQTAA 96

Query: 324 L---APALKFNGGGHINHSIFWHNLSPNGG--------KPSDVLTKAVEKDFGSWDNIKN 470
           L   A   +F    + NH  F   +             + +  + KAV ++FGS +N+ +
Sbjct: 97  LPEHAATFQFASQAYNNHFFFQSLIGKRAADAKKNSKYEANAAINKAVNENFGSKENLLS 156

Query: 471 QLSTASVAVQGSGWGWL---GYNKQ--MKKLQIAT------CQNQDPLQATT-------- 593
           ++   +    G+ W W+    YN+   ++  Q  +       Q+ DP   ++        
Sbjct: 157 KIHELASNSFGACWLWIVIDDYNRLNLLRTFQAGSPYLWTRWQSNDPHLISSVPDYSARP 216

Query: 594 ---GLVPLFGIDVWEHAYYLQYKNV-RADYVKAIFDVANWNDISQRYEKAL 734
                VP+  + +W HAYY  Y  + R+ Y+   FD  +W+ I +R   +L
Sbjct: 217 RKYAHVPILNLCLWNHAYYKDYGLLNRSRYIDTWFDCIDWSVIEERLTNSL 267


>UniRef50_Q2HFL4 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 336

 Score = 41.5 bits (93), Expect = 0.028
 Identities = 36/147 (24%), Positives = 64/147 (43%), Gaps = 11/147 (7%)
 Frame = +3

Query: 114 SLIRVAGASRQKHTLPELPYEY------NALEPVISREIMSLHHSKHHATYINNLNV--A 269
           +L+ +A  +R  H L  L Y+       N +   +S    ++  +++    +  LN+  A
Sbjct: 21  TLLPLACQARSMHALAPLSYDLKGEATQNGISDFLSPAAFNISWTQYQTYLLQKLNILTA 80

Query: 270 EEKLAQAQAKGDI-DTIINLAPALKFNGGG--HINHSIFWHNLSPNGGKPSDVLTKAVEK 440
           E      Q K  +  T  +   A  FN     H NH  F H +SP   +  + L   +E+
Sbjct: 81  ETDYESHQIKDILLGTARDPGSAPIFNHASMAHNNHFFFKH-ISPKPVEVPEPLRSRLEQ 139

Query: 441 DFGSWDNIKNQLSTASVAVQGSGWGWL 521
            FGS D ++ ++   +  + G G+ WL
Sbjct: 140 SFGSMDTLRQEMVYTAAGMFGPGFVWL 166


>UniRef50_Q4P0E6 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 305

 Score = 40.7 bits (91), Expect = 0.048
 Identities = 39/164 (23%), Positives = 66/164 (40%), Gaps = 10/164 (6%)
 Frame = +3

Query: 75  TSLVIMLMSQRIGSLIRVAGASRQKHTLPELPYEYN-ALEPVISREIMSLHHSKHHATYI 251
           TS+V    S  + +        R  HT P  P   +    P +S   +        +  +
Sbjct: 19  TSVVSSPFSSALAASSSSTSQLRTLHTCPPTPEPLSEGCAPFLSSSTIKQISQNWQSGLL 78

Query: 252 NNLNVAEEKLAQAQAKGDIDTIINLAP----ALKFNGGGH-INHSIFWHNLSPN----GG 404
             LN  E +  +  +   ++T+I L+      L FN     +N++ F   L+P       
Sbjct: 79  ELLN-QEVRDTEFASSSIVETVIGLSQNREKLLAFNYASQALNNAFFLSTLAPQDRLRNP 137

Query: 405 KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQ 536
            P   L  A+ K FGS+  +    S+A+  +  SGW WL  ++Q
Sbjct: 138 TPLPKLATAISKSFGSFPEMCLAFSSAAYGMSASGWVWLVTDQQ 181



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
 Frame = +3

Query: 597 LVPLFGIDVWEHAYYLQYKNV-RADYVKAIFDVANWNDISQRYE 725
           L PL  I V EHA+   Y  + + +Y+   ++  NW+ + +R+E
Sbjct: 252 LYPLLNISVHEHAWLNDYGIMGKEEYLTTFWNCVNWDKVEERFE 295


>UniRef50_Q59593 Cluster: Superoxide dismutase; n=1; Nocardia
           asteroides|Rep: Superoxide dismutase - Nocardia
           asteroides
          Length = 163

