SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0031
         (644 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O95166 Cluster: Gamma-aminobutyric acid receptor-associ...   231   1e-59
UniRef50_Q09490 Cluster: Protein lgg-1; n=26; Eukaryota|Rep: Pro...   213   3e-54
UniRef50_Q8B513 Cluster: Polyprotein; n=1; Bovine viral diarrhea...   196   4e-49
UniRef50_P87068 Cluster: Autophagy-related protein 8 precursor; ...   167   3e-40
UniRef50_UPI0000D9F236 Cluster: PREDICTED: similar to GABA(A) re...   149   6e-35
UniRef50_P60520 Cluster: Gamma-aminobutyric acid receptor-associ...   149   6e-35
UniRef50_Q8LEM4 Cluster: Autophagy-related protein 8a precursor;...   146   5e-34
UniRef50_A2EEF5 Cluster: Microtubule associated protein 1A/1B, l...   128   1e-28
UniRef50_A6P6J6 Cluster: Autophagy-related protein 8; n=2; Magno...   124   2e-27
UniRef50_UPI0000DA42D1 Cluster: PREDICTED: similar to GABA(A) re...   119   5e-26
UniRef50_A7Q0V1 Cluster: Chromosome chr7 scaffold_42, whole geno...   119   5e-26
UniRef50_Q8S925 Cluster: Autophagy-related protein 8h; n=3; Magn...   118   2e-25
UniRef50_Q4QD46 Cluster: Microtubule-associated protein 1A/1B, l...   117   3e-25
UniRef50_A2A681 Cluster: Gamma-aminobutyric acid receptor associ...   113   5e-24
UniRef50_Q54G11 Cluster: Putative uncharacterized protein; n=1; ...   110   3e-23
UniRef50_Q7RRW1 Cluster: Autophagy 8i; n=8; Alveolata|Rep: Autop...   106   4e-22
UniRef50_Q7ZWC0 Cluster: Zgc:56565; n=5; Eumetazoa|Rep: Zgc:5656...    98   1e-19
UniRef50_Q4TAG3 Cluster: Chromosome undetermined SCAF7349, whole...    98   1e-19
UniRef50_A0BE40 Cluster: Chromosome undetermined scaffold_101, w...    94   2e-18
UniRef50_Q9BXW4 Cluster: Microtubule-associated proteins 1A/1B l...    94   3e-18
UniRef50_UPI00006CD8C7 Cluster: hypothetical protein TTHERM_0052...    93   7e-18
UniRef50_Q22M73 Cluster: Putative uncharacterized protein; n=1; ...    92   1e-17
UniRef50_A2EFC3 Cluster: Microtubule-associated protein, putativ...    91   3e-17
UniRef50_Q4RPD5 Cluster: Chromosome 1 SCAF15008, whole genome sh...    90   5e-17
UniRef50_A7MB94 Cluster: LOC507432 protein; n=5; Amniota|Rep: LO...    89   8e-17
UniRef50_A0CWE3 Cluster: Chromosome undetermined scaffold_3, who...    89   1e-16
UniRef50_Q4DQT1 Cluster: Microtubial binding protein, putative; ...    88   1e-16
UniRef50_UPI00004D762A Cluster: UPI00004D762A related cluster; n...    83   4e-15
UniRef50_Q23536 Cluster: Protein lgg-2; n=2; Caenorhabditis|Rep:...    83   4e-15
UniRef50_Q9H492 Cluster: Microtubule-associated proteins 1A/1B l...    81   2e-14
UniRef50_Q57WE7 Cluster: Microtubule-associated protein 1A/1B, l...    78   2e-13
UniRef50_A0DB29 Cluster: Chromosome undetermined scaffold_44, wh...    77   3e-13
UniRef50_Q9GZQ8 Cluster: Microtubule-associated proteins 1A/1B l...    77   4e-13
UniRef50_UPI000155E1F7 Cluster: PREDICTED: similar to microtubul...    70   4e-11
UniRef50_Q4UE40 Cluster: Autophagy protein 8I, putative; n=2; Th...    68   2e-10
UniRef50_UPI0001554CDD Cluster: PREDICTED: hypothetical protein;...    68   2e-10
UniRef50_A0CD24 Cluster: Chromosome undetermined scaffold_169, w...    68   2e-10
UniRef50_A0BKK1 Cluster: Chromosome undetermined scaffold_112, w...    67   4e-10
UniRef50_UPI000155CF91 Cluster: PREDICTED: similar to GABA(A) re...    64   4e-09
UniRef50_A0CWS8 Cluster: Chromosome undetermined scaffold_3, who...    62   1e-08
UniRef50_A7BJL2 Cluster: Autophagy-related gene 8 product; n=3; ...    61   3e-08
UniRef50_Q6H6P0 Cluster: Putative autophagy-related protein 8E; ...    60   6e-08
UniRef50_A0CH76 Cluster: Chromosome undetermined scaffold_18, wh...    59   8e-08
UniRef50_A0CRP1 Cluster: Chromosome undetermined scaffold_25, wh...    57   3e-07
UniRef50_A0BIR0 Cluster: Chromosome undetermined scaffold_11, wh...    56   7e-07
UniRef50_A2X5M4 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_UPI00006CA3CD Cluster: hypothetical protein TTHERM_0052...    52   2e-05
UniRef50_A7ANM2 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_A0BIV2 Cluster: Chromosome undetermined scaffold_11, wh...    49   1e-04
UniRef50_Q4QDC8 Cluster: Microtubule associated protein-like; n=...    48   1e-04
UniRef50_Q4QDD1 Cluster: Microtubial binding protein-like protei...    45   0.002
UniRef50_Q4QBL7 Cluster: Polyprotein, putative; n=2; Leishmania|...    40   0.039
UniRef50_UPI0000F2157A Cluster: PREDICTED: similar to Microtubul...    39   0.090
UniRef50_UPI00006CBA81 Cluster: hypothetical protein TTHERM_0050...    38   0.16 
UniRef50_A7RKL8 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ...    37   0.36 
UniRef50_UPI0000586F54 Cluster: PREDICTED: similar to Autophagy-...    36   0.63 
UniRef50_UPI00015B62AB Cluster: PREDICTED: similar to CG18255-PA...    36   0.84 
UniRef50_A0CES2 Cluster: Chromosome undetermined scaffold_172, w...    36   0.84 
UniRef50_UPI0000D556FA Cluster: PREDICTED: similar to CG5987-PA;...    35   1.5  
UniRef50_Q16WV3 Cluster: Autophagy-specific protein, putative; n...    35   1.9  
UniRef50_A0DVW5 Cluster: Chromosome undetermined scaffold_66, wh...    35   1.9  
UniRef50_Q54RN5 Cluster: Autophagy protein 12; n=2; Dictyosteliu...    34   3.4  
UniRef50_Q4PGY2 Cluster: Putative uncharacterized protein; n=1; ...    33   5.9  
UniRef50_Q5DBF6 Cluster: SJCHGC04003 protein; n=1; Schistosoma j...    33   7.8  
UniRef50_Q5D9A2 Cluster: SJCHGC09412 protein; n=1; Schistosoma j...    33   7.8  

>UniRef50_O95166 Cluster: Gamma-aminobutyric acid
           receptor-associated protein (GABA(A) receptor-
           associated protein); n=18; root|Rep: Gamma-aminobutyric
           acid receptor-associated protein (GABA(A) receptor-
           associated protein) - Homo sapiens (Human)
          Length = 117

 Score =  231 bits (565), Expect = 1e-59
 Identities = 105/116 (90%), Positives = 112/116 (96%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKF YKEEH FEKR++EGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLR EDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116


>UniRef50_Q09490 Cluster: Protein lgg-1; n=26; Eukaryota|Rep:
           Protein lgg-1 - Caenorhabditis elegans
          Length = 123

 Score =  213 bits (520), Expect = 3e-54
 Identities = 96/116 (82%), Positives = 108/116 (93%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ YKEE++FEKR+AEG+KIRRKYPDR+PVIVEKAPK++L DLDKKKYLVPSDLTVGQF
Sbjct: 1   MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRI LRPEDALFFFVNNVIP T  TMG LYQ+HH+ED FLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYG 116


>UniRef50_Q8B513 Cluster: Polyprotein; n=1; Bovine viral diarrhea
           virus 1|Rep: Polyprotein - Bovine viral diarrhea virus
           (BVDV) (Mucosal disease virus)
          Length = 239

 Score =  196 bits (478), Expect = 4e-49
 Identities = 87/103 (84%), Positives = 98/103 (95%)
 Frame = +2

Query: 83  RKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPE 262
           RK EGEKIR+KYPDRVPVIVEKAPKAR+ DLDK+KYLVPSDLTVGQFYFLIRKRIHLRPE
Sbjct: 80  RKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPE 139

Query: 263 DALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           DALFFFVNN IPPTSATMG LY+++H+ED+FLY+A+SDE+ YG
Sbjct: 140 DALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESTYG 182


>UniRef50_P87068 Cluster: Autophagy-related protein 8 precursor;
           n=20; Eukaryota|Rep: Autophagy-related protein 8
           precursor - Laccaria bicolor (Bicoloured deceiver)
           (Laccaria laccata var.bicolor)
          Length = 184

 Score =  167 bits (405), Expect = 3e-40
 Identities = 72/116 (62%), Positives = 95/116 (81%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           M+ ++K+EH FEKRKAE E+IR+KYPDR+PVI EKA +  +  +DKKKYLVPSDLTVGQF
Sbjct: 1   MRSKFKDEHPFEKRKAEAERIRQKYPDRIPVICEKADRTDIPTIDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            ++IRKRI L PE A+F FV+ V+PPT+A M ++Y+EH DED FLY+++S EN +G
Sbjct: 61  VYVIRKRIKLAPEKAIFIFVDEVLPPTAALMSAIYEEHKDEDNFLYVSYSGENTFG 116


>UniRef50_UPI0000D9F236 Cluster: PREDICTED: similar to GABA(A)
           receptor-associated protein like 2; n=1; Macaca
           mulatta|Rep: PREDICTED: similar to GABA(A)
           receptor-associated protein like 2 - Macaca mulatta
          Length = 267

 Score =  149 bits (361), Expect = 6e-35
 Identities = 67/116 (57%), Positives = 87/116 (75%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ +KE+HS E R  E  KIR KYPDRVPVIVEK   +++ D+DK+KYLVPSD+TV QF
Sbjct: 151 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF 210

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            ++IRKRI L  E A+F FV+  +P +S TMG LY++  DED FLY+A+S EN +G
Sbjct: 211 MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG 266


>UniRef50_P60520 Cluster: Gamma-aminobutyric acid
           receptor-associated protein-like 2 (GABA(A)
           receptor-associated protein-like 2); n=75;
           Eukaryota|Rep: Gamma-aminobutyric acid
           receptor-associated protein-like 2 (GABA(A)
           receptor-associated protein-like 2) - Homo sapiens
           (Human)
          Length = 117

 Score =  149 bits (361), Expect = 6e-35
 Identities = 67/116 (57%), Positives = 87/116 (75%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ +KE+HS E R  E  KIR KYPDRVPVIVEK   +++ D+DK+KYLVPSD+TV QF
Sbjct: 1   MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            ++IRKRI L  E A+F FV+  +P +S TMG LY++  DED FLY+A+S EN +G
Sbjct: 61  MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG 116


>UniRef50_Q8LEM4 Cluster: Autophagy-related protein 8a precursor;
           n=61; Eukaryota|Rep: Autophagy-related protein 8a
           precursor - Arabidopsis thaliana (Mouse-ear cress)
          Length = 122

 Score =  146 bits (353), Expect = 5e-34
 Identities = 64/116 (55%), Positives = 87/116 (75%)
 Frame = +2

Query: 47  KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 226
           K  +K  +  E R +E  +IR KYPDR+PVIVEKA ++ + D+DKKKYLVP+DLTVGQF 
Sbjct: 3   KSSFKISNPLEARMSESSRIREKYPDRIPVIVEKAGQSDVPDIDKKKYLVPADLTVGQFV 62

Query: 227 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 394
           +++RKRI L  E A+F FV N +PPT+A M ++Y+EH DED FLY+ +S EN +G+
Sbjct: 63  YVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFGS 118


>UniRef50_A2EEF5 Cluster: Microtubule associated protein 1A/1B,
           light chain 3 containing protein; n=1; Trichomonas
           vaginalis G3|Rep: Microtubule associated protein 1A/1B,
           light chain 3 containing protein - Trichomonas vaginalis
           G3
          Length = 123

 Score =  128 bits (309), Expect = 1e-28
 Identities = 55/114 (48%), Positives = 84/114 (73%)
 Frame = +2

Query: 53  QYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFL 232
           +YK E SF  R  E   I RK+   VPVIV+K PK  L D++++K+LVPS+L++GQF ++
Sbjct: 9   RYKREKSFADRCQESAGIIRKFKSHVPVIVDKDPKCTLPDIERQKFLVPSELSIGQFIYV 68

Query: 233 IRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 394
           +RKRI+L+  +A+F FVN  +PP ++TMG+LY+E+ DED F+Y  +S +N +G+
Sbjct: 69  VRKRINLQSAEAIFLFVNKKLPPPNSTMGALYEENRDEDGFMYCLYSSDNSFGS 122


>UniRef50_A6P6J6 Cluster: Autophagy-related protein 8; n=2;
           Magnoliophyta|Rep: Autophagy-related protein 8 -
           Fagopyrum esculentum (Common buckwheat)
          Length = 124

 Score =  124 bits (299), Expect = 2e-27
 Identities = 54/112 (48%), Positives = 79/112 (70%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           +K+E++FE+R  E  +I  K+PDRVP+I E+  K  L +L+K+K+LVP D++VGQF  ++
Sbjct: 7   FKDEYTFEERVKESSEIIAKFPDRVPLIAERYSKTELPELEKRKFLVPRDMSVGQFIHIL 66

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
             R+HL P  ALF FVNN +P T++ M SLY+   DED FLY+ +S E  +G
Sbjct: 67  SGRLHLPPGKALFIFVNNTLPQTTSLMNSLYESFKDEDGFLYMFYSSEKTFG 118


>UniRef50_UPI0000DA42D1 Cluster: PREDICTED: similar to GABA(A)
           receptor-associated protein like 2; n=2; Rattus
           norvegicus|Rep: PREDICTED: similar to GABA(A)
           receptor-associated protein like 2 - Rattus norvegicus
          Length = 289