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +2

Query: 500 GLRLGLAWLQQTNEEIAN--SYMPEPGSSAGHHWIGPALRNRCMGARVLSSVQERSCRLR 673
           GL LG A L+    E A+  +  P    +AGHH   PA  +R +GAR+L +VQER  RLR
Sbjct: 96  GLGLGGARLRHPRPEAADLPALRPAGQRAAGHH---PAAPSRHVGARLLPAVQERQGRLR 152

Query: 674 E 676
           +
Sbjct: 153 D 153


>UniRef50_A4RF21 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 307

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 20/65 (30%), Positives = 35/65 (53%)
 Frame = +3

Query: 327 APALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGS 506
           AP   +    H NH  F+  LS    +   +L +A+E+DFGS + ++ +    ++A+ G 
Sbjct: 104 APTFNYASMAHNNH-FFFDGLSSEPVEMPKLLREALEQDFGSIETLQREFLVTALAMFGP 162

Query: 507 GWGWL 521
           G+ WL
Sbjct: 163 GFVWL 167


>UniRef50_A0D834 Cluster: Superoxide dismutase; n=1; Paramecium
           tetraurelia|Rep: Superoxide dismutase - Paramecium
           tetraurelia
          Length = 103

 Score = 39.9 bits (89), Expect = 0.085
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 3/71 (4%)
 Frame = +3

Query: 177 YNALEPVISREIMSLHHSKHHATYINNLN-VAEEKLAQAQAKGDIDTIINLAPALK-FNG 350
           Y  L P IS + +S HH  HH  Y+N LN + +    Q Q+  +I  + N   A+K FN 
Sbjct: 9   YKDLSPYISAKTLSYHHGAHHKGYVNALNTLIQGTDYQGQSLEEI-ILSNQQKAVKIFNH 67

Query: 351 GGHI-NHSIFW 380
              + NH+ +W
Sbjct: 68  ATQLWNHNSYW 78


>UniRef50_Q7S2H6 Cluster: Putative uncharacterized protein
           NCU07386.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU07386.1 - Neurospora crassa
          Length = 310

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 33/139 (23%), Positives = 61/139 (43%), Gaps = 7/139 (5%)
 Frame = +3

Query: 126 VAGASRQKHTLPELP--YEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQ 293
           +A   R +H L  L   +E   +   +S   +++ ++++    +  LN  V      Q  
Sbjct: 36  IAAQRRWQHYLMPLRDNFEQEGIRNFLSPGSVNMAYTEYQTFILEKLNALVVGTDFEQKD 95

Query: 294 AKGDIDTIIN---LAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNI 464
            K  +        LA         H NH  F+ +LSP   K  D L   + ++FGS D +
Sbjct: 96  TKSIVLATARDPELAHVFNHASMAHNNH-FFFDHLSPVPVKMGDKLFYHINENFGSVDTL 154

Query: 465 KNQLSTASVAVQGSGWGWL 521
           ++++   +V++ G G+ WL
Sbjct: 155 RDEMIGTAVSMFGPGFVWL 173


>UniRef50_P47141 Cluster: Mitochondrial 37S ribosomal protein S26;
           n=6; Saccharomycetales|Rep: Mitochondrial 37S ribosomal
           protein S26 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 266

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 531 KQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYK-NVRADYVKAIFDVANWND 707
           KQMK+L   + +    +Q  T  +P+  +++W+HAY   Y    R+ YVK + D  NW+ 
Sbjct: 198 KQMKELIGKSTKLNGKVQDWT--MPIICVNLWDHAYLHDYGVGNRSKYVKNVLDNLNWSV 255

Query: 708 ISQR 719
           ++ R
Sbjct: 256 VNNR 259


>UniRef50_Q848L2 Cluster: SodA; n=1; uncultured bacterium|Rep: SodA
           - uncultured bacterium
          Length = 205

 Score = 38.3 bits (85), Expect = 0.26
 Identities = 26/108 (24%), Positives = 48/108 (44%), Gaps = 1/108 (0%)
 Frame = +3

Query: 411 SDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQAT 590
           S V  + ++  FG +D  +  +  A    +G GW    ++    +L +    +   L   
Sbjct: 96  SSVAAEGMDVAFGGFDGWRADVE-ALATTRGIGWVVAAWDASAGQL-VNLWADLHHLLLP 153