 Score =  119 bits (287), Expect = 5e-26
 Identities = 55/116 (47%), Positives = 77/116 (66%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ +KE+HS E R  E  KIR K PDRVPVIVEK   +++ D D++K+L+PS  TV QF
Sbjct: 173 MKWMFKEDHSLEHRFVESAKIRVKPPDRVPVIVEKVSGSQIVDTDRRKHLIPSHSTVAQF 232

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            ++++KRI    E A F  V+  +P +  T+G LY++  DED FLY+A   EN +G
Sbjct: 233 MWILKKRIQFPSEKATFLCVDKTVPQSRLTVGQLYKKEKDEDGFLYVAHRGENTFG 288


>UniRef50_A7Q0V1 Cluster: Chromosome chr7 scaffold_42, whole genome
           shotgun sequence; n=2; core eudicotyledons|Rep:
           Chromosome chr7 scaffold_42, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 129

 Score =  119 bits (287), Expect = 5e-26
 Identities = 53/112 (47%), Positives = 76/112 (67%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           +K E S+E+R  E   I  KYPDRVPVI E+  K  L +++KKK+LVP D++VGQF  ++
Sbjct: 9   FKNEFSYEERLEESRDIIAKYPDRVPVIAERYSKTDLPEMEKKKFLVPRDMSVGQFIHIL 68

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
             R+HL P  ALF FV N +P T++ M ++Y+   DED FLY+++S E  +G
Sbjct: 69  SIRLHLTPGKALFVFVENTLPQTASLMDTVYESFKDEDGFLYMSYSSEKTFG 120


>UniRef50_Q8S925 Cluster: Autophagy-related protein 8h; n=3;
           Magnoliophyta|Rep: Autophagy-related protein 8h -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 119

 Score =  118 bits (283), Expect = 2e-25
 Identities = 53/112 (47%), Positives = 74/112 (66%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           +K++ S ++R  E   I  KYPDR+PVI+EK   A L D++K KYLVP D+TVG F  ++
Sbjct: 8   FKDQFSSDERLKESNNIIAKYPDRIPVIIEKYSNADLPDMEKNKYLVPRDMTVGHFIHML 67

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            KR+ L P  ALF FV+N +P T++ M SLY    +ED FLY+ +S E  +G
Sbjct: 68  SKRMQLDPSKALFVFVHNTLPQTASRMDSLYNTFKEEDGFLYMCYSTEKTFG 119


>UniRef50_Q4QD46 Cluster: Microtubule-associated protein 1A/1B,
           light chain 3, putative; n=3; Leishmania|Rep:
           Microtubule-associated protein 1A/1B, light chain 3,
           putative - Leishmania major
          Length = 125

 Score =  117 bits (281), Expect = 3e-25
 Identities = 54/112 (48%), Positives = 71/112 (63%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           YK+ H+ E R  + EK+R + PDR+ VI EKA  + + DLDK K+LVP D TVG F   I
Sbjct: 9   YKKAHTLEARLRDAEKVRERAPDRILVICEKAENSPVPDLDKSKFLVPPDATVGGFLVSI 68

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           R+RI +  E ALF FV + +P  S  M  L+  + DED FLY+ +S EN YG
Sbjct: 69  RRRITMEAEKALFLFVGDSVPANSTLMSDLFNRYKDEDGFLYVTYSGENTYG 120


>UniRef50_A2A681 Cluster: Gamma-aminobutyric acid receptor
           associated protein; n=1; Mus musculus|Rep:
           Gamma-aminobutyric acid receptor associated protein -
           Mus musculus (Mouse)
          Length = 106

 Score =  113 bits (271), Expect = 5e-24
 Identities = 51/57 (89%), Positives = 55/57 (96%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTV 214
           MKF YKEEH FEKR++EGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTV
Sbjct: 1   MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTV 57


>UniRef50_Q54G11 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 126

 Score =  110 bits (264), Expect = 3e-23
 Identities = 52/117 (44%), Positives = 77/117 (65%), Gaps = 4/117 (3%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           +K+E+S EKRK    KIR +Y DR+P+IVE+A  + + D++KKK+L PS++ +  F   I
Sbjct: 8   FKQEYSLEKRKLISSKIRNRYKDRLPIIVERAANSDVPDINKKKFLAPSNMVITNFIMEI 67

Query: 236 RKRI---HLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 394
           RK +       + A+F FVN N +PP+S  + S+Y  H DED FLYI +S EN +G+
Sbjct: 68  RKHLDDSDHNEQKAIFLFVNKNNLPPSSQLLSSIYDAHKDEDGFLYICYSGENTFGS 124


>UniRef50_Q7RRW1 Cluster: Autophagy 8i; n=8; Alveolata|Rep:
           Autophagy 8i - Plasmodium yoelii yoelii
          Length = 124

 Score =  106 bits (255), Expect = 4e-22
 Identities = 52/120 (43%), Positives = 78/120 (65%), Gaps = 9/120 (7%)
 Frame = +2

Query: 59  KEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIR 238
           KEE  FE R AE  KIR KYP+R+PV+ EKA ++ L +++KKK+LVP ++ VG+F F++ 
Sbjct: 5   KEEIPFESRVAETHKIRAKYPNRIPVVCEKAHRSNLPEIEKKKFLVPMNMLVGEFKFVLH 64

Query: 239 KRIH---------LRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           + I+         L  E  ++ FVNN+IP T   M  LY+ + DED +LY+ +S E+ +G
Sbjct: 65  QHINQSAYGNNMKLFREKTIYLFVNNIIPKTGLLMQELYEMYKDEDGYLYLEYSCESCFG 124


>UniRef50_Q7ZWC0 Cluster: Zgc:56565; n=5; Eumetazoa|Rep: Zgc:56565 -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 128

 Score = 98.3 bits (234), Expect = 1e-19
 Identities = 47/115 (40%), Positives = 72/115 (62%), Gaps = 2/115 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  S   RK E   IR K+P ++PVI+E+  + + L  LDK K+LVP +LT+ QF  +
Sbjct: 13  FKQRKSLATRKQEVAGIRTKFPTKIPVIIERYQREKFLPPLDKTKFLVPQELTMTQFVTI 72

Query: 233 IRKRIHLRPEDALFFFVNNV-IPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 394
           IR R+ L P  A +  +NN  I   S TM  LY++H DED FLY+ ++ + ++G+
Sbjct: 73  IRNRMTLMPNQAFYLLINNSGIASMSMTMAQLYKDHKDEDGFLYMTYASQEMFGH 127


>UniRef50_Q4TAG3 Cluster: Chromosome undetermined SCAF7349, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF7349,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 112

 Score = 98.3 bits (234), Expect = 1e-19
 Identities = 55/112 (49%), Positives = 70/112 (62%), Gaps = 25/112 (22%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPV-------------------------IVEK 148
           MK+ ++E HSFE+R+ E  K R KYPDRVPV                         IVEK
Sbjct: 1   MKWMFQERHSFEERREESAKTRSKYPDRVPVSGPPRRPRVRVVICVCVCGGGVGQVIVEK 60

Query: 149 APKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPT 304
            PK+++ D+DK+KYL+PSDL+VGQF FLIRKRI L PE A+F  V+ V+P T
Sbjct: 61  VPKSQIMDVDKQKYLLPSDLSVGQFMFLIRKRIQLPPEKAVFLCVDKVLPQT 112


>UniRef50_A0BE40 Cluster: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 137

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 49/122 (40%), Positives = 75/122 (61%), Gaps = 3/122 (2%)
 Frame = +2

Query: 35  NINM-KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLT 211
           N NM K  +K+++S E+R  E E I + Y DRVP+I+EK   +RL DLD +KYL  S+  
Sbjct: 15  NNNMQKESFKKQYSKEQRLKESENILKHYQDRVPIIIEKDKNSRLPDLDVQKYLFLSNFR 74

Query: 212 VGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSAT--MGSLYQEHHDEDFFLYIAFSDENV 385
           V Q   LIR +++L   +A++ FVNN +     T  +  +Y ++ D+D FLYI + + N 
Sbjct: 75  VFQLNTLIRSKLNLNKAEAVYLFVNNKVALRGGTIHIKEVYDKYQDDDKFLYIQYCEYNT 134

Query: 386 YG 391
           +G
Sbjct: 135 FG 136


>UniRef50_Q9BXW4 Cluster: Microtubule-associated proteins 1A/1B
           light chain 3C precursor; n=7; Eutheria|Rep:
           Microtubule-associated proteins 1A/1B light chain 3C
           precursor - Homo sapiens (Human)
          Length = 147

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 45/114 (39%), Positives = 73/114 (64%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  S   R+ E   IR K+P+++PV+VE+ P+   L  LDK K+LVP +LT+ QF  +
Sbjct: 13  FKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSI 72

Query: 233 IRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR R+ LR  +A +  VNN  +   SATM  +Y+++ DED F+Y+ ++ +  +G
Sbjct: 73  IRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFG 126


>UniRef50_UPI00006CD8C7 Cluster: hypothetical protein
           TTHERM_00522490; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00522490 - Tetrahymena
           thermophila SB210
          Length = 122

 Score = 92.7 bits (220), Expect = 7e-18
 Identities = 41/114 (35%), Positives = 76/114 (66%), Gaps = 1/114 (0%)
 Frame = +2

Query: 53  QYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFL 232
           +YK+  S ++RK+E E IR+ YPD++P+I+EK PK++L  +D+ K+L+   L V Q   +
Sbjct: 6   RYKDLLSEDQRKSECENIRKNYPDKIPLIIEKHPKSKLEQIDRTKFLILEKLRVYQVNTI 65

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+++ L   DAL+ FVN N++      +  +Y+++ D D F+Y+++ + + +G
Sbjct: 66  IRRKMSLNKVDALYLFVNDNILLRGDQCLKDVYEKYKDSDGFIYLSYCEYSSFG 119


>UniRef50_Q22M73 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 126

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 51/117 (43%), Positives = 77/117 (65%), Gaps = 4/117 (3%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +KE+ S  +R+ E EK + KYP+ +PVIVE   KA+ +  L+K+K+LV  D+ + +F   
Sbjct: 9   FKEKFSLAERQKELEKQKSKYPNMIPVIVEINKKAKTVRVLEKQKFLVSKDVKLHEFQQT 68

Query: 233 IRKRIHLRPE-DALFFFV-NNVIPPTSATMGSLYQEHHD-EDFFLYIAFSDENVYGN 394
           +RK++ +  E DALFFFV N  I   + TM  +YQE  D +D FLYI +SD+ V+G+
Sbjct: 69  VRKKLDITNEADALFFFVGNKKIEKINRTMSEIYQESKDKDDGFLYITYSDQEVFGS 125


>UniRef50_A2EFC3 Cluster: Microtubule-associated protein, putative;
           n=1; Trichomonas vaginalis G3|Rep:
           Microtubule-associated protein, putative - Trichomonas
           vaginalis G3
          Length = 113

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 38/94 (40%), Positives = 60/94 (63%), Gaps = 1/94 (1%)
 Frame = +2

Query: 113 KYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNN 289
           KYPD +PVIVE+ P    L D+  KK+ V   L+VG F + +R R+ +  +DA+F FV+N
Sbjct: 18  KYPDHIPVIVERDPHCTTLPDIKNKKFFVTKTLSVGNFVYCVRNRLDINEKDAIFLFVDN 77

Query: 290 VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            +P  S  +G++Y++H  ED  L+  +S ++ YG
Sbjct: 78  TLPNPSDNLGAIYEKHKSEDQMLHCTYSSDSAYG 111


>UniRef50_Q4RPD5 Cluster: Chromosome 1 SCAF15008, whole genome
           shotgun sequence; n=3; Clupeocephala|Rep: Chromosome 1
           SCAF15008, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 127

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 47/115 (40%), Positives = 71/115 (61%), Gaps = 2/115 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +K+    E RK E   IR K+P+++PVIVE+  + + L  LDK K+LVP +LT+GQF  L
Sbjct: 13  FKQRKCLETRKDEVCVIRSKFPNKLPVIVERYVREKTLPLLDKTKFLVPFELTLGQFLCL 72

Query: 233 IRKRIHLRPEDALFFFV-NNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 394
           +R +I L    +LF  V    +   S++MG +Y  H D D FLYI ++ + V+G+
Sbjct: 73  LRNKIDLDSSKSLFLLVAEKSMSCMSSSMGDIYSRHRDTDGFLYITYASQEVFGS 127


>UniRef50_A7MB94 Cluster: LOC507432 protein; n=5; Amniota|Rep:
           LOC507432 protein - Bos taurus (Bovine)
          Length = 148

 Score = 89.0 bits (211), Expect = 8e-17
 Identities = 43/114 (37%), Positives = 72/114 (63%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  S   R+ E   IR K+P ++PVIVE+ P+ + L  LDK K+LVP +LT+ QF  +
Sbjct: 13  FKQRKSLATRREEVAGIRVKFPGKIPVIVERYPREKFLPRLDKTKFLVPQELTMTQFLSV 72

Query: 233 IRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR R+ L   +A +  VNN  +   + TM  +Y+++ DED F+Y+ ++ + ++G
Sbjct: 73  IRSRMVLGATEAFYLLVNNKSLGSMNVTMAEIYRDYKDEDGFVYMTYASQEMFG 126


>UniRef50_A0CWE3 Cluster: Chromosome undetermined scaffold_3, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_3,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 133

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 41/114 (35%), Positives = 67/114 (58%), Gaps = 1/114 (0%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           YK +H  E RK   ++ + KYP+  P++V+K PKA++  L + ++LV   +   +F   I
Sbjct: 17  YKAQHKLEDRKKRVQQYKEKYPEMTPMVVQKHPKAKIMSLTRPQFLVNQTVKFSEFKNQI 76

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHD-EDFFLYIAFSDENVYGN 394
           R ++ L P+  LFF+  N I     ++  LY ++ D ED FLY+ +SD  V+GN
Sbjct: 77  RTKLQLSPQQTLFFYCGNNIISDDISLQELYNKYKDREDEFLYLNYSDCEVFGN 130


>UniRef50_Q4DQT1 Cluster: Microtubial binding protein, putative;
           n=3; Trypanosoma cruzi|Rep: Microtubial binding protein,
           putative - Trypanosoma cruzi
          Length = 326

 Score = 88.2 bits (209), Expect = 1e-16
 Identities = 47/128 (36%), Positives = 73/128 (57%), Gaps = 13/128 (10%)
 Frame = +2

Query: 47  KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP------------KARL-GDLDKKK 187
           K++Y+  H+F +R+ E   IR ++P  VPV+ E A             + RL  DLD  K
Sbjct: 192 KYRYQRTHTFAERQKEVATIRGRFPQHVPVVCEPASIDTVLSAGPISDRCRLLRDLDCSK 251