Query: 591 TGLVPLFGIDVWEHAYYLQY-KNVRADYVKAIFDVANWNDISQRYEKA 731
            G   +F +D+WEHAY+  +    R  Y K I +  +W  +  R+ +A
Sbjct: 154 AGHGIVFVLDLWEHAYWDDFGPKGRGAYSKFILENTDWEVVEARFARA 201


>UniRef50_A5VNS3 Cluster: Fe-superoxide dismutase; n=1; Brucella
           ovis ATCC 25840|Rep: Fe-superoxide dismutase - Brucella
           ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
          Length = 61

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 588 TTGL-VPLFGIDVWEHAYYLQYKNVRADYVKAIFD 689
           TTG   P  G+DV EH YYL ++N R D+ K+  D
Sbjct: 12  TTGKGKPPLGLDVGEHCYYLDFRNYRLDHRKSFLD 46


>UniRef50_A5DIH0 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 262

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = +3

Query: 600 VPLFGIDVWEHAYYLQYKNV-RADYVKAIFDVANWNDISQR 719
           +PL  I+VW+ A+   Y    RADY+  +++  NW+ +++R
Sbjct: 218 LPLLAINVWDVAFIQDYGTTGRADYLANVWECINWDIVNKR 258


>UniRef50_Q1V005 Cluster: Phosphoribosylaminoimidazole carboxylase
           ATPase chain; n=4; Bacteria|Rep:
           Phosphoribosylaminoimidazole carboxylase ATPase chain -
           Candidatus Pelagibacter ubique HTCC1002
          Length = 348

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 2/57 (3%)
 Frame = +3

Query: 174 EYNALEPVISREIMS--LHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPAL 338
           E N ++PV+ +  ++  + H      +INNLN+   +    + K +ID++ +L P +
Sbjct: 82  EINKIKPVLPKPSVNRIIQHRLAEKDFINNLNIRTTRYVSIEKKSEIDSVEDLLPGI 138


>UniRef50_Q5A922 Cluster: Potential mitochondrial protein Fmp29;
           n=5; Saccharomycetales|Rep: Potential mitochondrial
           protein Fmp29 - Candida albicans (Yeast)
          Length = 624

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 17/44 (38%), Positives = 22/44 (50%)
 Frame = +3

Query: 189 EPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTII 320
           + VI R I S+H  KHH  Y   LN  +E + +   K D D  I
Sbjct: 129 DKVIVRSIASIHEGKHHRVYKITLNTGKELVLRIPYKLDSDVAI 172


>UniRef50_Q1HG45 Cluster: Superoxide dismutase; n=1; Sporothrix
           schenckii|Rep: Superoxide dismutase - Sporothrix
           schenckii
          Length = 308

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 39/161 (24%), Positives = 65/161 (40%), Gaps = 14/161 (8%)
 Frame = +3

Query: 81  LVIMLMSQRIGSLIRVAGASRQKHTLPELPYEYNALEP-VISREIMSLHHSKHHATYINN 257
           L +M       +L  +A A R  H LP   ++     P ++S E   L  ++H    +N 
Sbjct: 8   LALMKRRPAQSALAPIAQARRSIHHLPVSRHDARVGVPNLLSAEGFDLAWTQHMTLMLNR 67

Query: 258 LN--VAEEKLAQAQAKGDI-DTIINLAPALKFNGGGHI-NHSIFWHNLSPNGGKPSDV-- 419
           LN   A       + K  I  T  N + A  FN      N   F+ ++ P    P++   
Sbjct: 68  LNQLAAGTTYEDRELKSIIIRTAGNQSSAAIFNYASMAHNTDFFFKHIIPASASPAEAAA 127

Query: 420 -------LTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWL 521
                  L  A+E +FGS + ++ +    +  + G G+ WL
Sbjct: 128 AREIPATLRLAIEDNFGSVETLRREFLAIAQGMFGPGFIWL 168


>UniRef50_Q0UWI2 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 286

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
 Frame = +3

Query: 555 ATCQNQDPLQATTGL--VPLFGIDVWEHAYYLQY-KNVRADYVKAIFDVANWNDISQ 716
           A  QN  P +   G+  VPL  ++ WEHA+   Y    +  Y++A +D  +WN + Q
Sbjct: 218 AAKQNLQPKKPLGGVDVVPLLCVNTWEHAWLHDYGVRGKRQYLEAWWDKIDWNWVRQ 274