Query: 188 YLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIA 367
           +LVP D ++ Q   L+R R+ L  E A+F F+++ + P SA +G LY +  D D FLY+ 
Sbjct: 252 FLVPGDASMQQLMVLLRSRLVLDAEQAIFLFIDDAVLPNSACVGDLYAQRKDADGFLYMT 311

Query: 368 FSDENVYG 391
           +S E+ +G
Sbjct: 312 YSIESAFG 319


>UniRef50_UPI00004D762A Cluster: UPI00004D762A related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00004D762A UniRef100 entry -
           Xenopus tropicalis
          Length = 120

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 2/109 (1%)
 Frame = +2

Query: 71  SFEKRKAEGEKIRRKYPDRVPVIVEKAPKA-RLGDLDKKKYLVPSDLTVGQFYFLIRKRI 247
           S E R  E  ++R ++P ++PVIVE++P+  RL  L+K K+LVP ++T+GQF   IR ++
Sbjct: 12  SAENRIHEVNRVRSRFPYKIPVIVERSPQEKRLPQLEKIKFLVPPEITMGQFVNTIRCKL 71

Query: 248 HLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            L P  +L   V+   +   + TM  +Y E+ D+D FLY+++  ++V+G
Sbjct: 72  PLPPSHSLCVMVSGRQVASLAMTMSQVYSENRDQDGFLYLSYMSQDVFG 120


>UniRef50_Q23536 Cluster: Protein lgg-2; n=2; Caenorhabditis|Rep:
           Protein lgg-2 - Caenorhabditis elegans
          Length = 130

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 39/114 (34%), Positives = 69/114 (60%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +KE   F +R+ + E+IR + P++VPVI+E+    R L  +D+ K+LVP  +TV +   +
Sbjct: 17  FKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSI 76

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           +R+R+ L P+ A F  VN   +   S +M +LY +  D D F+Y+ ++ +  +G
Sbjct: 77  VRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG 130


>UniRef50_Q9H492 Cluster: Microtubule-associated proteins 1A/1B
           light chain 3A precursor; n=25; Eumetazoa|Rep:
           Microtubule-associated proteins 1A/1B light chain 3A
           precursor - Homo sapiens (Human)
          Length = 121

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 38/114 (33%), Positives = 68/114 (59%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  SF  R  E ++IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L P  A F  VN + +   S  +  +Y++  DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120


>UniRef50_Q57WE7 Cluster: Microtubule-associated protein 1A/1B,
           light chain 3, putative; n=1; Trypanosoma brucei|Rep:
           Microtubule-associated protein 1A/1B, light chain 3,
           putative - Trypanosoma brucei
          Length = 134

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 41/130 (31%), Positives = 65/130 (50%), Gaps = 16/130 (12%)
 Frame = +2

Query: 50  FQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLG----------------DLDK 181
           ++Y+   SF +R  E E  R +YP  +P++ E    A                   +LD 
Sbjct: 5   YRYQYTRSFAERAKETESARLRYPKHIPILCEPTSAASASTPRDVRLFSTRQQVQRELDC 64

Query: 182 KKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLY 361
            K+L+P   TV +F   +R+R+ L    A+F F+ N +PP SA +G +Y    D D FLY
Sbjct: 65  NKFLLPETATVMEFMMALRQRLLLEEGQAVFVFIGNELPPNSACLGDIYARAKDPDGFLY 124

Query: 362 IAFSDENVYG 391
           +++  EN +G
Sbjct: 125 VSYGVENTFG 134


>UniRef50_A0DB29 Cluster: Chromosome undetermined scaffold_44, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_44,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 131

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 38/117 (32%), Positives = 69/117 (58%), Gaps = 5/117 (4%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVG----QF 223
           ++E H+ ++R+A  +     YPD +PVI+EK PK+++  L+K+ Y +P ++ +     QF
Sbjct: 11  FRELHTVQERQAIFKDKISHYPDMIPVILEKHPKSKIQHLNKQLYFLPQNIDIYFRMIQF 70

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHD-EDFFLYIAFSDENVYG 391
              I+  + +  + +L+F + N + P    +  +Y++  D ED FLYI FSD  V+G
Sbjct: 71  RDTIKSTLQISSKQSLYFHIGNQVLPEDIKLADIYEKKKDSEDGFLYITFSDLEVFG 127


>UniRef50_Q9GZQ8 Cluster: Microtubule-associated proteins 1A/1B
           light chain 3B precursor; n=39; Coelomata|Rep:
           Microtubule-associated proteins 1A/1B light chain 3B
           precursor - Homo sapiens (Human)
          Length = 125

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 36/114 (31%), Positives = 66/114 (57%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  +FE+R  +   IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L    A F  VN + +   S  +  +Y+   DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 120


>UniRef50_UPI000155E1F7 Cluster: PREDICTED: similar to
           microtubule-associated proteins 1A/1B light chain 3;
           n=2; Laurasiatheria|Rep: PREDICTED: similar to
           microtubule-associated proteins 1A/1B light chain 3 -
           Equus caballus
          Length = 223

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 34/107 (31%), Positives = 61/107 (57%), Gaps = 2/107 (1%)
 Frame = +2

Query: 77  EKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHL 253
           E+R  +   IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +IR+R+ L
Sbjct: 112 EQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQL 171

Query: 254 RPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
               A F  VN + +   S  +  +Y+   DED FLY+ ++ +  +G
Sbjct: 172 NANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 218


>UniRef50_Q4UE40 Cluster: Autophagy protein 8I, putative; n=2;
           Theileria|Rep: Autophagy protein 8I, putative -
           Theileria annulata
          Length = 126

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 35/113 (30%), Positives = 64/113 (56%), Gaps = 9/113 (7%)
 Frame = +2

Query: 80  KRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 259
           +RK E  ++R K+ +R+PVI   +       +++ K+LVP ++  G+F +L++K ++ + 
Sbjct: 15  ERKNEVSRLRSKFRNRIPVICIPSHNNPF-KIERSKFLVPVNMMYGEFKYLLQKHLNCQL 73

Query: 260 ED---------ALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            D          ++ +VNN IP  S  +G L+++H  ED  LY+ +S EN  G
Sbjct: 74  MDDPHYYGKNSTVYLYVNNKIPKMSTLLGDLFRKHKSEDGILYMVYSSENTLG 126


>UniRef50_UPI0001554CDD Cluster: PREDICTED: hypothetical protein;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein - Ornithorhynchus anatinus
          Length = 201

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 35/98 (35%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = +2

Query: 80  KRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLR 256
           +R  E  +IR ++P+++PVI+E+   + +L  LDK K+LVP  + + +   +IR+R+ L 
Sbjct: 87  ERCKEVRQIREQHPNKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLN 146

Query: 257 PEDALFFFVNNVIPPTSAT-MGSLYQEHHDEDFFLYIA 367
           P  A F  VN     + AT +  +Y++  DED  LY+A
Sbjct: 147 PTQAFFLLVNQHSMVSVATPISEIYEQEKDEDGLLYMA 184


>UniRef50_A0CD24 Cluster: Chromosome undetermined scaffold_169,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_169,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 131

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 37/122 (30%), Positives = 67/122 (54%), Gaps = 10/122 (8%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           YK+ H+ E RK   ++   KYP+ +P+IVEK P  +L  L K K+LV S  +  +F   I
Sbjct: 9   YKDSHTLEDRKKRVQEQLAKYPEMIPIIVEKIPGCKLPQLQKVKFLVNSSFSFNEFKNTI 68

Query: 236 RKRIHLRPEDALFFFV--NNVIPPTSA-------TMGSLYQEHHD-EDFFLYIAFSDENV 385
           +K+++L  + +  F     N++   ++        + ++Y ++ D ED FLY+ ++D   
Sbjct: 69  KKKLNLDEKTSTLFMYCGKNLMNERTSYNQQLDDKLKNIYDQYKDPEDGFLYLHYADAET 128

Query: 386 YG 391
           +G
Sbjct: 129 FG 130


>UniRef50_A0BKK1 Cluster: Chromosome undetermined scaffold_112,
           whole genome shotgun sequence; n=6; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_112,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 741

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 39/104 (37%), Positives = 60/104 (57%), Gaps = 5/104 (4%)
 Frame = +2

Query: 98  EKIRRKYPDRVPVIVEKAPKARL--GDLDK-KKYLVPSDLTVGQFYFLIRKRIHLRPEDA 268
           E I  KYPDRVP++VE   K++L   D  K KKYLV        F+ ++R  + L  +++
Sbjct: 638 ESIIDKYPDRVPILVETIDKSKLRFSDGSKFKKYLVEKSDHFYHFFLILRNTLKLSKQES 697

Query: 269 LFFFVNN--VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 394
           ++ FVNN  +I P S  +G +Y ++  +D FL I  S+   +GN
Sbjct: 698 IYLFVNNTGLIKPES-QVGEVYSKYRSKDGFLRIILSEYATFGN 740


>UniRef50_UPI000155CF91 Cluster: PREDICTED: similar to GABA(A)
           receptor-associated protein like 1; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to GABA(A)
           receptor-associated protein like 1 - Ornithorhynchus
           anatinus
          Length = 92

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 28/37 (75%), Positives = 30/37 (81%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP 154
           MKFQYKE+H FE RK EGEKIR+KYPDRVPV V   P
Sbjct: 1   MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVSVVSPP 37


>UniRef50_A0CWS8 Cluster: Chromosome undetermined scaffold_3, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_3,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 121

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 30/112 (26%), Positives = 61/112 (54%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           ++   SF++RK E +  +  YP+ + V+VE+   ++L   +  K+ +P+ +T+      I
Sbjct: 7   FQNTRSFDERKNESDNCKYLYPNDILVVVEQLNTSKLPRQNFIKFKMPNTMTIINVLQYI 66

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           + +I L   D++  +   ++     T+  LYQ+  D D FLYI++ + N +G
Sbjct: 67  KSKIKLSQYDSINLYCGKILLRIDQTLKELYQQFKDLDGFLYISYIEMNSFG 118


>UniRef50_A7BJL2 Cluster: Autophagy-related gene 8 product; n=3;
           Entamoeba|Rep: Autophagy-related gene 8 product -
           Entamoeba invadens
          Length = 129

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 38/123 (30%), Positives = 63/123 (51%), Gaps = 8/123 (6%)
 Frame = +2

Query: 47  KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 226
           K  +K+  SFE+RKA   ++R+K P+ VP++V+    +   +L K ++ +P D  V  F 
Sbjct: 6   KLPFKQRVSFEERKAFAIQLRQKKPNYVPLVVDNDGTSNAINLKKDRFFIPEDSKVSDFV 65

Query: 227 -FLIRKRIHLRPEDALFFFVNNVIPPTSA-------TMGSLYQEHHDEDFFLYIAFSDEN 382
             L+ K I    E  +      +  P+ A       T+GSLY  + +ED +LY     E+
Sbjct: 66  KVLVDKYIETDGETPISTVSVKIQTPSKAVQPSNEDTIGSLYAMYQEEDGYLYFIVYRES 125

Query: 383 VYG 391
           V+G
Sbjct: 126 VFG 128


>UniRef50_Q6H6P0 Cluster: Putative autophagy-related protein 8E;
           n=3; Oryza sativa|Rep: Putative autophagy-related
           protein 8E - Oryza sativa subsp. japonica (Rice)
          Length = 87

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 25/53 (47%), Positives = 37/53 (69%), Gaps = 1/53 (1%)
 Frame = +2

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDE-DFFLYIAFSDENVYG 391
           ++++HL P  ALF FVNN +P T+  MGS+Y+ + DE D FLY+ +S E  +G
Sbjct: 35  KRKLHLPPGTALFVFVNNTLPQTAQLMGSVYESYKDEGDGFLYLCYSSEKTFG 87


>UniRef50_A0CH76 Cluster: Chromosome undetermined scaffold_18, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_18,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 110

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 30/109 (27%), Positives = 64/109 (58%), Gaps = 1/109 (0%)
 Frame = +2

Query: 68  HSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRI 247
           +S ++R+ + ++   + P+ +P+I+EK P++++  L  + Y+   +L   QF   ++  +
Sbjct: 2   YSIQERQVKFKEKLNQNPEMIPIILEKHPRSKIQGLKNQLYIYLYNLI--QFRDTLKCTL 59

Query: 248 HLRPEDALFFFVNNVIPPTSATMGSLYQEHHD-EDFFLYIAFSDENVYG 391
            + P+ +L+F + N + P    +  +YQ+  D +D FLYI +SD  V+G
Sbjct: 60  QISPKQSLYFHIGNQLLPEG--LADIYQKKKDPDDGFLYITYSDLEVFG 106


>UniRef50_A0CRP1 Cluster: Chromosome undetermined scaffold_25, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_25,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 132

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 38/130 (29%), Positives = 63/130 (48%), Gaps = 10/130 (7%)
 Frame = +2

Query: 35  NINMKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLV------ 196
           N   K  +KE H+ E+R    +  +  YP ++ +I+E+   +      ++++++      
Sbjct: 2   NAQTKSSFKERHTLEERIKLYQTKQLAYPSKILIILEQFIDSSSTSQLQQQHIIKRCAAD 61

Query: 197 PSDLTV---GQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHD-EDFFLYI 364
           P  L V   G    L +K+I      +LFFF+NNV+P    TMG L ++  D ED FLYI
Sbjct: 62  PEQLMVTFEGDISLLFKKKIPKAQHISLFFFINNVLPQKDQTMGQLQKKMQDQEDGFLYI 121

Query: 365 AFSDENVYGN 394
                   G+
Sbjct: 122 QVKSLETLGS 131


>UniRef50_A0BIR0 Cluster: Chromosome undetermined scaffold_11, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_11,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 127

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 38/127 (29%), Positives = 69/127 (54%), Gaps = 11/127 (8%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVE----KAPKARL--GDLDKKKYLVPSD 205
           MKFQ+K ++SF++R+ +  ++  +Y   +P+I+E     A K ++   DL  KK LV   
Sbjct: 1   MKFQFKTQNSFKQRQEQSFRLIERYEKMIPIILEIYIQDAEKKQIPKADLQIKKILVHEQ 60

Query: 206 LTVGQFYFLIRKRI--HLRPEDALFFFV--NNVIPPT-SATMGSLYQEHHDEDFFLYIAF 370
           ++V Q +    +R   ++  +++LF F   N +I  + S T+  LYQ+  D D +LY+  
Sbjct: 61  ISVQQIFDKFNQRFSQYIGKKESLFLFYGGNKLITNSFSQTIQKLYQQEKDIDDWLYLEL 120