>UniRef50_A6SRX5 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 288

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 34/148 (22%), Positives = 61/148 (41%), Gaps = 9/148 (6%)
 Frame = +3

Query: 105 RIGSLIRVAGASRQKHTLPELPYEY-NALEPVISREIMSLHHSKHHATYINNLNVAEEKL 281
           RIG  ++          +P L +++ N +   I  +   L  + +    ++ L+ A   +
Sbjct: 8   RIGRSVQKNFIRSISQHIPPLKHDFSNGIPEFIGPQAFELAWTSYQKLMVDKLSDAIAGV 67

Query: 282 AQAQAKGDIDTIINLA----PALKFNGGGH-INHSIFWHNLSPN-GGKP--SDVLTKAVE 437
                K   D  +  A     A  FN      N++ F++ L PN   +P  S+ L  A+E
Sbjct: 68  PHLDGKQPKDIALLCARDPDQAATFNYASMAFNNNFFFNCLQPNPASEPVMSEKLRAAIE 127

Query: 438 KDFGSWDNIKNQLSTASVAVQGSGWGWL 521
             F S D +K +    +  + G G+ WL
Sbjct: 128 SSFSSVDGLKKEFVITASKMFGPGFVWL 155


>UniRef50_Q07GT1 Cluster: VirB4 protein, putative; n=1; Roseobacter
           denitrificans OCh 114|Rep: VirB4 protein, putative -
           Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
           (Erythrobactersp. (strain OCh 114)) (Roseobacter
           denitrificans)
          Length = 786

 Score = 33.9 bits (74), Expect = 5.6
 Identities = 28/99 (28%), Positives = 50/99 (50%), Gaps = 6/99 (6%)
 Frame = +3

Query: 78  SLVIMLMSQRIGSLIR-VAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYIN 254
           ++V+MLM+QR+  L+   AG S  +  +  L Y  +        E+  L+ +   A ++ 
Sbjct: 673 NVVLMLMTQRVDHLVNSAAGGSILESCVTTLVYPNSR---YTLDEVAPLNFTDAEAAFVT 729

Query: 255 NLNVAEEKLAQAQAKGDIDTIIN-----LAPALKFNGGG 356
           + +   ++LA  +  GD+ T++N     L P LK  GGG
Sbjct: 730 S-SAGGQRLALIR-NGDVSTVVNMDLGALGPLLKVLGGG 766


>UniRef50_A0D7E8 Cluster: Chromosome undetermined scaffold_4, whole
           genome shotgun sequence; n=5; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_4, whole genome shotgun
           sequence - Paramecium tetraurelia
          Length = 480

 Score = 33.9 bits (74), Expect = 5.6
 Identities = 17/74 (22%), Positives = 32/74 (43%)
 Frame = +3

Query: 252 NNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKA 431
           N  + A E+  QA  + D+    NL+       G H+N S+F++ +  N  +   +   A
Sbjct: 377 NEYHAAVEQATQAYKEADVLAKSNLSTTSPIRLGLHLNQSVFYYEILQNATEAIRIANDA 436

Query: 432 VEKDFGSWDNIKNQ 473
            E+     D +  +
Sbjct: 437 FEQAIAQVDTVNEE 450


>UniRef50_Q2U4N0 Cluster: Predicted protein; n=1; Aspergillus
           oryzae|Rep: Predicted protein - Aspergillus oryzae
          Length = 822

 Score = 33.5 bits (73), Expect = 7.4
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = -2

Query: 535 CLL*PSQPQPEPCTATEAVDS*FFMLSQDPKSFSTALVRTSEGLPP 398
           C+L  + P+PE  T  E  D+  + L   PK    A++RTS+ +PP
Sbjct: 646 CILAANLPEPE--TVAEWADALSYPLDSVPKGIFGAILRTSKNIPP 689


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 854,107,781
Number of Sequences: 1657284
Number of extensions: 18267779
Number of successful extensions: 49689
Number of sequences better than 10.0: 151
Number of HSP's better than 10.0 without gapping: 47549
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49407
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 79932179145
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).