Query: 371 SDENVYG 391
             +   G
Sbjct: 121 RIQETSG 127


>UniRef50_A2X5M4 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 164

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 23/47 (48%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +2

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDE-DFFLYIAFS 373
           ++++HL P  ALF FVNN +P T+  MGS+Y+ + DE D FLY+ +S
Sbjct: 97  KRKLHLSPGTALFVFVNNTLPQTAQLMGSVYESYKDEGDGFLYLCYS 143


>UniRef50_UPI00006CA3CD Cluster: hypothetical protein
           TTHERM_00526360; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00526360 - Tetrahymena
           thermophila SB210
          Length = 231

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 33/118 (27%), Positives = 64/118 (54%), Gaps = 7/118 (5%)
 Frame = +2

Query: 53  QYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYF 229
           QY++E +FE+R  + ++ ++K+P+ VP+I+E+ P  + + ++   K+L            
Sbjct: 38  QYQKEFTFEERYNDSQECKKKHPECVPLIIERHPDHKDIKEMQTPKFLFHCQSQTANAMV 97

Query: 230 LIRKRIHLRPEDALFFFVN------NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENV 385
             +K +  +    ++FFV+       +I P S  +G LYQ +   D  LYI +SD+N+
Sbjct: 98  RTQKDVQAK---KMWFFVHMPDNQLKLIYPQS-KLGVLYQRYKRSDGNLYIFYSDKNL 151


>UniRef50_A7ANM2 Cluster: Putative uncharacterized protein; n=1;
           Babesia bovis|Rep: Putative uncharacterized protein -
           Babesia bovis
          Length = 126

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/116 (21%), Positives = 59/116 (50%), Gaps = 9/116 (7%)
 Frame = +2

Query: 71  SFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKR-- 244
           S+     E   +  ++ +R+PV+       ++  + + K+LVP ++   +F ++++K   
Sbjct: 12  SYRSGHNESSDVTERFLNRIPVVCLPRNN-KVPRIARSKFLVPGNMMYAEFKYILQKHLV 70

Query: 245 -------IHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
                  +++     L+ +V + +P + A +G LY+EH   +  LY+ +++EN  G
Sbjct: 71  AENASNSVYIGKNATLYLYVADKVPVSQAAIGDLYREHRSAEGILYMTYANENSLG 126


>UniRef50_A0BIV2 Cluster: Chromosome undetermined scaffold_11, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_11,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 128

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 33/128 (25%), Positives = 68/128 (53%), Gaps = 12/128 (9%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKK-----KYLVPSD 205
           MKF+YK ++S+E+R  +   +  K+   +PVI+E   K+R L ++  K     K +V   
Sbjct: 1   MKFKYKIQNSYEQRTQQSFNLIEKHGQMIPVIIELVLKSRWLKEIFNKHKQFQKMIVRET 60

Query: 206 LTVGQFYFLIRKRIH--LRPEDALFFFV--NNVIPPTS--ATMGSLYQEHHDEDFFLYIA 367
           ++V   +  ++ + +  + P   +F +V  N ++   S   ++   Y+++ D D +LY+A
Sbjct: 61  ISVQDLFNTLKYKYYPQMTPTFGIFIYVGGNKLLLHNSFPKSLKEFYEQNKDSDGWLYLA 120

Query: 368 FSDENVYG 391
            + +  YG
Sbjct: 121 LTFQECYG 128


>UniRef50_Q4QDC8 Cluster: Microtubule associated protein-like; n=8;
           Leishmania|Rep: Microtubule associated protein-like -
           Leishmania major
          Length = 125

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 1/113 (0%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYL-VPSDLTVGQFYFL 232
           Y   +  E R+AE  +++ KYP  V V+VE A KA      K  +L +P D TV +    
Sbjct: 4   YHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAG----SKVHFLALPRDATVAELEAA 59

Query: 233 IRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           +R+ +    +  +   +    P  +AT+G +      +D FLY++   E   G
Sbjct: 60  VRQALGTSAK-KVTLAIEGSTPAVTATVGDIADACKRDDGFLYVSVRTEQAMG 111


>UniRef50_Q4QDD1 Cluster: Microtubial binding protein-like protein;
           n=5; Leishmania|Rep: Microtubial binding protein-like
           protein - Leishmania major
          Length = 136

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/105 (25%), Positives = 52/105 (49%)
 Frame = +2

Query: 77  EKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLR 256
           + R+AE E++RR++P+++PV+VE A  + +  L      V  D TV      +R+ +  R
Sbjct: 11  DARRAECERVRREHPEQLPVVVESANSSHVRFL-----AVQRDATVADLEAEVRQALG-R 64

Query: 257 PEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
               +   +    P  +  MG ++      D FL+++ + E+  G
Sbjct: 65  TNKKVALAIEGCSPAATTVMGDIFDACKQVDSFLHVSCARESSMG 109


>UniRef50_Q4QBL7 Cluster: Polyprotein, putative; n=2;
           Leishmania|Rep: Polyprotein, putative - Leishmania major
          Length = 203

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = +2

Query: 209 TVGQFYFLIRKRIHLRPEDALFFFV--NNVIPPTSATMGSLYQEHHDEDFFLYIAFSDEN 382
           +V +    +R R+ L    +LF  V  N+V+ P ++ +G LY+ + + D FLY+ +  EN
Sbjct: 120 SVAEVILTLRGRLALDSCQSLFLSVGENDVLVPGNSLLGDLYERYRNADGFLYLGYLLEN 179

Query: 383 VYG 391
            +G
Sbjct: 180 TFG 182


>UniRef50_UPI0000F2157A Cluster: PREDICTED: similar to
           Microtubule-associated protein 1 light chain 3 beta;
           n=1; Danio rerio|Rep: PREDICTED: similar to
           Microtubule-associated protein 1 light chain 3 beta -
           Danio rerio
          Length = 113

 Score = 39.1 bits (87), Expect = 0.090
 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +2

Query: 80  KRKAEGEKIRRKYPDRVPVIVEK-APKARLGDLDKKKYLVPSDLTVGQFYFLIR 238
           KR  +   IR ++P+++PVI+E+   + +L  LDK K+LVP  + + +   +IR
Sbjct: 60  KRVEDVRLIREQHPNKIPVIIERYKGEKQLPILDKTKFLVPDHVNMSELIKIIR 113


>UniRef50_UPI00006CBA81 Cluster: hypothetical protein
           TTHERM_00500940; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00500940 - Tetrahymena
           thermophila SB210
          Length = 94

 Score = 38.3 bits (85), Expect = 0.16
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVG 217
           +K+ HSFE+R  E + IR  YP  +P+  E      + D+D  K+ V  D+ VG
Sbjct: 25  FKKTHSFEERFIEYQIIRCNYPGFIPIACE---LENITDVDVSKFYVSDDIFVG 75


>UniRef50_A7RKL8 Cluster: Predicted protein; n=2; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 130

 Score = 37.1 bits (82), Expect = 0.36
 Identities = 20/67 (29%), Positives = 34/67 (50%)
 Frame = +2

Query: 104 IRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFV 283
           I++   D+V V+++ A  A +  + +KK+ V    TV      IRK I   P ++LF +V
Sbjct: 37  IKQSAKDKVEVLLKAAGDAPI--MKRKKWAVEGSKTVAYLIEFIRKYIRCEPSESLFLYV 94

Query: 284 NNVIPPT 304
                P+
Sbjct: 95  GQAFAPS 101


>UniRef50_UPI0000586F54 Cluster: PREDICTED: similar to
           Autophagy-specific protein, putative; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Autophagy-specific protein, putative -
           Strongylocentrotus purpuratus
          Length = 126

 Score = 36.3 bits (80), Expect = 0.63
 Identities = 20/80 (25%), Positives = 39/80 (48%)
 Frame = +2

Query: 62  EEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRK 241
           +     K+  EG+ +++K  D+V ++++    A +  + KKK+ V ++  V      I K
Sbjct: 20  QNDQISKQTKEGDVVKKK-SDKVDILLKATGSAPI--MKKKKWAVDANKKVAWVIDFIHK 76

Query: 242 RIHLRPEDALFFFVNNVIPP 301
            +   P  +LF +VN    P
Sbjct: 77  YLKCDPSQSLFLYVNQAFAP 96


>UniRef50_UPI00015B62AB Cluster: PREDICTED: similar to CG18255-PA;
            n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
            CG18255-PA - Nasonia vitripennis
          Length = 2871

 Score = 35.9 bits (79), Expect = 0.84
 Identities = 17/45 (37%), Positives = 30/45 (66%)
 Frame = +2

Query: 53   QYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKK 187
            ++K+E    K+K E EK++++  DR   + E+A K RL ++D+KK
Sbjct: 1510 KFKKEEEGRKKKEEAEKLKKEEEDR--KMKEEAEKLRLDEVDRKK 1552



 Score = 33.1 bits (72), Expect = 5.9
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +2

Query: 53   QYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKK 187
            Q K+E    K+K E EK++++  +R     EKA K RL + D+KK
Sbjct: 1272 QLKKEEEERKKKEEAEKLKKEEEERKK--EEKAEKLRLEEEDRKK 1314


>UniRef50_A0CES2 Cluster: Chromosome undetermined scaffold_172,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_172,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 136

 Score = 35.9 bits (79), Expect = 0.84
 Identities = 15/62 (24%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +2

Query: 212 VGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHD-EDFFLYIAFSDENVY 388
           V   +  ++ ++ +  E  L+   NN I     ++G +Y ++ + +D  LYI +S +  +
Sbjct: 75  VSSIFQTLKAKLKINQETTLYLLCNNYILQYEQSIGQVYDKYKNHDDGLLYIKYSSQETF 134

Query: 389 GN 394
           GN
Sbjct: 135 GN 136


>UniRef50_UPI0000D556FA Cluster: PREDICTED: similar to CG5987-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG5987-PA - Tribolium castaneum
          Length = 602

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 20/58 (34%), Positives = 32/58 (55%)
 Frame = +2

Query: 134 VIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTS 307
           +IVE   + RL  L +++YL+ S   +   YF ++K  +LRP D   F + + I  TS
Sbjct: 520 MIVESEERDRLQKLAQREYLIRSHGILEHVYFSMKKNGNLRPRDEKKFAIFDKIRATS 577


>UniRef50_Q16WV3 Cluster: Autophagy-specific protein, putative; n=2;
           Endopterygota|Rep: Autophagy-specific protein, putative
           - Aedes aegypti (Yellowfever mosquito)
          Length = 120

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 17/76 (22%), Positives = 35/76 (46%)
 Frame = +2

Query: 77  EKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLR 256
           E    E +K+ ++   ++ +I+     A +  L +KK+ V  +  +      I K + L 
Sbjct: 18  ENLSLEPQKVEKQETKKIDIILHATGSAPI--LKQKKWAVDQEKPISAIIKFIHKYLKLE 75

Query: 257 PEDALFFFVNNVIPPT 304
           P + LF ++N    P+
Sbjct: 76  PGEKLFLYINQTFAPS 91


>UniRef50_A0DVW5 Cluster: Chromosome undetermined scaffold_66, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_66,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 133

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 17/64 (26%), Positives = 34/64 (53%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           YK+    E+RK +    ++KYP  VP+I+++     L  LD+ + L+  + T  Q    +
Sbjct: 11  YKDVIPLEERKEKYNYYKQKYPKCVPIILQRQNNCNLIFLDRPEVLLDEEKTGNQLIQYL 70

Query: 236 RKRI 247
           + ++
Sbjct: 71  KDQL 74


>UniRef50_Q54RN5 Cluster: Autophagy protein 12; n=2; Dictyostelium
           discoideum|Rep: Autophagy protein 12 - Dictyostelium
           discoideum AX4
          Length = 124

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 20/76 (26%), Positives = 42/76 (55%), Gaps = 3/76 (3%)
 Frame = +2

Query: 173 LDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPT-SATMGSLYQ--EHHD 343
           L +KK+ + ++++       +R ++ L+  ++LF F+N V  P+    +G LY+   H+D
Sbjct: 52  LKQKKFKIQANVSFQNVIDKLRGQLKLKSNESLFLFINQVFQPSPDEILGELYKCFSHND 111

Query: 344 EDFFLYIAFSDENVYG 391
           +   L I +S +  +G
Sbjct: 112 Q---LIINYSLQMAWG 124


>UniRef50_Q4PGY2 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 840

 Score = 33.1 bits (72), Expect = 5.9
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 2/57 (3%)
 Frame = -3

Query: 222 NWPTVKSDGTKYFFLSRSPSLAFGAFST--ITGTRSGYFLRIFSPSAFLFSNECSSL 58
           +W  +  DGT    L R+PS++ G  S+  IT  ++ YF   F   A   +  C SL
Sbjct: 615 SWLDIDEDGTLDLLLQRTPSISDGLDSSRRITFVQNNYFHDSFFLKALTLNGACQSL 671


>UniRef50_Q5DBF6 Cluster: SJCHGC04003 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC04003 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 107

 Score = 32.7 bits (71), Expect = 7.8
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +2

Query: 122 DRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPP 301
           D+V ++++ A  A +  + K K+ V     +      IRK I   P ++LF +VN    P
Sbjct: 20  DKVILLLKAAGNAPV--MKKMKWSVSRKQKIHWVVDFIRKYISCDPSESLFLYVNQCFAP 77

Query: 302 T-SATMGSLY 328
              A +GSLY
Sbjct: 78  AMDAEIGSLY 87


>UniRef50_Q5D9A2 Cluster: SJCHGC09412 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC09412 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 264

 Score = 32.7 bits (71), Expect = 7.8
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 5/67 (7%)
 Frame = +2

Query: 191 LVPSDLTVGQFYFLIRKRIHLRPED---ALFFFVNNVI--PPTSATMGSLYQEHHDEDFF 355
           L P +LTVG    LIR + +L+P +   ++FF V+++     T + +  LY     + F 
Sbjct: 81  LCPPELTVGHIEKLIRMKFNLKPSEHDVSVFFSVDDLFNSDHTLSDLACLYAWRRQQPFK 140

Query: 356 LYIAFSD 376
           LY    +
Sbjct: 141 LYFTIKE 147


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 599,679,913
Number of Sequences: 1657284
Number of extensions: 12176888
Number of successful extensions: 31584
Number of sequences better than 10.0: 65
Number of HSP's better than 10.0 without gapping: 30392
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31516
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 48541014171
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).